--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:57:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1575/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -387.70          -392.02
2       -387.68          -391.12
--------------------------------------
TOTAL     -387.69          -391.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900367    0.091236    0.380552    1.503334    0.861904   1501.00   1501.00    1.002
r(A<->C){all}   0.155940    0.018780    0.000040    0.431289    0.117792     98.80    215.40    1.002
r(A<->G){all}   0.177329    0.020981    0.000060    0.460676    0.139571    110.37    148.84    1.003
r(A<->T){all}   0.165944    0.020037    0.000239    0.446151    0.131487    188.23    227.51    1.002
r(C<->G){all}   0.160616    0.018578    0.000108    0.426750    0.128281    265.68    281.96    1.001
r(C<->T){all}   0.169222    0.020580    0.000103    0.455421    0.133132    193.14    222.73    1.001
r(G<->T){all}   0.170950    0.020322    0.000140    0.457791    0.134163    177.55    186.75    1.000
pi(A){all}      0.136050    0.000415    0.098245    0.176363    0.135393    884.93   1099.83    1.000
pi(C){all}      0.270058    0.000700    0.220641    0.323632    0.269999   1308.40   1336.91    1.000
pi(G){all}      0.369925    0.000806    0.315444    0.423611    0.368996   1150.09   1179.74    1.000
pi(T){all}      0.223966    0.000618    0.177142    0.271704    0.222862   1271.07   1285.55    1.000
alpha{1,2}      0.419797    0.234434    0.000111    1.372967    0.246198    757.89    950.99    1.000
alpha{3}        0.445862    0.215030    0.000173    1.355229    0.301002   1167.29   1208.25    1.001
pinvar{all}     0.994019    0.000056    0.979377    0.999995    0.996487   1132.10   1264.09    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-371.170695
Model 2: PositiveSelection	-371.170772
Model 0: one-ratio	-371.170799
Model 7: beta	-371.170731
Model 8: beta&w>1	-371.170713


Model 0 vs 1	2.0799999992959783E-4

Model 2 vs 1	1.539999999522479E-4

Model 8 vs 7	3.6000000022795575E-5
>C1
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C2
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C3
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C4
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C5
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C6
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=97 

C1              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C2              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C3              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C4              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C5              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C6              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
                **************************************************

C1              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C2              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C3              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C4              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C5              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C6              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   97 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   97 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2910]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2910]--->[2910]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.621 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C2              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C3              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C4              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C5              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C6              LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
                **************************************************

C1              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C2              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C3              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C4              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C5              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C6              AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C2              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C3              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C4              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C5              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C6              TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
                **************************************************

C1              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C2              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C3              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C4              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C5              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C6              GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
                **************************************************

C1              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C2              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C3              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C4              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C5              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C6              TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
                **************************************************

C1              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C2              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C3              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C4              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C5              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C6              GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
                **************************************************

C1              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C2              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C3              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C4              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C5              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C6              CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
                **************************************************

C1              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C2              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C3              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C4              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C5              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C6              GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
                *****************************************



>C1
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C2
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C3
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C4
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C5
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C6
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C1
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C2
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C3
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C4
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C5
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C6
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 291 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856143
      Setting output file names to "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1862162734
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5694859264
      Seed = 1298528830
      Swapseed = 1579856143
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -651.271909 -- -24.965149
         Chain 2 -- -651.271947 -- -24.965149
         Chain 3 -- -651.271849 -- -24.965149
         Chain 4 -- -651.271947 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -651.271947 -- -24.965149
         Chain 2 -- -651.271947 -- -24.965149
         Chain 3 -- -651.271947 -- -24.965149
         Chain 4 -- -651.271947 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-651.272] (-651.272) (-651.272) (-651.272) * [-651.272] (-651.272) (-651.272) (-651.272) 
        500 -- (-417.423) (-403.825) [-394.481] (-393.869) * (-409.950) (-396.375) [-409.797] (-404.517) -- 0:00:00
       1000 -- (-403.692) (-399.401) [-402.104] (-399.075) * (-401.870) (-395.142) (-410.785) [-399.173] -- 0:00:00
       1500 -- (-399.560) (-397.604) [-400.015] (-405.806) * [-391.436] (-394.839) (-399.909) (-398.542) -- 0:00:00
       2000 -- (-402.628) (-394.992) (-403.040) [-399.874] * [-396.201] (-400.219) (-402.038) (-400.430) -- 0:00:00
       2500 -- (-393.847) [-396.007] (-395.873) (-397.227) * (-393.170) [-394.025] (-400.306) (-396.615) -- 0:00:00
       3000 -- (-401.937) [-399.537] (-395.360) (-409.283) * (-399.050) (-403.056) [-395.148] (-403.785) -- 0:00:00
       3500 -- (-397.494) (-395.138) [-398.727] (-399.586) * (-396.707) [-392.264] (-403.825) (-401.181) -- 0:00:00
       4000 -- (-391.573) (-399.660) (-397.935) [-400.472] * (-398.850) (-401.635) (-400.554) [-396.872] -- 0:00:00
       4500 -- (-400.883) (-391.862) (-395.255) [-389.710] * (-401.199) (-403.383) (-395.586) [-404.836] -- 0:00:00
       5000 -- (-401.459) [-398.096] (-402.596) (-399.731) * (-400.424) (-395.067) (-404.816) [-393.305] -- 0:00:00

      Average standard deviation of split frequencies: 0.114280

       5500 -- (-400.296) (-402.313) [-395.734] (-401.402) * (-405.960) (-394.404) [-393.784] (-394.315) -- 0:03:00
       6000 -- (-397.853) (-395.814) (-400.492) [-399.952] * (-406.781) [-391.125] (-394.331) (-407.295) -- 0:02:45
       6500 -- (-398.799) (-393.620) [-397.911] (-405.890) * (-397.271) (-394.889) [-396.470] (-404.367) -- 0:02:32
       7000 -- [-394.181] (-396.984) (-395.781) (-405.314) * [-399.588] (-396.541) (-400.078) (-403.273) -- 0:02:21
       7500 -- [-393.914] (-401.613) (-392.367) (-388.006) * (-409.132) (-395.474) (-400.438) [-399.902] -- 0:02:12
       8000 -- (-398.599) [-395.434] (-395.919) (-387.379) * (-394.900) (-399.628) (-395.429) [-400.380] -- 0:02:04
       8500 -- [-397.732] (-395.796) (-397.670) (-390.068) * (-409.720) [-396.854] (-398.090) (-401.388) -- 0:01:56
       9000 -- (-397.559) (-399.195) (-403.335) [-387.588] * (-397.223) (-398.950) [-393.772] (-405.531) -- 0:01:50
       9500 -- (-393.491) (-402.152) (-399.394) [-388.221] * (-392.676) [-402.159] (-390.303) (-402.662) -- 0:01:44
      10000 -- (-401.098) (-396.438) (-395.306) [-389.784] * (-392.623) [-400.835] (-398.390) (-403.803) -- 0:01:39

      Average standard deviation of split frequencies: 0.079970

      10500 -- [-399.146] (-393.937) (-400.174) (-389.032) * [-388.085] (-400.350) (-399.436) (-401.405) -- 0:01:34
      11000 -- (-400.732) (-396.717) [-395.314] (-390.479) * [-387.757] (-398.221) (-404.090) (-394.189) -- 0:01:29
      11500 -- (-404.305) [-399.885] (-401.410) (-389.120) * (-387.882) (-393.772) [-395.729] (-394.074) -- 0:01:25
      12000 -- (-397.988) [-391.502] (-401.205) (-390.576) * [-388.672] (-396.009) (-398.157) (-396.823) -- 0:01:22
      12500 -- (-398.463) [-393.627] (-407.865) (-389.017) * [-387.210] (-396.536) (-395.172) (-395.909) -- 0:01:19
      13000 -- [-391.441] (-397.629) (-402.670) (-388.291) * (-388.250) (-393.081) [-394.972] (-395.375) -- 0:01:15
      13500 -- (-400.017) [-396.544] (-392.477) (-389.343) * (-388.385) [-394.557] (-396.034) (-393.960) -- 0:01:13
      14000 -- (-397.213) (-400.841) (-395.851) [-390.219] * (-391.856) [-391.780] (-401.419) (-389.942) -- 0:01:10
      14500 -- (-397.753) [-396.037] (-398.471) (-389.405) * (-388.602) (-400.100) [-392.835] (-388.518) -- 0:01:07
      15000 -- (-404.164) (-399.600) (-395.207) [-388.350] * (-388.168) [-396.017] (-400.448) (-388.832) -- 0:01:05

      Average standard deviation of split frequencies: 0.072675

      15500 -- [-395.452] (-404.309) (-402.946) (-389.354) * [-387.406] (-394.190) (-391.959) (-389.361) -- 0:01:03
      16000 -- [-394.829] (-388.367) (-408.376) (-387.278) * [-386.995] (-399.227) (-398.700) (-387.196) -- 0:01:01
      16500 -- (-396.090) (-391.313) [-395.113] (-391.077) * (-387.666) [-394.739] (-394.231) (-387.499) -- 0:00:59
      17000 -- (-402.878) (-389.072) [-390.648] (-388.372) * [-389.286] (-395.795) (-402.436) (-387.921) -- 0:00:57
      17500 -- [-392.431] (-390.702) (-400.758) (-386.957) * (-388.986) (-393.389) (-394.238) [-387.879] -- 0:00:56
      18000 -- [-393.826] (-387.997) (-396.561) (-386.219) * (-387.325) (-401.014) (-399.105) [-390.420] -- 0:00:54
      18500 -- (-399.758) (-387.965) (-403.850) [-386.428] * (-390.970) (-403.198) (-400.172) [-388.267] -- 0:00:53
      19000 -- [-393.031] (-392.686) (-396.589) (-386.487) * (-393.954) (-397.069) (-418.624) [-387.812] -- 0:00:51
      19500 -- (-395.718) (-389.605) (-400.450) [-386.839] * (-387.618) (-403.696) (-410.082) [-393.485] -- 0:00:50
      20000 -- [-400.693] (-389.255) (-398.063) (-387.062) * (-390.297) (-397.970) [-386.891] (-387.231) -- 0:00:49

      Average standard deviation of split frequencies: 0.043085

      20500 -- [-394.888] (-387.549) (-393.329) (-387.074) * [-389.623] (-405.361) (-387.797) (-388.387) -- 0:00:47
      21000 -- (-397.854) (-389.304) (-397.860) [-387.560] * [-386.995] (-395.706) (-387.292) (-387.866) -- 0:00:46
      21500 -- [-393.441] (-387.444) (-398.454) (-388.602) * (-388.518) (-392.934) (-390.405) [-389.686] -- 0:00:45
      22000 -- (-399.974) (-389.182) (-412.401) [-387.881] * (-388.451) (-388.296) (-387.323) [-392.900] -- 0:01:28
      22500 -- (-400.582) (-387.934) (-389.422) [-390.010] * (-389.538) [-388.078] (-387.032) (-387.634) -- 0:01:26
      23000 -- (-404.337) [-386.717] (-389.030) (-388.898) * [-387.412] (-386.750) (-386.602) (-388.107) -- 0:01:24
      23500 -- [-403.087] (-388.523) (-388.387) (-388.256) * (-387.318) (-390.525) [-387.281] (-390.541) -- 0:01:23
      24000 -- (-404.258) (-391.566) (-387.932) [-386.799] * (-388.414) (-386.759) [-388.118] (-387.987) -- 0:01:21
      24500 -- (-398.595) (-394.028) [-388.163] (-389.792) * [-389.073] (-388.524) (-386.407) (-386.280) -- 0:01:19
      25000 -- [-397.039] (-387.535) (-387.525) (-389.196) * (-389.266) [-391.044] (-390.111) (-387.105) -- 0:01:18

      Average standard deviation of split frequencies: 0.045327

      25500 -- (-402.079) [-387.724] (-388.207) (-389.087) * (-387.258) [-388.983] (-386.986) (-387.989) -- 0:01:16
      26000 -- (-395.575) (-390.699) [-388.249] (-390.442) * (-390.308) (-386.344) (-389.167) [-392.017] -- 0:01:14
      26500 -- [-394.314] (-388.957) (-389.563) (-388.643) * (-386.024) (-395.763) [-388.254] (-386.404) -- 0:01:13
      27000 -- (-395.095) (-386.267) (-390.012) [-388.033] * (-386.353) (-389.182) [-388.498] (-386.776) -- 0:01:12
      27500 -- (-397.571) (-388.560) [-386.830] (-389.280) * (-389.224) (-388.071) [-388.784] (-392.051) -- 0:01:10
      28000 -- (-400.585) (-392.551) [-390.066] (-390.729) * (-387.830) [-388.378] (-389.713) (-390.051) -- 0:01:09
      28500 -- (-404.897) [-388.361] (-390.852) (-388.318) * (-386.516) (-389.832) (-387.685) [-388.944] -- 0:01:08
      29000 -- (-407.309) (-388.256) (-389.709) [-387.632] * (-388.379) [-390.041] (-387.831) (-393.445) -- 0:01:06
      29500 -- [-397.240] (-386.684) (-390.962) (-387.221) * (-387.751) [-390.236] (-389.697) (-387.357) -- 0:01:05
      30000 -- (-403.337) (-387.566) [-390.015] (-388.122) * (-386.459) (-387.209) (-387.166) [-387.479] -- 0:01:04

      Average standard deviation of split frequencies: 0.043041

      30500 -- (-391.581) [-387.093] (-386.541) (-389.753) * (-386.766) (-387.645) (-388.348) [-389.486] -- 0:01:03
      31000 -- (-389.651) (-388.096) [-386.160] (-386.481) * (-389.659) (-388.696) (-388.361) [-389.779] -- 0:01:02
      31500 -- (-386.231) (-390.598) (-387.688) [-388.895] * [-387.132] (-386.413) (-389.470) (-388.421) -- 0:01:01
      32000 -- (-386.642) (-388.068) (-386.269) [-387.735] * (-386.303) [-386.654] (-387.812) (-388.682) -- 0:01:00
      32500 -- [-388.194] (-386.432) (-387.652) (-392.051) * (-387.463) (-387.158) [-388.575] (-388.334) -- 0:00:59
      33000 -- (-388.277) [-387.399] (-389.872) (-388.112) * (-388.050) (-388.491) (-387.237) [-389.685] -- 0:00:58
      33500 -- (-389.623) (-391.238) [-388.366] (-389.865) * [-387.563] (-389.624) (-388.029) (-388.972) -- 0:00:57
      34000 -- (-387.801) (-389.075) (-388.117) [-389.404] * (-388.652) (-389.759) (-387.823) [-387.542] -- 0:00:56
      34500 -- (-387.881) (-389.884) (-386.539) [-390.021] * [-387.940] (-387.678) (-387.551) (-386.908) -- 0:00:55
      35000 -- [-387.679] (-391.311) (-387.578) (-387.188) * [-389.834] (-387.859) (-387.323) (-387.532) -- 0:00:55

      Average standard deviation of split frequencies: 0.039973

      35500 -- (-387.882) [-392.526] (-386.967) (-388.789) * [-391.192] (-388.617) (-388.163) (-388.242) -- 0:00:54
      36000 -- (-388.244) (-389.612) (-386.365) [-387.164] * (-390.980) (-389.163) (-388.541) [-388.617] -- 0:00:53
      36500 -- (-387.914) [-389.678] (-388.788) (-387.622) * [-386.982] (-388.563) (-390.608) (-387.291) -- 0:00:52
      37000 -- (-386.989) (-388.973) [-389.106] (-387.075) * (-388.367) (-389.066) (-387.516) [-388.932] -- 0:00:52
      37500 -- (-391.423) [-388.451] (-388.140) (-388.317) * (-388.944) (-388.775) [-387.844] (-389.925) -- 0:00:51
      38000 -- (-388.533) [-388.979] (-387.494) (-388.683) * (-390.262) [-386.773] (-387.516) (-389.079) -- 0:00:50
      38500 -- [-387.922] (-388.724) (-388.747) (-390.707) * [-388.731] (-387.167) (-386.818) (-389.144) -- 0:00:49
      39000 -- (-386.313) [-389.868] (-390.450) (-389.778) * (-389.555) (-394.597) (-386.793) [-386.811] -- 0:01:13
      39500 -- (-386.939) (-390.658) (-387.438) [-387.416] * (-386.591) (-388.880) [-386.416] (-387.637) -- 0:01:12
      40000 -- (-386.760) [-390.059] (-388.750) (-390.903) * (-387.209) [-390.272] (-389.572) (-388.098) -- 0:01:12

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-387.311) (-388.638) [-387.290] (-387.608) * (-387.516) (-389.826) (-389.123) [-386.121] -- 0:01:11
      41000 -- (-389.225) (-387.720) (-387.017) [-387.009] * [-390.700] (-389.257) (-388.065) (-390.353) -- 0:01:10
      41500 -- (-387.044) (-391.222) [-389.909] (-388.206) * (-387.405) (-388.639) (-388.041) [-388.572] -- 0:01:09
      42000 -- (-386.736) [-389.962] (-388.223) (-387.311) * [-385.997] (-388.175) (-388.947) (-387.316) -- 0:01:08
      42500 -- (-389.418) (-387.087) [-386.688] (-387.899) * (-391.127) (-387.545) (-389.032) [-388.584] -- 0:01:07
      43000 -- (-390.666) (-389.720) [-389.314] (-387.754) * [-387.728] (-387.673) (-387.443) (-392.085) -- 0:01:06
      43500 -- (-388.551) (-386.510) (-392.582) [-387.121] * (-392.099) (-387.048) [-387.787] (-387.800) -- 0:01:05
      44000 -- [-387.627] (-389.379) (-392.827) (-390.446) * (-386.817) (-387.451) [-388.199] (-387.499) -- 0:01:05
      44500 -- (-387.592) [-388.617] (-391.105) (-388.323) * [-387.935] (-393.806) (-388.838) (-388.228) -- 0:01:04
      45000 -- (-387.109) (-386.774) [-390.813] (-388.287) * (-398.841) [-388.318] (-389.831) (-392.212) -- 0:01:03

      Average standard deviation of split frequencies: 0.032607

      45500 -- (-389.839) (-391.044) (-390.919) [-386.485] * (-388.010) (-388.783) (-387.962) [-388.554] -- 0:01:02
      46000 -- (-389.587) (-386.884) (-390.677) [-388.901] * [-387.034] (-386.749) (-390.462) (-387.394) -- 0:01:02
      46500 -- [-386.532] (-392.282) (-389.077) (-387.674) * (-387.487) (-387.107) [-387.867] (-387.933) -- 0:01:01
      47000 -- (-389.930) (-389.849) (-391.028) [-389.432] * (-388.353) [-386.593] (-388.782) (-388.487) -- 0:01:00
      47500 -- (-387.481) [-389.817] (-388.031) (-388.383) * [-387.384] (-387.460) (-391.608) (-387.670) -- 0:01:00
      48000 -- (-386.622) [-389.751] (-390.338) (-390.777) * (-390.294) (-389.659) [-386.615] (-388.441) -- 0:00:59
      48500 -- (-391.181) (-388.020) [-387.890] (-390.076) * (-387.604) (-388.330) [-389.258] (-390.086) -- 0:00:58
      49000 -- (-387.687) (-389.036) (-388.836) [-388.820] * (-388.926) (-387.877) [-387.554] (-387.237) -- 0:00:58
      49500 -- [-386.770] (-387.726) (-386.685) (-390.084) * (-389.249) (-389.818) [-387.003] (-390.704) -- 0:00:57
      50000 -- (-387.686) (-388.615) (-387.179) [-389.252] * (-390.126) [-389.985] (-387.524) (-391.774) -- 0:00:57

      Average standard deviation of split frequencies: 0.033495

      50500 -- (-389.751) (-394.315) [-387.167] (-386.524) * (-388.391) (-388.355) [-386.520] (-389.903) -- 0:00:56
      51000 -- (-386.224) [-387.762] (-387.476) (-394.182) * [-387.679] (-389.641) (-388.947) (-387.767) -- 0:00:55
      51500 -- (-387.174) (-391.125) (-387.072) [-390.171] * [-386.957] (-390.024) (-391.142) (-390.238) -- 0:00:55
      52000 -- (-387.076) (-387.916) [-388.507] (-387.285) * (-388.214) [-386.337] (-387.692) (-387.795) -- 0:00:54
      52500 -- (-389.225) [-387.841] (-389.054) (-387.409) * (-386.203) [-389.786] (-388.327) (-387.243) -- 0:00:54
      53000 -- [-387.437] (-388.047) (-388.081) (-388.828) * (-387.859) [-388.099] (-387.196) (-388.457) -- 0:00:53
      53500 -- [-388.552] (-389.712) (-389.475) (-389.004) * (-390.466) [-389.853] (-390.365) (-388.943) -- 0:00:53
      54000 -- [-389.100] (-388.641) (-388.304) (-395.539) * (-387.928) [-390.503] (-391.002) (-388.542) -- 0:00:52
      54500 -- [-390.281] (-390.770) (-387.782) (-388.851) * (-387.834) [-388.150] (-395.350) (-389.009) -- 0:00:52
      55000 -- (-387.128) [-387.169] (-390.154) (-387.374) * (-388.655) (-386.379) [-387.637] (-389.475) -- 0:00:51

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-387.745) (-386.752) [-387.679] (-389.563) * (-389.069) [-386.392] (-388.346) (-388.554) -- 0:00:51
      56000 -- (-388.771) (-386.964) (-387.558) [-390.152] * (-390.535) (-388.590) [-389.605] (-387.134) -- 0:01:07
      56500 -- (-387.795) [-389.644] (-388.384) (-388.299) * (-388.620) (-388.638) [-389.413] (-389.123) -- 0:01:06
      57000 -- [-388.289] (-390.772) (-391.063) (-389.443) * (-388.840) [-386.800] (-389.023) (-389.685) -- 0:01:06
      57500 -- (-388.277) [-389.864] (-388.241) (-389.036) * (-388.363) (-387.074) [-386.868] (-389.545) -- 0:01:05
      58000 -- (-387.840) (-388.438) [-389.190] (-388.902) * (-388.199) (-388.561) [-387.303] (-387.405) -- 0:01:04
      58500 -- (-387.830) (-393.486) [-391.149] (-389.443) * (-386.850) [-389.175] (-386.670) (-390.051) -- 0:01:04
      59000 -- [-389.170] (-395.158) (-388.146) (-389.234) * (-387.307) (-389.799) [-386.866] (-388.711) -- 0:01:03
      59500 -- (-388.159) (-393.135) [-386.894] (-387.195) * [-389.223] (-390.396) (-393.098) (-386.847) -- 0:01:03
      60000 -- (-386.948) (-390.746) (-388.768) [-387.858] * (-387.138) (-389.651) (-386.806) [-386.363] -- 0:01:02

      Average standard deviation of split frequencies: 0.031539

      60500 -- (-388.768) (-388.785) [-390.791] (-390.311) * (-386.639) (-391.379) [-390.876] (-386.263) -- 0:01:02
      61000 -- (-389.134) [-387.404] (-387.301) (-387.687) * (-388.226) (-389.705) [-387.887] (-390.974) -- 0:01:01
      61500 -- (-388.821) [-387.795] (-388.487) (-388.762) * (-387.363) (-391.563) [-388.037] (-390.934) -- 0:01:01
      62000 -- [-389.591] (-391.613) (-392.368) (-388.026) * [-386.974] (-387.702) (-389.397) (-386.809) -- 0:01:00
      62500 -- (-390.229) (-388.301) [-386.771] (-390.209) * (-386.617) [-387.537] (-388.211) (-387.299) -- 0:01:00
      63000 -- (-389.126) [-387.490] (-396.987) (-389.282) * (-387.855) (-392.483) (-387.468) [-387.078] -- 0:00:59
      63500 -- (-386.203) (-387.393) (-393.028) [-390.736] * (-386.277) (-392.378) [-387.875] (-386.445) -- 0:00:58
      64000 -- (-386.608) (-395.353) [-389.578] (-390.769) * (-390.289) (-386.507) [-387.089] (-391.517) -- 0:00:58
      64500 -- (-386.194) (-386.368) (-390.144) [-388.193] * (-389.059) (-389.997) (-387.012) [-387.161] -- 0:00:58
      65000 -- (-389.564) (-386.304) [-388.214] (-386.982) * (-389.191) (-390.062) (-387.871) [-387.146] -- 0:00:57

      Average standard deviation of split frequencies: 0.027818

      65500 -- [-387.472] (-386.860) (-388.362) (-387.480) * (-389.097) [-389.651] (-386.709) (-388.447) -- 0:00:57
      66000 -- (-387.788) (-388.027) [-387.666] (-387.150) * (-389.752) (-386.790) [-386.780] (-387.196) -- 0:00:56
      66500 -- (-389.202) (-389.049) [-389.575] (-387.269) * (-389.851) [-387.616] (-388.526) (-393.085) -- 0:00:56
      67000 -- (-390.625) (-390.174) (-389.297) [-387.587] * [-387.102] (-388.482) (-388.913) (-388.338) -- 0:00:55
      67500 -- (-393.282) (-387.838) (-390.048) [-389.531] * [-388.531] (-388.330) (-389.133) (-389.413) -- 0:00:55
      68000 -- (-389.930) [-388.909] (-389.104) (-388.610) * (-390.080) (-386.583) (-388.540) [-391.242] -- 0:00:54
      68500 -- (-386.915) (-391.002) (-388.385) [-387.992] * [-391.126] (-389.936) (-387.394) (-387.579) -- 0:00:54
      69000 -- (-387.324) [-393.243] (-389.450) (-392.523) * [-389.688] (-389.257) (-388.448) (-387.363) -- 0:00:53
      69500 -- (-392.994) (-387.600) [-388.553] (-389.525) * [-389.211] (-388.445) (-388.499) (-390.693) -- 0:00:53
      70000 -- (-388.894) [-386.705] (-386.454) (-391.692) * [-388.663] (-389.516) (-391.608) (-386.002) -- 0:00:53

      Average standard deviation of split frequencies: 0.026683

      70500 -- (-389.405) (-386.621) (-387.280) [-390.454] * (-389.300) (-387.860) (-390.855) [-389.151] -- 0:00:52
      71000 -- (-387.612) [-388.272] (-386.672) (-392.866) * (-392.246) (-388.118) [-388.164] (-388.567) -- 0:00:52
      71500 -- (-386.054) (-388.637) [-387.114] (-389.190) * (-389.433) (-390.979) [-387.944] (-391.117) -- 0:00:51
      72000 -- (-387.837) [-389.623] (-389.831) (-388.211) * [-388.630] (-390.674) (-387.415) (-388.999) -- 0:00:51
      72500 -- (-388.895) (-388.564) (-390.144) [-388.945] * (-391.943) (-387.369) [-386.889] (-386.934) -- 0:00:51
      73000 -- (-389.363) [-387.546] (-391.517) (-388.775) * (-395.502) [-388.956] (-387.992) (-388.981) -- 0:01:03
      73500 -- (-390.335) [-387.041] (-390.129) (-390.121) * [-388.814] (-389.439) (-388.793) (-389.604) -- 0:01:03
      74000 -- (-388.746) (-386.816) [-388.651] (-388.316) * (-391.333) (-388.851) (-389.133) [-389.209] -- 0:01:02
      74500 -- (-388.162) (-388.286) (-391.002) [-386.876] * (-389.428) (-388.505) [-389.142] (-389.274) -- 0:01:02
      75000 -- (-388.061) (-395.708) [-391.864] (-387.656) * (-389.326) (-388.063) (-386.567) [-386.600] -- 0:01:01

      Average standard deviation of split frequencies: 0.023178

      75500 -- (-388.074) [-391.955] (-388.778) (-392.550) * (-389.183) (-390.316) [-387.304] (-389.026) -- 0:01:01
      76000 -- (-390.132) (-388.870) [-389.890] (-390.656) * (-388.403) (-388.626) (-388.109) [-388.216] -- 0:01:00
      76500 -- [-386.610] (-386.926) (-389.567) (-387.672) * (-388.496) (-390.043) (-387.115) [-387.208] -- 0:01:00
      77000 -- (-389.896) [-386.012] (-389.075) (-388.853) * (-386.935) (-387.878) [-387.500] (-392.480) -- 0:00:59
      77500 -- [-388.399] (-387.430) (-387.442) (-395.435) * (-389.508) (-387.402) (-387.253) [-391.536] -- 0:00:59
      78000 -- (-388.607) [-386.771] (-387.569) (-391.708) * (-388.004) (-388.035) (-393.217) [-387.208] -- 0:00:59
      78500 -- [-386.772] (-387.509) (-388.138) (-388.059) * (-389.715) (-391.093) (-388.862) [-391.191] -- 0:00:58
      79000 -- (-386.008) [-387.284] (-386.728) (-389.007) * [-388.203] (-391.991) (-389.136) (-387.254) -- 0:00:58
      79500 -- [-386.017] (-388.125) (-389.743) (-391.435) * (-387.610) [-395.395] (-386.951) (-391.645) -- 0:00:57
      80000 -- (-389.198) (-389.649) (-388.676) [-386.578] * (-388.306) (-386.631) (-386.741) [-389.197] -- 0:00:57

      Average standard deviation of split frequencies: 0.023375

      80500 -- [-387.148] (-386.646) (-388.979) (-387.394) * (-387.249) (-388.061) [-388.095] (-387.361) -- 0:00:57
      81000 -- (-387.637) (-391.359) (-386.925) [-387.194] * (-386.758) (-388.018) [-386.599] (-390.389) -- 0:00:56
      81500 -- (-386.620) (-387.191) (-387.881) [-388.799] * (-386.328) [-387.368] (-391.540) (-390.066) -- 0:00:56
      82000 -- [-387.997] (-386.018) (-387.904) (-388.400) * (-387.890) (-388.347) [-392.697] (-391.551) -- 0:00:55
      82500 -- [-387.068] (-386.160) (-390.795) (-388.141) * [-387.382] (-388.907) (-392.036) (-389.748) -- 0:00:55
      83000 -- (-388.018) [-390.097] (-388.167) (-391.748) * (-388.021) (-389.520) (-394.295) [-389.122] -- 0:00:55
      83500 -- (-389.802) [-387.053] (-390.602) (-390.325) * (-387.980) (-390.638) (-391.099) [-390.713] -- 0:00:54
      84000 -- (-386.689) (-390.531) (-392.502) [-388.792] * [-386.748] (-388.531) (-387.748) (-389.926) -- 0:00:54
      84500 -- [-393.250] (-386.870) (-394.820) (-392.452) * [-388.201] (-388.512) (-389.070) (-388.352) -- 0:00:54
      85000 -- (-387.198) [-386.917] (-392.083) (-389.751) * (-388.982) (-389.575) (-388.352) [-388.486] -- 0:00:53

      Average standard deviation of split frequencies: 0.024667

      85500 -- [-388.635] (-386.753) (-388.609) (-392.477) * (-388.776) [-388.336] (-387.161) (-386.786) -- 0:00:53
      86000 -- (-387.683) [-386.634] (-388.391) (-387.997) * (-386.914) [-387.307] (-388.454) (-388.659) -- 0:00:53
      86500 -- [-388.884] (-387.382) (-387.011) (-389.393) * [-386.403] (-388.737) (-388.737) (-388.731) -- 0:00:52
      87000 -- (-387.336) [-389.561] (-386.569) (-395.825) * (-386.215) (-387.576) [-388.105] (-390.329) -- 0:00:52
      87500 -- (-391.091) (-388.519) [-387.719] (-395.668) * (-387.742) [-389.131] (-392.739) (-386.782) -- 0:00:52
      88000 -- (-387.266) (-388.258) (-392.003) [-389.887] * [-387.033] (-390.380) (-386.380) (-390.437) -- 0:00:51
      88500 -- [-388.691] (-389.240) (-388.729) (-386.694) * (-387.325) (-387.063) [-387.332] (-388.737) -- 0:00:51
      89000 -- (-388.228) (-387.613) [-391.507] (-388.626) * (-395.953) (-387.507) (-388.441) [-388.764] -- 0:00:51
      89500 -- (-388.370) [-387.302] (-386.341) (-390.158) * (-389.086) (-390.679) [-389.706] (-386.658) -- 0:01:01
      90000 -- [-387.486] (-390.676) (-387.320) (-389.896) * (-387.908) [-391.821] (-387.149) (-387.554) -- 0:01:00

      Average standard deviation of split frequencies: 0.023137

      90500 -- (-389.308) [-389.235] (-388.506) (-388.021) * [-389.784] (-389.654) (-386.455) (-388.653) -- 0:01:00
      91000 -- [-388.823] (-390.965) (-389.147) (-387.437) * [-387.428] (-387.037) (-387.768) (-388.031) -- 0:00:59
      91500 -- (-390.599) [-391.022] (-386.932) (-388.326) * (-389.847) [-393.307] (-387.519) (-390.563) -- 0:00:59
      92000 -- (-390.201) (-388.117) [-388.920] (-388.356) * [-387.549] (-391.632) (-388.128) (-389.316) -- 0:00:59
      92500 -- (-390.906) (-387.272) [-386.193] (-391.408) * (-386.600) [-387.268] (-388.338) (-388.750) -- 0:00:58
      93000 -- (-389.304) [-388.135] (-388.721) (-388.144) * (-386.074) (-390.407) [-387.049] (-386.544) -- 0:00:58
      93500 -- (-389.726) [-388.765] (-388.960) (-387.831) * (-390.824) (-389.375) (-386.728) [-387.358] -- 0:00:58
      94000 -- (-390.228) (-388.270) [-388.088] (-387.242) * [-388.822] (-389.219) (-388.396) (-390.437) -- 0:00:57
      94500 -- (-389.588) (-388.664) (-388.011) [-387.262] * (-391.351) [-388.576] (-389.676) (-389.168) -- 0:00:57
      95000 -- (-388.041) (-388.587) (-387.045) [-387.646] * (-392.131) [-391.643] (-391.849) (-388.691) -- 0:00:57

      Average standard deviation of split frequencies: 0.018005

      95500 -- [-389.444] (-386.634) (-387.979) (-390.556) * (-389.772) (-390.222) [-390.190] (-386.824) -- 0:00:56
      96000 -- (-391.029) (-386.546) (-390.049) [-388.569] * (-396.796) [-387.149] (-388.357) (-392.213) -- 0:00:56
      96500 -- (-386.497) (-389.504) [-386.496] (-387.861) * [-387.667] (-388.555) (-390.076) (-395.068) -- 0:00:56
      97000 -- (-388.871) (-387.883) (-388.430) [-388.253] * (-390.143) (-386.581) (-389.477) [-387.420] -- 0:00:55
      97500 -- (-388.150) [-389.066] (-387.991) (-386.616) * (-390.969) (-387.106) [-389.512] (-391.073) -- 0:00:55
      98000 -- (-389.722) [-386.457] (-386.987) (-389.189) * [-389.830] (-390.694) (-387.820) (-389.199) -- 0:00:55
      98500 -- (-391.626) (-389.521) (-387.949) [-389.289] * (-386.981) (-388.955) (-386.287) [-390.296] -- 0:00:54
      99000 -- (-386.593) [-386.375] (-388.950) (-390.122) * [-388.321] (-389.481) (-390.990) (-387.869) -- 0:00:54
      99500 -- (-387.327) [-388.570] (-387.521) (-392.750) * (-392.874) [-386.520] (-389.809) (-387.534) -- 0:00:54
      100000 -- (-389.344) [-387.789] (-389.868) (-390.612) * (-389.952) (-388.376) [-388.068] (-392.881) -- 0:00:54

      Average standard deviation of split frequencies: 0.017691

      100500 -- [-389.417] (-387.218) (-387.966) (-386.591) * (-390.980) [-386.938] (-391.427) (-390.477) -- 0:00:53
      101000 -- [-388.009] (-387.461) (-386.921) (-386.670) * (-389.006) [-393.715] (-387.905) (-388.723) -- 0:00:53
      101500 -- (-386.724) (-387.902) [-386.548] (-390.930) * (-388.739) (-396.512) [-388.271] (-393.408) -- 0:00:53
      102000 -- [-386.200] (-388.626) (-390.143) (-388.182) * (-388.910) [-389.771] (-387.149) (-391.175) -- 0:00:52
      102500 -- (-390.216) (-387.404) (-390.093) [-387.664] * (-388.998) [-386.788] (-389.293) (-387.033) -- 0:00:52
      103000 -- (-388.748) [-387.249] (-387.421) (-386.984) * (-392.981) [-389.206] (-389.835) (-389.218) -- 0:00:52
      103500 -- (-390.240) (-387.634) [-387.543] (-388.151) * (-387.829) (-388.378) [-388.655] (-388.721) -- 0:00:51
      104000 -- (-390.235) (-392.461) [-389.348] (-386.635) * (-387.149) (-387.703) (-389.315) [-392.069] -- 0:00:51
      104500 -- (-391.461) (-391.296) [-387.772] (-390.779) * (-387.920) (-390.692) [-390.390] (-387.200) -- 0:00:51
      105000 -- (-387.804) (-387.252) (-386.383) [-389.785] * [-386.946] (-387.275) (-388.868) (-389.837) -- 0:00:51

      Average standard deviation of split frequencies: 0.017048

      105500 -- (-387.557) [-386.497] (-389.885) (-388.467) * (-387.849) (-388.156) [-386.924] (-387.654) -- 0:00:50
      106000 -- (-386.815) [-392.036] (-388.836) (-389.495) * (-389.054) (-388.167) [-386.223] (-390.534) -- 0:00:50
      106500 -- (-387.443) (-388.335) [-389.841] (-392.236) * (-387.335) [-389.730] (-386.505) (-393.545) -- 0:00:58
      107000 -- (-386.372) [-391.763] (-387.072) (-388.902) * (-388.936) (-392.181) (-387.361) [-387.528] -- 0:00:58
      107500 -- (-389.509) (-391.191) (-387.368) [-388.435] * [-389.679] (-389.341) (-387.083) (-389.553) -- 0:00:58
      108000 -- (-388.557) [-389.060] (-389.827) (-391.386) * (-387.459) (-387.086) [-385.988] (-387.844) -- 0:00:57
      108500 -- (-391.208) (-388.464) (-390.661) [-390.691] * [-388.539] (-389.103) (-386.855) (-389.289) -- 0:00:57
      109000 -- [-388.479] (-388.472) (-389.599) (-388.288) * (-387.171) [-388.214] (-390.216) (-390.157) -- 0:00:57
      109500 -- (-396.209) (-388.770) (-389.346) [-386.766] * [-391.284] (-390.338) (-388.170) (-387.885) -- 0:00:56
      110000 -- (-391.536) [-387.442] (-387.593) (-393.863) * [-388.740] (-390.317) (-388.359) (-388.163) -- 0:00:56

      Average standard deviation of split frequencies: 0.021074

      110500 -- [-389.489] (-386.790) (-387.401) (-387.402) * (-387.517) (-389.936) (-390.698) [-388.351] -- 0:00:56
      111000 -- (-390.543) (-387.063) (-387.831) [-387.429] * (-388.033) [-389.094] (-387.874) (-386.696) -- 0:00:56
      111500 -- [-386.252] (-389.728) (-386.765) (-390.202) * (-386.161) (-391.410) [-389.221] (-388.193) -- 0:00:55
      112000 -- [-387.589] (-388.997) (-387.188) (-391.770) * (-386.183) (-390.438) (-387.027) [-387.992] -- 0:00:55
      112500 -- (-388.534) [-387.303] (-390.538) (-388.306) * (-388.269) (-387.206) [-387.665] (-389.965) -- 0:00:55
      113000 -- (-390.204) (-386.998) (-390.149) [-386.539] * (-390.034) (-386.182) [-391.537] (-386.768) -- 0:00:54
      113500 -- (-390.951) (-390.903) [-387.953] (-387.130) * (-387.131) (-389.889) (-391.927) [-386.612] -- 0:00:54
      114000 -- [-387.818] (-391.810) (-389.619) (-391.652) * (-388.514) (-387.734) [-390.483] (-388.069) -- 0:00:54
      114500 -- (-387.063) (-393.561) [-390.221] (-389.405) * [-389.438] (-389.790) (-394.700) (-389.411) -- 0:00:54
      115000 -- [-386.623] (-393.043) (-389.239) (-387.850) * (-388.711) (-389.067) [-389.528] (-388.412) -- 0:00:53

      Average standard deviation of split frequencies: 0.019678

      115500 -- (-390.766) (-388.348) (-388.589) [-388.922] * (-388.803) (-387.778) (-388.618) [-387.502] -- 0:00:53
      116000 -- (-391.281) (-388.555) (-387.374) [-391.909] * (-387.219) (-389.353) (-387.929) [-388.324] -- 0:00:53
      116500 -- (-388.462) (-391.899) [-390.836] (-392.912) * (-386.482) (-391.455) [-391.282] (-389.372) -- 0:00:53
      117000 -- [-388.261] (-392.220) (-388.522) (-387.616) * (-387.421) (-386.233) [-391.245] (-389.579) -- 0:00:52
      117500 -- [-389.268] (-390.516) (-392.272) (-392.349) * (-389.322) [-387.026] (-387.625) (-387.714) -- 0:00:52
      118000 -- [-388.849] (-390.622) (-389.684) (-400.187) * (-387.042) (-388.911) (-389.503) [-387.477] -- 0:00:52
      118500 -- (-389.070) [-387.368] (-390.929) (-391.074) * (-391.532) (-386.878) (-389.523) [-386.692] -- 0:00:52
      119000 -- (-387.063) (-387.145) (-389.391) [-386.418] * (-387.067) (-386.918) (-388.864) [-388.740] -- 0:00:51
      119500 -- [-386.547] (-387.595) (-394.072) (-386.959) * (-387.097) (-387.479) (-394.015) [-388.042] -- 0:00:51
      120000 -- [-387.596] (-389.881) (-394.528) (-391.889) * (-387.428) (-388.257) (-386.686) [-390.386] -- 0:00:51

      Average standard deviation of split frequencies: 0.021682

      120500 -- [-387.901] (-390.224) (-395.394) (-392.388) * (-386.687) [-388.805] (-389.007) (-389.484) -- 0:00:51
      121000 -- (-388.227) [-387.452] (-388.553) (-390.240) * (-386.846) [-390.072] (-387.980) (-387.493) -- 0:00:50
      121500 -- (-390.786) (-386.908) [-388.773] (-390.154) * [-387.391] (-389.954) (-387.582) (-388.900) -- 0:00:50
      122000 -- (-387.810) (-391.382) [-390.263] (-387.827) * (-388.613) (-387.697) (-387.598) [-390.643] -- 0:00:50
      122500 -- [-387.571] (-388.829) (-387.665) (-390.782) * (-388.171) (-390.013) (-392.550) [-389.299] -- 0:00:50
      123000 -- [-387.107] (-390.106) (-389.216) (-394.828) * (-387.410) (-390.414) (-387.941) [-387.206] -- 0:00:49
      123500 -- (-387.539) (-389.919) (-387.426) [-388.508] * [-386.377] (-391.277) (-387.543) (-389.250) -- 0:00:56
      124000 -- [-387.806] (-391.454) (-390.715) (-387.718) * (-387.887) (-388.483) (-387.734) [-390.515] -- 0:00:56
      124500 -- (-388.079) (-390.731) (-390.539) [-388.459] * (-388.492) (-386.866) [-392.820] (-388.620) -- 0:00:56
      125000 -- (-386.081) (-389.375) (-389.062) [-390.638] * (-391.926) (-387.028) (-388.787) [-390.097] -- 0:00:56

      Average standard deviation of split frequencies: 0.020951

      125500 -- (-389.421) (-391.728) (-388.108) [-388.364] * (-387.045) (-388.757) [-387.963] (-387.036) -- 0:00:55
      126000 -- [-387.752] (-390.819) (-387.518) (-390.381) * (-388.734) (-387.892) [-386.424] (-388.080) -- 0:00:55
      126500 -- [-387.618] (-386.574) (-387.335) (-393.136) * [-388.921] (-387.859) (-389.811) (-389.792) -- 0:00:55
      127000 -- (-386.939) (-386.858) (-387.208) [-387.663] * (-391.378) [-390.954] (-389.047) (-386.825) -- 0:00:54
      127500 -- [-389.138] (-387.464) (-387.321) (-387.837) * (-390.168) (-394.469) (-387.332) [-390.104] -- 0:00:54
      128000 -- (-390.017) [-388.796] (-387.207) (-388.839) * [-388.476] (-392.238) (-391.581) (-392.761) -- 0:00:54
      128500 -- (-391.876) (-386.608) (-389.280) [-386.984] * [-389.223] (-390.288) (-391.539) (-386.878) -- 0:00:54
      129000 -- (-390.378) [-387.763] (-392.859) (-387.117) * (-391.486) (-388.819) [-388.414] (-388.948) -- 0:00:54
      129500 -- (-392.317) [-387.609] (-391.066) (-387.815) * [-387.948] (-388.146) (-388.418) (-390.057) -- 0:00:53
      130000 -- (-390.073) [-386.171] (-389.210) (-387.892) * (-392.560) (-392.529) (-387.559) [-390.296] -- 0:00:53

      Average standard deviation of split frequencies: 0.020023

      130500 -- (-390.595) [-390.757] (-390.156) (-388.572) * (-391.033) [-388.321] (-392.193) (-387.942) -- 0:00:53
      131000 -- (-387.516) (-388.263) [-388.494] (-389.324) * (-393.210) (-388.405) [-387.768] (-386.844) -- 0:00:53
      131500 -- (-389.150) (-386.587) (-387.612) [-386.417] * (-389.820) (-393.507) [-390.319] (-389.148) -- 0:00:52
      132000 -- [-388.845] (-390.027) (-388.118) (-390.127) * [-388.721] (-388.495) (-389.463) (-392.367) -- 0:00:52
      132500 -- (-387.648) [-387.144] (-387.433) (-390.468) * (-393.719) (-389.566) (-387.929) [-387.981] -- 0:00:52
      133000 -- [-388.469] (-386.406) (-387.543) (-389.458) * (-391.073) (-390.381) [-390.491] (-387.478) -- 0:00:52
      133500 -- (-391.532) [-387.395] (-387.762) (-390.540) * (-390.684) [-386.926] (-395.195) (-389.042) -- 0:00:51
      134000 -- [-388.338] (-390.902) (-389.085) (-390.038) * (-393.988) [-386.430] (-391.108) (-389.660) -- 0:00:51
      134500 -- [-387.887] (-388.700) (-387.213) (-390.235) * (-390.569) [-393.127] (-391.542) (-387.136) -- 0:00:51
      135000 -- (-386.829) (-387.808) (-391.300) [-388.849] * (-387.590) (-387.539) (-389.380) [-387.930] -- 0:00:51

      Average standard deviation of split frequencies: 0.021345

      135500 -- (-393.392) (-390.961) [-388.753] (-387.573) * [-387.880] (-386.269) (-392.366) (-391.855) -- 0:00:51
      136000 -- [-386.226] (-387.741) (-391.453) (-388.646) * (-388.795) [-387.447] (-392.644) (-391.758) -- 0:00:50
      136500 -- (-386.848) (-387.196) [-391.036] (-388.642) * [-388.212] (-388.084) (-396.856) (-386.916) -- 0:00:50
      137000 -- (-387.325) (-391.258) (-391.175) [-391.248] * (-390.708) (-388.806) (-388.854) [-387.945] -- 0:00:50
      137500 -- (-388.785) (-389.199) [-389.347] (-390.719) * (-388.987) [-387.690] (-388.377) (-387.080) -- 0:00:50
      138000 -- (-390.392) (-393.547) (-386.340) [-391.310] * [-388.250] (-388.302) (-389.112) (-387.455) -- 0:00:49
      138500 -- (-387.759) (-386.870) [-387.156] (-393.616) * (-393.622) (-386.734) (-390.835) [-388.021] -- 0:00:49
      139000 -- (-387.264) (-390.991) (-387.282) [-390.093] * (-388.244) (-389.226) [-388.078] (-389.684) -- 0:00:49
      139500 -- (-386.759) [-386.696] (-386.658) (-391.102) * (-388.813) (-386.850) [-388.857] (-386.973) -- 0:00:49
      140000 -- (-387.847) (-388.914) (-388.209) [-390.778] * (-386.473) (-389.210) [-387.501] (-386.279) -- 0:00:55

      Average standard deviation of split frequencies: 0.020636

      140500 -- (-394.370) (-389.938) (-387.876) [-388.156] * (-388.661) (-394.048) [-388.905] (-387.223) -- 0:00:55
      141000 -- [-388.993] (-387.571) (-386.603) (-390.834) * (-386.753) (-387.205) [-390.026] (-391.776) -- 0:00:54
      141500 -- (-390.421) [-387.645] (-388.213) (-389.859) * [-387.557] (-387.374) (-386.775) (-386.702) -- 0:00:54
      142000 -- (-388.381) (-386.799) [-388.875] (-393.844) * (-386.812) [-387.681] (-387.882) (-387.508) -- 0:00:54
      142500 -- (-387.044) (-386.079) [-387.921] (-391.828) * (-388.058) [-388.517] (-387.059) (-388.740) -- 0:00:54
      143000 -- (-386.414) [-387.585] (-388.353) (-387.137) * (-386.869) [-390.001] (-387.881) (-393.825) -- 0:00:53
      143500 -- (-387.013) (-389.009) [-393.324] (-389.545) * (-389.978) [-386.382] (-388.525) (-389.932) -- 0:00:53
      144000 -- (-387.185) (-388.790) [-389.100] (-389.914) * (-387.602) (-387.126) (-388.914) [-392.020] -- 0:00:53
      144500 -- (-386.993) (-389.231) [-388.522] (-389.703) * (-389.446) (-387.976) (-388.232) [-386.469] -- 0:00:53
      145000 -- [-388.377] (-390.396) (-387.253) (-387.664) * (-388.316) (-390.416) [-386.239] (-387.911) -- 0:00:53

      Average standard deviation of split frequencies: 0.019203

      145500 -- (-392.115) (-386.611) [-390.061] (-388.223) * (-387.131) (-388.263) [-387.819] (-389.573) -- 0:00:52
      146000 -- (-386.291) (-387.704) [-388.996] (-386.133) * (-390.335) [-386.757] (-388.728) (-388.915) -- 0:00:52
      146500 -- (-386.361) [-389.101] (-387.312) (-386.746) * (-389.365) [-387.673] (-386.237) (-386.823) -- 0:00:52
      147000 -- (-387.010) (-387.622) [-386.846] (-390.435) * (-387.728) (-392.121) [-386.773] (-389.205) -- 0:00:52
      147500 -- (-388.698) (-387.355) [-386.760] (-390.813) * (-391.900) (-389.948) (-386.853) [-388.302] -- 0:00:52
      148000 -- [-388.215] (-391.373) (-387.298) (-389.095) * (-387.383) (-388.152) [-387.141] (-388.099) -- 0:00:51
      148500 -- (-388.106) (-390.898) [-386.052] (-388.915) * (-387.000) (-391.159) [-387.334] (-386.552) -- 0:00:51
      149000 -- [-386.733] (-388.894) (-386.943) (-394.002) * [-387.488] (-388.344) (-390.515) (-388.381) -- 0:00:51
      149500 -- (-389.578) (-390.704) [-387.474] (-395.736) * (-396.886) (-387.647) [-390.853] (-390.126) -- 0:00:51
      150000 -- (-389.629) (-386.897) (-387.841) [-389.553] * (-392.842) (-388.224) (-387.373) [-388.900] -- 0:00:51

      Average standard deviation of split frequencies: 0.018773

      150500 -- (-388.525) (-389.072) (-390.187) [-388.359] * (-389.906) [-386.964] (-388.902) (-387.955) -- 0:00:50
      151000 -- (-387.435) (-387.547) (-387.536) [-387.288] * (-387.392) (-389.082) (-390.552) [-390.175] -- 0:00:50
      151500 -- (-388.333) [-386.803] (-387.802) (-390.335) * (-389.649) (-389.187) [-389.352] (-386.353) -- 0:00:50
      152000 -- (-389.212) (-395.623) [-389.919] (-388.039) * (-390.381) (-388.553) (-391.464) [-386.756] -- 0:00:50
      152500 -- (-389.744) (-390.193) [-388.086] (-391.072) * [-386.458] (-391.901) (-387.552) (-389.253) -- 0:00:50
      153000 -- (-388.189) (-388.739) [-387.067] (-388.265) * (-386.568) (-389.640) [-387.342] (-391.027) -- 0:00:49
      153500 -- (-388.180) [-388.881] (-388.300) (-391.181) * [-386.366] (-390.112) (-390.187) (-387.567) -- 0:00:49
      154000 -- (-388.732) [-389.865] (-392.364) (-390.188) * (-390.270) [-388.926] (-387.618) (-387.908) -- 0:00:49
      154500 -- [-386.525] (-393.134) (-388.265) (-390.428) * (-387.068) [-386.368] (-387.520) (-387.269) -- 0:00:49
      155000 -- [-387.578] (-389.630) (-387.984) (-390.114) * (-390.001) [-386.627] (-389.599) (-388.204) -- 0:00:49

      Average standard deviation of split frequencies: 0.020313

      155500 -- (-389.677) (-389.742) (-386.928) [-389.866] * (-387.855) (-394.405) [-388.260] (-387.797) -- 0:00:48
      156000 -- [-386.627] (-389.505) (-387.265) (-387.024) * [-389.071] (-389.462) (-386.805) (-390.220) -- 0:00:48
      156500 -- (-388.647) (-387.452) (-390.202) [-391.016] * (-387.151) (-387.547) [-387.865] (-387.629) -- 0:00:48
      157000 -- (-387.938) [-387.052] (-389.861) (-392.149) * (-386.842) (-385.975) (-389.349) [-386.800] -- 0:00:53
      157500 -- (-390.586) (-389.551) (-391.558) [-392.131] * (-389.852) (-387.840) [-387.279] (-387.726) -- 0:00:53
      158000 -- (-388.235) [-386.184] (-387.874) (-389.232) * (-390.081) (-389.592) [-388.213] (-396.984) -- 0:00:53
      158500 -- (-391.630) (-389.107) [-387.349] (-392.814) * [-388.969] (-389.109) (-386.967) (-392.998) -- 0:00:53
      159000 -- (-387.292) (-389.017) [-387.017] (-386.913) * (-389.588) (-386.567) [-387.982] (-386.212) -- 0:00:52
      159500 -- [-388.213] (-386.113) (-388.036) (-392.718) * (-389.907) (-386.773) (-386.822) [-388.103] -- 0:00:52
      160000 -- (-392.285) [-390.003] (-387.593) (-388.543) * (-389.426) (-390.145) (-386.609) [-387.141] -- 0:00:52

      Average standard deviation of split frequencies: 0.020538

      160500 -- (-391.283) [-388.562] (-388.718) (-389.217) * [-388.902] (-387.389) (-388.492) (-386.962) -- 0:00:52
      161000 -- (-388.763) (-387.576) [-387.429] (-392.218) * [-386.776] (-388.847) (-390.731) (-390.128) -- 0:00:52
      161500 -- (-386.202) [-387.744] (-387.192) (-392.340) * [-388.807] (-387.769) (-391.728) (-386.369) -- 0:00:51
      162000 -- [-386.872] (-388.779) (-389.065) (-387.781) * (-387.045) (-390.350) [-389.600] (-388.104) -- 0:00:51
      162500 -- (-388.150) [-386.661] (-389.113) (-386.852) * [-389.133] (-388.140) (-389.045) (-388.063) -- 0:00:51
      163000 -- (-389.111) [-386.870] (-387.356) (-391.304) * [-387.720] (-388.893) (-387.992) (-387.063) -- 0:00:51
      163500 -- (-389.954) (-387.759) (-387.186) [-390.044] * (-386.351) (-388.325) [-387.512] (-388.830) -- 0:00:51
      164000 -- (-386.936) [-387.879] (-388.410) (-388.563) * (-387.666) [-389.570] (-389.131) (-390.594) -- 0:00:50
      164500 -- [-387.045] (-388.369) (-394.963) (-389.334) * (-386.700) [-386.439] (-391.567) (-388.060) -- 0:00:50
      165000 -- (-388.995) (-388.538) [-394.205] (-388.544) * (-388.183) (-388.475) (-387.324) [-386.591] -- 0:00:50

      Average standard deviation of split frequencies: 0.020327

      165500 -- (-392.099) (-387.205) (-388.036) [-388.396] * (-389.871) (-390.833) [-387.081] (-386.645) -- 0:00:50
      166000 -- (-387.410) [-386.308] (-391.762) (-388.059) * (-388.821) (-387.032) (-389.678) [-389.854] -- 0:00:50
      166500 -- (-390.608) [-387.578] (-398.963) (-387.057) * [-388.927] (-386.167) (-389.358) (-387.299) -- 0:00:50
      167000 -- [-390.350] (-392.390) (-388.462) (-387.601) * (-391.310) (-390.266) (-388.311) [-390.480] -- 0:00:49
      167500 -- [-387.571] (-387.909) (-387.038) (-391.241) * [-388.999] (-389.908) (-390.752) (-389.419) -- 0:00:49
      168000 -- (-388.425) (-386.639) (-387.655) [-390.380] * (-386.651) [-390.503] (-390.604) (-386.934) -- 0:00:49
      168500 -- (-388.292) (-389.129) (-388.662) [-388.904] * (-387.108) [-388.105] (-389.031) (-387.005) -- 0:00:49
      169000 -- [-388.142] (-387.432) (-388.658) (-391.993) * (-386.462) [-388.892] (-387.522) (-388.970) -- 0:00:49
      169500 -- (-390.662) [-387.793] (-387.068) (-387.332) * (-388.201) [-387.213] (-387.348) (-389.236) -- 0:00:48
      170000 -- [-388.624] (-388.818) (-386.566) (-387.420) * (-389.026) [-388.425] (-389.260) (-387.001) -- 0:00:48

      Average standard deviation of split frequencies: 0.019488

      170500 -- (-388.666) [-390.519] (-388.490) (-386.545) * (-389.103) (-389.631) [-390.665] (-386.967) -- 0:00:48
      171000 -- (-389.808) (-387.445) (-386.850) [-387.570] * (-387.352) [-387.808] (-387.353) (-388.968) -- 0:00:48
      171500 -- (-390.284) [-388.867] (-387.332) (-388.169) * (-389.430) [-391.054] (-388.582) (-387.173) -- 0:00:48
      172000 -- [-391.941] (-388.101) (-390.920) (-389.388) * (-387.303) [-388.182] (-388.238) (-392.387) -- 0:00:48
      172500 -- [-386.739] (-390.147) (-396.502) (-388.606) * (-389.710) (-387.571) [-387.242] (-390.593) -- 0:00:47
      173000 -- (-388.779) (-388.031) (-390.717) [-389.533] * (-387.190) [-386.791] (-387.312) (-387.178) -- 0:00:47
      173500 -- (-387.691) [-388.762] (-388.670) (-390.182) * (-387.680) [-388.717] (-390.159) (-388.589) -- 0:00:47
      174000 -- (-388.853) (-386.750) (-390.374) [-386.833] * (-389.131) [-386.779] (-386.723) (-388.008) -- 0:00:52
      174500 -- (-389.673) (-389.499) (-389.582) [-386.509] * (-389.741) [-389.170] (-387.833) (-393.837) -- 0:00:52
      175000 -- (-386.829) (-386.845) (-389.344) [-390.620] * [-389.602] (-391.295) (-386.631) (-391.386) -- 0:00:51

      Average standard deviation of split frequencies: 0.018044

      175500 -- (-387.574) (-387.074) (-389.078) [-390.162] * [-388.927] (-393.584) (-387.494) (-390.381) -- 0:00:51
      176000 -- (-387.813) [-389.631] (-386.076) (-389.742) * (-386.450) (-393.267) (-397.409) [-387.016] -- 0:00:51
      176500 -- [-386.349] (-392.890) (-386.733) (-389.197) * (-391.798) [-388.428] (-389.863) (-389.810) -- 0:00:51
      177000 -- (-389.298) [-387.044] (-387.140) (-392.939) * (-387.880) (-389.179) [-387.935] (-387.046) -- 0:00:51
      177500 -- (-388.627) (-388.195) [-386.235] (-388.013) * (-388.147) (-390.940) [-387.507] (-388.794) -- 0:00:50
      178000 -- (-388.456) [-386.659] (-390.088) (-387.714) * (-393.584) (-389.090) [-387.576] (-387.494) -- 0:00:50
      178500 -- (-390.515) [-389.368] (-388.743) (-388.818) * [-387.283] (-389.615) (-387.864) (-390.836) -- 0:00:50
      179000 -- (-387.310) (-387.383) [-390.912] (-387.781) * (-387.822) (-387.820) (-389.358) [-386.743] -- 0:00:50
      179500 -- [-387.863] (-390.575) (-387.468) (-387.046) * (-386.140) (-390.303) [-387.612] (-387.948) -- 0:00:50
      180000 -- (-387.949) (-390.497) (-388.713) [-386.096] * (-387.182) (-388.559) (-390.722) [-387.322] -- 0:00:50

      Average standard deviation of split frequencies: 0.017344

      180500 -- (-388.683) (-393.196) (-388.852) [-387.992] * (-393.422) (-388.701) [-387.270] (-389.647) -- 0:00:49
      181000 -- (-387.713) (-394.543) (-389.314) [-391.480] * (-390.454) (-387.021) [-387.643] (-386.350) -- 0:00:49
      181500 -- (-389.756) [-388.089] (-390.739) (-389.228) * [-386.893] (-387.288) (-386.610) (-387.209) -- 0:00:49
      182000 -- [-387.281] (-388.810) (-388.111) (-391.277) * (-386.720) (-387.921) (-387.479) [-388.123] -- 0:00:49
      182500 -- (-389.382) (-386.706) [-387.427] (-386.405) * (-387.175) (-387.148) [-388.157] (-386.572) -- 0:00:49
      183000 -- (-393.920) (-387.874) (-388.269) [-386.908] * (-391.261) (-389.078) (-389.484) [-389.295] -- 0:00:49
      183500 -- [-388.491] (-389.704) (-389.002) (-387.483) * (-390.672) (-392.836) (-387.293) [-390.653] -- 0:00:48
      184000 -- (-386.835) [-391.519] (-389.997) (-388.808) * [-392.127] (-388.183) (-388.386) (-390.168) -- 0:00:48
      184500 -- (-388.289) (-387.365) [-388.958] (-389.638) * (-387.592) (-387.894) [-386.135] (-390.792) -- 0:00:48
      185000 -- [-386.644] (-387.578) (-389.689) (-391.648) * (-392.844) (-388.194) (-389.238) [-388.433] -- 0:00:48

      Average standard deviation of split frequencies: 0.016407

      185500 -- [-387.477] (-388.331) (-387.058) (-388.506) * (-392.514) [-386.248] (-389.073) (-390.296) -- 0:00:48
      186000 -- (-386.735) (-387.900) [-387.319] (-391.540) * (-387.515) [-386.687] (-386.647) (-389.160) -- 0:00:48
      186500 -- (-392.165) (-387.652) [-386.774] (-388.633) * (-387.525) (-389.459) [-387.560] (-387.095) -- 0:00:47
      187000 -- (-391.853) (-390.053) (-388.277) [-388.196] * (-388.822) [-387.159] (-389.084) (-386.742) -- 0:00:47
      187500 -- [-387.341] (-395.969) (-391.927) (-389.224) * (-391.913) (-387.862) [-387.740] (-386.807) -- 0:00:47
      188000 -- (-387.424) (-386.912) [-388.026] (-389.731) * (-385.996) (-387.378) (-388.730) [-387.291] -- 0:00:47
      188500 -- [-387.049] (-387.877) (-388.881) (-388.579) * (-385.996) [-387.484] (-386.240) (-387.486) -- 0:00:47
      189000 -- (-393.862) (-387.716) (-389.569) [-388.277] * [-387.951] (-388.322) (-389.998) (-391.386) -- 0:00:47
      189500 -- [-389.605] (-389.348) (-389.506) (-388.808) * (-393.592) [-388.734] (-389.032) (-390.144) -- 0:00:47
      190000 -- [-388.101] (-389.283) (-390.805) (-388.129) * (-388.306) (-389.811) (-390.128) [-386.453] -- 0:00:46

      Average standard deviation of split frequencies: 0.015933

      190500 -- (-388.614) (-389.716) (-387.357) [-388.733] * (-387.660) (-388.590) [-387.525] (-388.206) -- 0:00:46
      191000 -- [-387.041] (-393.375) (-389.103) (-387.955) * [-387.528] (-394.740) (-386.275) (-387.760) -- 0:00:50
      191500 -- (-387.168) (-386.663) [-389.503] (-388.469) * (-389.622) [-388.974] (-388.164) (-388.735) -- 0:00:50
      192000 -- [-388.533] (-387.888) (-386.584) (-388.264) * (-387.252) [-387.252] (-389.338) (-391.896) -- 0:00:50
      192500 -- [-391.444] (-388.683) (-389.088) (-386.329) * [-387.626] (-389.164) (-388.402) (-389.841) -- 0:00:50
      193000 -- (-390.081) (-388.331) [-392.256] (-387.845) * [-387.139] (-387.992) (-387.731) (-388.262) -- 0:00:50
      193500 -- [-392.121] (-388.805) (-389.833) (-386.758) * [-388.378] (-390.534) (-389.774) (-389.093) -- 0:00:50
      194000 -- (-391.244) (-390.132) (-390.956) [-389.279] * [-387.854] (-387.884) (-387.501) (-388.201) -- 0:00:49
      194500 -- (-389.354) [-389.653] (-386.524) (-390.152) * (-389.652) (-386.579) [-386.620] (-389.151) -- 0:00:49
      195000 -- (-386.315) (-386.828) (-389.295) [-387.801] * (-391.745) (-389.339) (-390.499) [-389.682] -- 0:00:49

      Average standard deviation of split frequencies: 0.016034

      195500 -- (-389.668) [-386.974] (-387.426) (-387.820) * (-389.666) (-387.621) (-392.919) [-387.282] -- 0:00:49
      196000 -- (-389.189) (-388.269) (-387.883) [-389.419] * [-387.466] (-388.029) (-387.152) (-390.253) -- 0:00:49
      196500 -- (-390.031) [-391.552] (-386.389) (-390.682) * (-390.512) (-388.527) (-392.167) [-387.491] -- 0:00:49
      197000 -- (-389.476) (-388.030) [-387.775] (-393.509) * (-395.896) (-388.822) [-386.959] (-392.316) -- 0:00:48
      197500 -- (-387.695) [-387.396] (-387.394) (-391.186) * [-388.743] (-388.961) (-386.517) (-388.385) -- 0:00:48
      198000 -- (-387.555) [-388.227] (-387.509) (-387.255) * (-387.489) (-388.484) [-386.921] (-389.752) -- 0:00:48
      198500 -- (-389.680) [-386.548] (-386.327) (-389.941) * (-391.453) (-390.273) (-387.750) [-389.826] -- 0:00:48
      199000 -- (-389.977) (-389.675) [-387.062] (-388.528) * (-388.126) (-388.523) (-386.416) [-387.875] -- 0:00:48
      199500 -- (-386.701) (-388.761) [-387.248] (-387.596) * (-386.827) (-389.554) [-387.776] (-392.003) -- 0:00:48
      200000 -- (-387.590) (-393.780) [-389.137] (-388.385) * (-387.931) [-386.715] (-390.432) (-386.520) -- 0:00:48

      Average standard deviation of split frequencies: 0.017227

      200500 -- [-387.201] (-387.315) (-386.824) (-389.785) * [-390.241] (-391.066) (-388.067) (-397.584) -- 0:00:47
      201000 -- (-386.980) (-387.409) [-387.643] (-387.095) * (-387.334) (-390.751) (-390.247) [-393.361] -- 0:00:47
      201500 -- (-392.624) (-388.986) (-389.137) [-391.160] * (-389.691) (-389.604) [-387.487] (-391.767) -- 0:00:47
      202000 -- [-388.126] (-388.712) (-391.306) (-386.964) * (-390.177) [-388.169] (-386.567) (-387.608) -- 0:00:47
      202500 -- (-387.970) [-389.271] (-387.625) (-387.512) * [-388.504] (-388.579) (-389.762) (-386.809) -- 0:00:47
      203000 -- (-389.129) (-387.927) (-388.302) [-389.836] * [-387.907] (-395.023) (-386.380) (-386.937) -- 0:00:47
      203500 -- (-387.417) [-389.947] (-386.420) (-387.086) * [-386.796] (-390.209) (-387.707) (-387.756) -- 0:00:46
      204000 -- (-389.187) [-388.852] (-392.106) (-388.528) * [-386.777] (-390.868) (-388.280) (-389.485) -- 0:00:46
      204500 -- [-386.355] (-388.664) (-389.551) (-386.892) * [-387.496] (-387.552) (-388.583) (-387.063) -- 0:00:46
      205000 -- [-386.761] (-390.685) (-386.881) (-387.412) * (-389.478) (-387.687) (-389.008) [-388.985] -- 0:00:46

      Average standard deviation of split frequencies: 0.017163

      205500 -- [-386.650] (-388.069) (-388.631) (-387.017) * (-392.294) (-387.846) [-386.720] (-387.444) -- 0:00:46
      206000 -- (-395.586) (-392.507) (-387.674) [-387.502] * (-390.701) (-387.491) [-389.521] (-388.626) -- 0:00:46
      206500 -- (-391.471) (-389.575) [-386.871] (-391.202) * (-387.457) (-387.473) (-391.264) [-387.605] -- 0:00:46
      207000 -- (-392.420) [-387.916] (-386.623) (-388.788) * (-387.980) (-387.512) (-387.267) [-389.601] -- 0:00:45
      207500 -- (-390.768) (-387.733) [-387.458] (-386.903) * (-393.041) (-390.332) [-387.922] (-388.290) -- 0:00:49
      208000 -- (-390.058) (-390.729) [-392.715] (-389.044) * [-386.449] (-387.293) (-389.919) (-387.320) -- 0:00:49
      208500 -- [-386.433] (-387.937) (-390.553) (-387.237) * (-387.276) (-387.001) [-387.429] (-391.614) -- 0:00:49
      209000 -- (-387.649) [-387.970] (-391.233) (-389.259) * (-388.588) (-390.952) [-389.942] (-388.053) -- 0:00:49
      209500 -- [-387.676] (-390.952) (-390.427) (-393.858) * (-389.032) (-387.947) (-388.585) [-388.727] -- 0:00:49
      210000 -- (-388.640) [-389.572] (-389.573) (-388.422) * (-389.093) (-389.308) (-387.790) [-387.757] -- 0:00:48

      Average standard deviation of split frequencies: 0.014604

      210500 -- [-387.640] (-391.541) (-389.286) (-388.695) * (-388.906) (-388.698) (-391.811) [-386.730] -- 0:00:48
      211000 -- (-387.781) [-392.639] (-392.825) (-387.355) * (-391.517) (-390.949) (-388.599) [-388.005] -- 0:00:48
      211500 -- (-387.502) (-388.085) (-386.778) [-386.401] * (-388.425) [-386.515] (-388.382) (-386.213) -- 0:00:48
      212000 -- (-387.012) (-387.832) (-388.045) [-389.773] * (-394.495) (-389.264) (-386.503) [-387.188] -- 0:00:48
      212500 -- (-387.263) (-388.895) (-388.215) [-393.679] * (-391.831) (-386.186) [-389.353] (-390.458) -- 0:00:48
      213000 -- (-388.789) (-389.148) (-389.702) [-386.902] * (-389.716) (-387.344) [-389.204] (-388.585) -- 0:00:48
      213500 -- (-388.698) [-393.264] (-391.089) (-390.313) * (-388.499) (-387.321) [-386.735] (-391.036) -- 0:00:47
      214000 -- (-387.682) (-387.754) (-388.745) [-386.906] * (-390.797) (-388.190) (-389.003) [-387.311] -- 0:00:47
      214500 -- [-387.323] (-388.522) (-388.163) (-390.200) * (-388.546) (-387.755) (-390.290) [-387.839] -- 0:00:47
      215000 -- (-387.984) (-386.881) (-387.066) [-387.848] * (-389.661) (-386.987) [-388.333] (-387.099) -- 0:00:47

      Average standard deviation of split frequencies: 0.015035

      215500 -- (-391.858) [-387.852] (-387.949) (-389.087) * (-388.049) (-387.094) [-389.516] (-386.471) -- 0:00:47
      216000 -- (-389.423) (-389.381) (-386.250) [-387.513] * [-388.879] (-386.753) (-388.117) (-387.724) -- 0:00:47
      216500 -- (-387.678) [-388.036] (-387.112) (-387.482) * [-389.983] (-393.466) (-389.967) (-388.024) -- 0:00:47
      217000 -- (-387.427) (-389.453) [-390.071] (-387.128) * (-387.619) (-392.404) [-390.056] (-388.305) -- 0:00:46
      217500 -- (-388.542) (-388.518) [-387.184] (-388.262) * [-390.001] (-386.538) (-387.133) (-387.196) -- 0:00:46
      218000 -- (-391.682) (-389.053) (-390.689) [-386.407] * (-388.237) (-390.073) (-387.731) [-387.563] -- 0:00:46
      218500 -- [-387.234] (-391.179) (-388.196) (-386.589) * (-387.423) [-392.100] (-389.940) (-388.480) -- 0:00:46
      219000 -- (-388.917) (-390.933) [-387.435] (-388.175) * (-390.064) (-387.514) [-388.202] (-387.982) -- 0:00:46
      219500 -- (-389.182) [-386.033] (-392.723) (-389.386) * (-389.301) (-391.250) (-387.954) [-388.238] -- 0:00:46
      220000 -- [-388.409] (-386.121) (-391.797) (-388.091) * (-388.591) [-388.655] (-388.185) (-387.094) -- 0:00:46

      Average standard deviation of split frequencies: 0.013886

      220500 -- (-388.580) (-389.458) [-387.823] (-389.242) * (-389.022) (-388.100) (-388.480) [-388.446] -- 0:00:45
      221000 -- [-387.539] (-391.162) (-387.266) (-386.671) * [-387.412] (-389.481) (-387.104) (-389.087) -- 0:00:45
      221500 -- (-388.992) [-387.745] (-388.761) (-392.505) * (-387.291) (-390.472) [-387.713] (-387.321) -- 0:00:45
      222000 -- [-386.513] (-387.279) (-390.534) (-390.728) * (-388.652) (-396.883) (-389.019) [-386.560] -- 0:00:45
      222500 -- (-386.662) [-390.605] (-391.018) (-389.060) * (-388.178) (-390.311) [-387.871] (-389.779) -- 0:00:45
      223000 -- (-386.767) (-392.301) [-388.827] (-389.177) * (-388.274) [-386.635] (-389.127) (-388.616) -- 0:00:45
      223500 -- (-389.832) (-389.461) [-385.976] (-386.733) * (-388.702) (-387.091) [-390.141] (-386.510) -- 0:00:45
      224000 -- [-387.439] (-387.910) (-388.882) (-389.468) * [-391.140] (-387.778) (-386.833) (-391.144) -- 0:00:45
      224500 -- (-387.314) (-389.537) [-389.060] (-390.788) * (-387.788) (-386.446) [-390.499] (-390.933) -- 0:00:48
      225000 -- (-387.819) (-393.119) [-387.271] (-388.635) * (-386.305) (-386.046) [-387.523] (-391.247) -- 0:00:48

      Average standard deviation of split frequencies: 0.013833

      225500 -- (-386.793) (-388.088) [-391.243] (-392.939) * (-387.257) (-387.555) (-386.556) [-386.870] -- 0:00:48
      226000 -- [-388.151] (-387.394) (-389.058) (-390.571) * (-387.734) (-386.575) (-387.102) [-387.574] -- 0:00:47
      226500 -- (-390.061) [-386.201] (-391.992) (-390.898) * [-389.318] (-386.788) (-388.042) (-390.010) -- 0:00:47
      227000 -- (-386.691) [-388.726] (-389.489) (-388.279) * (-389.075) [-388.729] (-387.647) (-388.521) -- 0:00:47
      227500 -- (-388.661) (-391.174) [-387.078] (-390.578) * (-391.101) (-389.831) [-386.613] (-388.600) -- 0:00:47
      228000 -- (-388.926) (-388.365) (-387.560) [-387.953] * [-387.694] (-390.348) (-387.957) (-386.982) -- 0:00:47
      228500 -- (-386.660) (-387.644) [-387.921] (-388.336) * (-388.554) (-387.869) [-389.466] (-388.189) -- 0:00:47
      229000 -- [-387.432] (-390.650) (-388.200) (-386.831) * [-387.217] (-387.662) (-388.186) (-388.083) -- 0:00:47
      229500 -- (-387.287) (-387.180) [-389.555] (-388.806) * (-388.575) [-387.609] (-387.689) (-389.810) -- 0:00:47
      230000 -- (-387.739) (-388.143) [-388.553] (-388.699) * (-387.534) (-387.596) [-391.210] (-386.660) -- 0:00:46

      Average standard deviation of split frequencies: 0.012035

      230500 -- (-387.288) (-389.668) (-390.799) [-392.473] * (-386.653) [-386.426] (-389.632) (-386.314) -- 0:00:46
      231000 -- (-386.017) (-388.201) [-388.127] (-388.551) * (-389.327) [-386.291] (-387.970) (-388.355) -- 0:00:46
      231500 -- (-386.547) (-389.760) [-391.103] (-387.370) * (-387.997) (-387.513) (-391.910) [-387.529] -- 0:00:46
      232000 -- [-386.800] (-387.511) (-387.110) (-387.523) * [-388.268] (-391.196) (-387.857) (-391.240) -- 0:00:46
      232500 -- (-388.428) [-390.453] (-390.426) (-388.265) * (-393.762) [-388.112] (-387.485) (-389.138) -- 0:00:46
      233000 -- (-388.105) (-389.386) [-387.915] (-389.637) * (-387.322) [-388.493] (-387.830) (-387.759) -- 0:00:46
      233500 -- (-387.954) (-389.810) [-391.056] (-388.628) * (-390.714) (-388.576) (-389.047) [-389.530] -- 0:00:45
      234000 -- [-386.862] (-390.141) (-388.084) (-388.927) * (-386.844) (-388.618) (-393.778) [-389.086] -- 0:00:45
      234500 -- [-386.511] (-387.197) (-386.159) (-388.140) * [-387.096] (-387.510) (-389.253) (-388.302) -- 0:00:45
      235000 -- (-388.469) [-389.854] (-386.197) (-387.031) * [-388.424] (-386.837) (-389.528) (-387.246) -- 0:00:45

      Average standard deviation of split frequencies: 0.012511

      235500 -- (-389.554) (-388.699) [-389.045] (-387.831) * (-388.996) [-389.229] (-392.395) (-387.184) -- 0:00:45
      236000 -- (-388.976) (-387.513) (-390.688) [-387.002] * (-386.539) (-386.958) (-392.901) [-386.459] -- 0:00:45
      236500 -- (-387.374) (-390.269) [-387.887] (-387.238) * [-387.279] (-387.302) (-393.981) (-387.586) -- 0:00:45
      237000 -- (-389.056) (-390.418) [-386.600] (-388.624) * (-386.957) [-387.437] (-388.926) (-386.555) -- 0:00:45
      237500 -- (-389.423) (-390.666) (-389.193) [-386.947] * (-392.805) (-389.111) (-390.057) [-386.915] -- 0:00:44
      238000 -- [-387.286] (-388.745) (-386.270) (-391.388) * (-388.639) (-389.782) [-386.079] (-389.972) -- 0:00:44
      238500 -- (-390.800) [-389.726] (-387.439) (-387.534) * [-386.413] (-393.080) (-388.771) (-392.277) -- 0:00:44
      239000 -- [-388.334] (-387.758) (-389.043) (-388.770) * (-387.212) (-388.687) (-387.336) [-387.254] -- 0:00:44
      239500 -- [-387.141] (-391.751) (-391.716) (-387.600) * (-387.555) (-386.319) (-393.149) [-387.753] -- 0:00:44
      240000 -- (-389.420) (-388.949) (-387.539) [-388.352] * (-390.751) (-387.240) [-386.177] (-386.806) -- 0:00:44

      Average standard deviation of split frequencies: 0.011208

      240500 -- (-388.099) (-391.489) [-387.614] (-387.911) * (-389.901) [-387.013] (-387.248) (-387.988) -- 0:00:44
      241000 -- (-390.430) (-393.007) [-389.096] (-386.713) * (-395.686) (-388.532) (-389.739) [-386.673] -- 0:00:44
      241500 -- (-388.033) (-391.826) [-388.498] (-388.169) * (-389.720) (-389.435) (-388.791) [-388.362] -- 0:00:47
      242000 -- (-387.326) (-387.369) (-389.586) [-392.988] * (-388.169) [-387.425] (-387.760) (-387.952) -- 0:00:46
      242500 -- (-389.585) (-387.816) (-387.894) [-387.676] * [-389.532] (-389.482) (-389.456) (-387.866) -- 0:00:46
      243000 -- (-392.360) (-391.410) (-387.404) [-386.801] * (-389.230) (-389.759) (-390.491) [-386.714] -- 0:00:46
      243500 -- (-392.152) (-391.981) (-389.859) [-388.265] * [-387.277] (-389.797) (-388.709) (-386.547) -- 0:00:46
      244000 -- (-394.065) (-399.934) (-387.272) [-386.048] * (-387.773) (-389.029) [-389.850] (-391.805) -- 0:00:46
      244500 -- (-393.173) (-387.286) [-387.793] (-388.582) * (-388.276) (-388.265) (-388.709) [-388.335] -- 0:00:46
      245000 -- (-387.529) [-389.717] (-387.017) (-388.718) * (-386.513) (-388.097) (-389.685) [-386.758] -- 0:00:46

      Average standard deviation of split frequencies: 0.011711

      245500 -- (-386.562) (-390.296) [-389.273] (-387.406) * [-387.082] (-395.153) (-389.473) (-389.421) -- 0:00:46
      246000 -- (-386.833) (-389.058) (-389.544) [-389.348] * (-386.602) (-386.461) (-389.678) [-388.113] -- 0:00:45
      246500 -- [-386.365] (-386.980) (-389.069) (-389.933) * [-386.374] (-388.866) (-389.548) (-388.112) -- 0:00:45
      247000 -- (-388.512) (-387.952) [-386.296] (-396.483) * [-386.713] (-386.975) (-388.205) (-388.600) -- 0:00:45
      247500 -- (-387.418) (-392.778) [-388.382] (-387.462) * (-387.945) (-392.174) [-388.570] (-389.384) -- 0:00:45
      248000 -- (-388.842) [-388.296] (-387.454) (-387.261) * (-388.079) (-387.920) (-388.269) [-390.371] -- 0:00:45
      248500 -- (-390.017) (-386.584) (-388.421) [-387.288] * (-386.979) [-391.443] (-387.687) (-396.173) -- 0:00:45
      249000 -- [-387.913] (-389.233) (-387.078) (-388.394) * [-387.647] (-390.252) (-387.183) (-388.058) -- 0:00:45
      249500 -- (-387.509) [-387.598] (-388.637) (-389.616) * [-387.733] (-390.370) (-388.306) (-390.075) -- 0:00:45
      250000 -- [-386.813] (-388.333) (-389.183) (-387.885) * (-391.933) [-387.428] (-387.027) (-389.418) -- 0:00:45

      Average standard deviation of split frequencies: 0.012328

      250500 -- (-391.943) (-389.567) (-386.427) [-387.840] * [-386.766] (-389.434) (-387.695) (-388.658) -- 0:00:44
      251000 -- (-387.432) (-388.097) (-386.583) [-387.383] * (-389.550) (-389.126) (-389.223) [-394.957] -- 0:00:44
      251500 -- (-388.646) (-393.578) [-389.409] (-388.036) * (-392.587) [-393.271] (-387.888) (-387.482) -- 0:00:44
      252000 -- [-387.439] (-389.457) (-388.035) (-389.753) * (-391.067) (-391.213) (-388.526) [-386.224] -- 0:00:44
      252500 -- [-389.401] (-389.143) (-387.264) (-390.446) * [-386.760] (-390.363) (-389.315) (-386.937) -- 0:00:44
      253000 -- [-387.745] (-389.440) (-387.887) (-391.415) * (-386.587) (-389.167) [-386.602] (-388.104) -- 0:00:44
      253500 -- (-388.615) (-391.564) (-387.795) [-393.908] * (-388.597) [-389.386] (-389.906) (-391.596) -- 0:00:44
      254000 -- (-391.560) (-390.285) (-390.055) [-387.364] * (-390.781) (-389.908) (-389.199) [-389.073] -- 0:00:44
      254500 -- [-387.916] (-386.375) (-393.506) (-387.825) * [-386.436] (-389.109) (-390.252) (-388.364) -- 0:00:43
      255000 -- [-388.273] (-388.636) (-392.948) (-388.645) * (-391.448) (-386.951) [-389.181] (-388.338) -- 0:00:43

      Average standard deviation of split frequencies: 0.012685

      255500 -- (-388.614) (-389.258) (-391.358) [-388.776] * (-389.346) (-386.270) [-387.698] (-388.314) -- 0:00:43
      256000 -- (-389.865) (-391.513) (-390.242) [-387.866] * (-387.381) (-388.506) [-387.655] (-387.437) -- 0:00:43
      256500 -- [-388.219] (-393.334) (-387.293) (-390.610) * [-388.040] (-387.526) (-394.148) (-388.011) -- 0:00:43
      257000 -- (-389.926) (-388.740) (-387.999) [-388.735] * (-390.404) (-391.977) [-387.098] (-389.716) -- 0:00:43
      257500 -- [-389.126] (-387.099) (-388.147) (-388.771) * (-388.602) [-387.003] (-387.738) (-391.796) -- 0:00:43
      258000 -- (-388.736) (-387.737) (-389.281) [-388.926] * (-387.446) (-391.346) [-386.720] (-387.151) -- 0:00:43
      258500 -- [-387.602] (-393.378) (-388.699) (-387.150) * (-389.023) (-386.817) [-388.536] (-390.027) -- 0:00:45
      259000 -- (-388.278) (-386.209) [-387.836] (-387.125) * (-390.397) (-389.460) (-387.019) [-386.587] -- 0:00:45
      259500 -- [-386.164] (-388.227) (-388.008) (-385.999) * (-391.318) [-387.235] (-386.838) (-388.539) -- 0:00:45
      260000 -- [-386.131] (-388.063) (-389.333) (-392.093) * [-389.909] (-387.661) (-386.717) (-387.708) -- 0:00:45

      Average standard deviation of split frequencies: 0.012760

      260500 -- [-387.708] (-391.513) (-387.162) (-387.546) * [-387.998] (-389.059) (-389.854) (-391.481) -- 0:00:45
      261000 -- [-387.912] (-390.398) (-388.766) (-386.528) * [-389.255] (-390.108) (-387.210) (-391.067) -- 0:00:45
      261500 -- (-388.732) (-390.832) [-387.870] (-396.076) * (-386.949) [-388.023] (-388.007) (-386.200) -- 0:00:45
      262000 -- (-388.273) [-386.556] (-387.986) (-387.498) * (-389.844) (-387.351) [-386.045] (-387.451) -- 0:00:45
      262500 -- (-387.276) [-386.681] (-388.571) (-386.983) * (-390.826) [-388.537] (-389.400) (-388.590) -- 0:00:44
      263000 -- (-389.021) (-386.630) (-388.979) [-393.292] * (-388.082) (-389.013) [-389.573] (-387.449) -- 0:00:44
      263500 -- (-388.671) (-386.948) [-387.427] (-389.718) * (-387.953) [-390.353] (-388.963) (-388.446) -- 0:00:44
      264000 -- (-387.120) (-388.887) [-387.827] (-389.009) * [-391.179] (-386.668) (-394.949) (-389.260) -- 0:00:44
      264500 -- (-386.853) (-389.141) (-387.262) [-388.405] * (-390.657) (-389.137) (-388.387) [-390.532] -- 0:00:44
      265000 -- (-388.321) (-391.478) [-387.400] (-387.944) * (-386.381) (-388.120) [-387.477] (-389.232) -- 0:00:44

      Average standard deviation of split frequencies: 0.012012

      265500 -- (-392.386) (-388.499) [-387.023] (-387.678) * (-390.107) [-386.419] (-390.807) (-387.069) -- 0:00:44
      266000 -- (-393.939) [-387.006] (-386.746) (-392.657) * [-388.517] (-391.609) (-389.250) (-388.860) -- 0:00:44
      266500 -- (-387.910) (-389.911) (-386.282) [-388.883] * [-388.991] (-392.745) (-393.508) (-386.772) -- 0:00:44
      267000 -- (-387.078) (-389.200) (-390.978) [-387.319] * (-391.005) [-392.541] (-390.046) (-389.741) -- 0:00:43
      267500 -- (-386.151) [-387.077] (-390.392) (-386.068) * [-388.860] (-390.993) (-389.427) (-388.877) -- 0:00:43
      268000 -- (-388.241) [-389.129] (-386.939) (-387.247) * [-387.285] (-391.834) (-387.792) (-387.819) -- 0:00:43
      268500 -- [-388.911] (-392.756) (-387.886) (-391.557) * (-387.680) (-392.216) (-393.206) [-388.043] -- 0:00:43
      269000 -- [-387.271] (-389.238) (-389.583) (-392.289) * (-387.192) (-390.338) [-387.622] (-387.339) -- 0:00:43
      269500 -- [-395.715] (-388.665) (-387.296) (-387.969) * (-388.109) (-391.557) (-388.970) [-391.534] -- 0:00:43
      270000 -- (-391.491) (-389.873) [-389.128] (-388.177) * (-387.230) (-388.591) (-393.053) [-388.057] -- 0:00:43

      Average standard deviation of split frequencies: 0.012482

      270500 -- (-397.095) (-391.272) (-389.569) [-387.150] * [-391.032] (-388.051) (-387.975) (-390.127) -- 0:00:43
      271000 -- (-391.944) [-390.788] (-391.109) (-387.980) * (-391.578) (-391.653) (-387.974) [-388.619] -- 0:00:43
      271500 -- (-391.713) (-387.300) (-393.808) [-388.582] * (-392.342) (-387.685) (-387.718) [-386.280] -- 0:00:42
      272000 -- [-392.599] (-388.722) (-387.303) (-387.725) * [-388.086] (-387.978) (-388.557) (-389.175) -- 0:00:42
      272500 -- (-386.930) (-388.379) [-390.430] (-391.955) * (-391.467) (-388.467) [-388.292] (-389.565) -- 0:00:42
      273000 -- (-388.600) (-390.022) (-390.021) [-387.827] * (-390.378) (-389.873) [-387.802] (-389.213) -- 0:00:42
      273500 -- (-388.924) (-388.256) [-386.923] (-386.408) * (-393.292) (-389.380) [-387.249] (-388.970) -- 0:00:42
      274000 -- (-390.253) (-390.177) (-388.032) [-388.549] * (-389.624) (-389.480) [-389.150] (-387.227) -- 0:00:42
      274500 -- (-387.720) (-390.359) (-388.312) [-386.497] * [-386.626] (-389.871) (-393.865) (-388.467) -- 0:00:42
      275000 -- (-388.481) (-392.297) [-388.263] (-392.668) * (-389.453) [-388.348] (-389.833) (-387.218) -- 0:00:44

      Average standard deviation of split frequencies: 0.013208

      275500 -- (-388.713) (-386.835) (-391.445) [-387.880] * [-387.276] (-389.651) (-390.218) (-387.054) -- 0:00:44
      276000 -- [-388.942] (-392.037) (-390.824) (-390.451) * [-390.305] (-388.009) (-397.204) (-388.687) -- 0:00:44
      276500 -- [-388.494] (-388.532) (-389.383) (-391.085) * (-393.456) (-393.961) (-386.123) [-390.001] -- 0:00:44
      277000 -- (-387.681) (-386.452) (-390.580) [-388.151] * (-392.658) (-388.574) [-388.478] (-389.340) -- 0:00:44
      277500 -- [-387.713] (-386.457) (-388.339) (-389.362) * (-390.686) (-387.368) (-388.919) [-388.139] -- 0:00:44
      278000 -- (-387.318) [-390.035] (-386.818) (-389.487) * (-389.591) [-387.066] (-388.200) (-388.224) -- 0:00:44
      278500 -- [-386.854] (-389.876) (-389.179) (-390.588) * (-389.633) (-387.355) (-388.481) [-388.279] -- 0:00:44
      279000 -- (-388.558) [-389.304] (-388.896) (-388.725) * (-388.631) (-387.695) [-389.957] (-389.777) -- 0:00:43
      279500 -- [-387.469] (-387.953) (-386.321) (-393.491) * (-389.588) (-386.946) (-389.254) [-392.455] -- 0:00:43
      280000 -- (-387.386) (-389.686) [-387.977] (-390.546) * [-388.139] (-388.272) (-387.849) (-388.980) -- 0:00:43

      Average standard deviation of split frequencies: 0.013542

      280500 -- [-388.652] (-388.929) (-387.981) (-391.128) * [-386.624] (-388.629) (-391.032) (-388.002) -- 0:00:43
      281000 -- (-389.824) [-386.910] (-389.502) (-392.529) * (-387.424) (-386.519) [-386.836] (-389.937) -- 0:00:43
      281500 -- (-387.962) (-387.945) [-388.054] (-390.112) * (-388.332) (-387.988) [-388.762] (-390.528) -- 0:00:43
      282000 -- (-387.387) [-386.704] (-389.184) (-388.418) * (-389.114) (-386.281) (-387.169) [-389.648] -- 0:00:43
      282500 -- [-386.410] (-393.296) (-390.869) (-388.207) * (-386.795) [-386.124] (-391.027) (-388.583) -- 0:00:43
      283000 -- (-389.183) (-388.564) [-389.085] (-387.351) * (-391.918) [-387.762] (-390.517) (-393.294) -- 0:00:43
      283500 -- (-389.178) [-387.068] (-390.305) (-386.352) * (-387.909) [-388.051] (-391.880) (-387.236) -- 0:00:42
      284000 -- (-388.551) (-387.908) (-386.500) [-386.645] * [-388.677] (-387.877) (-387.967) (-387.917) -- 0:00:42
      284500 -- (-386.235) [-386.532] (-390.673) (-389.362) * (-386.392) (-389.322) [-391.740] (-387.564) -- 0:00:42
      285000 -- (-388.395) [-387.620] (-391.171) (-389.965) * (-386.567) [-388.905] (-389.123) (-388.266) -- 0:00:42

      Average standard deviation of split frequencies: 0.013283

      285500 -- (-389.256) (-387.211) (-387.867) [-388.698] * (-394.165) (-387.881) (-387.899) [-388.076] -- 0:00:42
      286000 -- [-389.069] (-387.503) (-389.070) (-387.494) * [-392.195] (-391.174) (-389.393) (-389.286) -- 0:00:42
      286500 -- (-388.617) [-390.012] (-386.229) (-389.046) * (-394.748) (-387.092) (-391.976) [-388.229] -- 0:00:42
      287000 -- (-389.391) [-386.782] (-388.958) (-392.805) * (-388.391) (-388.075) [-390.888] (-389.622) -- 0:00:42
      287500 -- (-389.522) [-388.970] (-389.712) (-390.486) * (-391.493) [-392.075] (-390.701) (-388.808) -- 0:00:42
      288000 -- [-388.285] (-386.359) (-388.311) (-389.654) * (-387.463) (-388.421) (-388.169) [-390.347] -- 0:00:42
      288500 -- [-390.106] (-390.521) (-388.639) (-388.516) * (-386.789) [-386.651] (-390.309) (-389.425) -- 0:00:41
      289000 -- (-387.577) [-387.445] (-388.760) (-388.101) * (-387.786) (-389.502) [-387.693] (-388.414) -- 0:00:41
      289500 -- (-387.464) (-386.967) (-387.970) [-387.673] * [-387.374] (-387.012) (-392.441) (-386.527) -- 0:00:41
      290000 -- [-389.651] (-387.602) (-388.138) (-390.273) * (-388.669) (-389.482) [-387.954] (-387.686) -- 0:00:41

      Average standard deviation of split frequencies: 0.013165

      290500 -- (-387.931) (-389.066) (-390.423) [-390.693] * (-393.489) (-389.426) [-386.762] (-388.824) -- 0:00:41
      291000 -- (-386.672) (-389.569) (-390.700) [-390.525] * (-390.533) (-387.367) (-386.625) [-386.364] -- 0:00:41
      291500 -- [-389.406] (-387.286) (-389.848) (-387.170) * (-388.804) (-387.188) [-389.298] (-386.139) -- 0:00:41
      292000 -- (-386.902) (-390.223) [-389.710] (-390.784) * (-388.594) (-387.912) [-388.412] (-392.668) -- 0:00:43
      292500 -- (-389.192) (-387.218) (-389.333) [-388.656] * (-389.950) [-387.375] (-387.723) (-389.539) -- 0:00:43
      293000 -- (-388.514) [-389.840] (-387.455) (-386.768) * [-387.307] (-390.774) (-388.348) (-386.315) -- 0:00:43
      293500 -- (-390.970) (-391.632) [-387.474] (-388.608) * [-387.728] (-388.986) (-387.175) (-387.240) -- 0:00:43
      294000 -- (-391.100) (-386.298) (-390.625) [-386.604] * (-388.509) [-391.418] (-386.498) (-387.916) -- 0:00:43
      294500 -- (-387.387) [-387.187] (-389.002) (-386.284) * [-388.251] (-387.116) (-389.304) (-386.431) -- 0:00:43
      295000 -- [-392.158] (-390.715) (-388.922) (-387.537) * (-387.857) (-387.311) (-393.284) [-387.301] -- 0:00:43

      Average standard deviation of split frequencies: 0.012641

      295500 -- [-389.626] (-387.640) (-387.370) (-394.738) * (-387.453) (-391.621) (-390.023) [-386.668] -- 0:00:42
      296000 -- (-389.773) (-390.251) [-389.474] (-390.169) * (-386.514) (-391.312) (-388.013) [-389.969] -- 0:00:42
      296500 -- [-388.266] (-386.417) (-391.827) (-388.360) * (-388.832) (-391.732) [-387.137] (-390.094) -- 0:00:42
      297000 -- (-389.137) (-390.943) (-390.387) [-388.013] * (-390.794) (-386.484) (-388.184) [-389.589] -- 0:00:42
      297500 -- [-386.542] (-389.859) (-387.930) (-393.939) * [-389.886] (-389.720) (-387.607) (-389.890) -- 0:00:42
      298000 -- (-389.713) [-387.781] (-387.845) (-393.580) * (-390.868) [-388.723] (-386.556) (-388.432) -- 0:00:42
      298500 -- [-388.124] (-387.705) (-387.862) (-388.959) * (-386.567) [-388.413] (-387.962) (-388.130) -- 0:00:42
      299000 -- (-387.348) (-387.939) (-387.517) [-389.130] * (-389.370) (-388.440) (-388.041) [-386.448] -- 0:00:42
      299500 -- (-388.701) [-388.428] (-387.493) (-386.520) * (-389.607) (-387.690) (-395.072) [-387.859] -- 0:00:42
      300000 -- (-386.906) (-389.056) [-392.280] (-389.287) * (-390.782) [-390.044] (-388.998) (-388.803) -- 0:00:42

      Average standard deviation of split frequencies: 0.011713

      300500 -- (-390.637) (-387.143) (-389.708) [-391.324] * (-387.788) (-386.809) [-387.006] (-388.928) -- 0:00:41
      301000 -- (-386.933) [-387.880] (-391.734) (-389.487) * [-389.108] (-386.512) (-387.868) (-388.875) -- 0:00:41
      301500 -- (-390.199) (-387.324) [-389.096] (-389.913) * (-391.727) [-387.099] (-387.115) (-388.798) -- 0:00:41
      302000 -- (-387.855) [-387.539] (-387.949) (-387.921) * (-390.530) [-389.674] (-387.001) (-389.509) -- 0:00:41
      302500 -- [-387.887] (-392.642) (-387.156) (-387.179) * (-387.414) [-388.625] (-388.227) (-389.408) -- 0:00:41
      303000 -- (-387.496) (-393.066) (-389.023) [-387.861] * (-391.504) (-389.806) [-388.317] (-389.276) -- 0:00:41
      303500 -- (-392.653) [-388.706] (-388.922) (-391.123) * (-389.564) [-388.115] (-388.619) (-388.201) -- 0:00:41
      304000 -- (-388.789) [-394.002] (-387.983) (-388.276) * (-386.383) (-387.661) [-388.473] (-387.898) -- 0:00:41
      304500 -- (-390.620) (-389.620) (-388.960) [-386.845] * (-388.599) [-387.105] (-390.952) (-389.920) -- 0:00:41
      305000 -- (-389.375) [-388.367] (-387.577) (-388.605) * [-387.193] (-388.907) (-390.637) (-388.029) -- 0:00:41

      Average standard deviation of split frequencies: 0.011383

      305500 -- [-388.659] (-386.408) (-390.112) (-387.548) * (-388.705) [-389.508] (-388.624) (-388.257) -- 0:00:40
      306000 -- [-390.795] (-388.190) (-389.568) (-386.760) * (-388.504) (-389.436) [-386.182] (-387.867) -- 0:00:40
      306500 -- (-388.883) (-390.371) (-389.075) [-387.422] * (-390.884) [-389.597] (-387.699) (-390.938) -- 0:00:40
      307000 -- (-389.118) (-387.960) [-391.077] (-388.405) * [-388.318] (-387.191) (-387.228) (-387.023) -- 0:00:40
      307500 -- [-387.178] (-390.093) (-392.139) (-387.331) * (-389.269) [-386.852] (-387.392) (-389.265) -- 0:00:40
      308000 -- [-387.459] (-387.043) (-388.379) (-388.039) * (-387.024) (-390.642) (-388.213) [-389.358] -- 0:00:40
      308500 -- (-386.966) (-391.251) [-389.403] (-387.192) * (-386.631) (-390.456) (-392.826) [-389.481] -- 0:00:40
      309000 -- (-387.214) [-390.837] (-388.166) (-388.056) * (-389.692) [-388.333] (-388.537) (-389.127) -- 0:00:42
      309500 -- (-388.216) [-388.066] (-387.353) (-389.671) * (-389.264) [-393.934] (-392.616) (-386.592) -- 0:00:42
      310000 -- [-387.170] (-386.689) (-388.163) (-388.078) * [-387.297] (-389.954) (-391.759) (-386.284) -- 0:00:42

      Average standard deviation of split frequencies: 0.010875

      310500 -- [-387.797] (-387.420) (-390.707) (-388.964) * [-389.258] (-389.337) (-388.662) (-386.501) -- 0:00:42
      311000 -- [-389.258] (-386.697) (-389.642) (-386.740) * (-390.828) (-391.099) [-387.036] (-395.473) -- 0:00:42
      311500 -- [-386.233] (-387.355) (-388.653) (-388.741) * (-393.061) (-394.208) [-387.897] (-388.863) -- 0:00:41
      312000 -- (-387.820) [-388.472] (-388.962) (-387.379) * [-391.548] (-386.448) (-387.197) (-387.951) -- 0:00:41
      312500 -- (-387.243) (-391.482) (-389.639) [-392.598] * (-387.239) [-391.108] (-390.113) (-387.721) -- 0:00:41
      313000 -- (-387.002) [-386.227] (-388.310) (-389.595) * (-388.989) (-386.550) (-387.228) [-391.536] -- 0:00:41
      313500 -- (-390.001) [-387.505] (-386.604) (-386.886) * [-386.647] (-387.418) (-388.145) (-389.638) -- 0:00:41
      314000 -- (-388.393) (-387.513) [-387.549] (-387.550) * [-387.670] (-387.500) (-391.809) (-388.386) -- 0:00:41
      314500 -- (-386.956) (-386.815) (-390.421) [-387.046] * [-391.898] (-388.162) (-388.862) (-386.953) -- 0:00:41
      315000 -- (-388.106) (-390.391) [-388.864] (-388.822) * (-388.005) [-391.252] (-389.706) (-387.783) -- 0:00:41

      Average standard deviation of split frequencies: 0.009653

      315500 -- [-388.007] (-388.985) (-388.727) (-387.135) * (-389.826) (-387.437) (-387.050) [-387.874] -- 0:00:41
      316000 -- [-386.576] (-390.524) (-389.044) (-393.011) * (-387.933) (-389.880) (-387.069) [-386.520] -- 0:00:41
      316500 -- [-386.815] (-389.647) (-386.351) (-395.406) * (-392.932) (-388.821) (-391.531) [-388.529] -- 0:00:41
      317000 -- (-386.271) (-388.685) (-386.344) [-391.307] * (-394.214) (-390.366) (-391.326) [-393.948] -- 0:00:40
      317500 -- (-388.018) (-386.825) [-389.101] (-390.395) * (-391.259) (-387.593) [-387.849] (-388.578) -- 0:00:40
      318000 -- (-388.269) (-387.766) (-387.060) [-388.100] * (-390.500) (-391.077) [-387.824] (-389.589) -- 0:00:40
      318500 -- (-388.471) (-393.034) [-387.798] (-387.130) * (-387.493) (-390.804) [-389.009] (-387.232) -- 0:00:40
      319000 -- [-390.941] (-393.514) (-387.301) (-387.972) * (-392.839) (-386.315) [-387.899] (-386.992) -- 0:00:40
      319500 -- [-390.786] (-388.864) (-389.005) (-388.082) * [-389.914] (-388.783) (-388.806) (-387.496) -- 0:00:40
      320000 -- (-389.800) (-386.461) [-390.225] (-386.430) * (-390.016) [-387.179] (-386.692) (-388.742) -- 0:00:40

      Average standard deviation of split frequencies: 0.010683

      320500 -- (-389.543) [-386.734] (-389.536) (-388.335) * (-390.619) [-386.443] (-386.581) (-390.167) -- 0:00:40
      321000 -- [-390.020] (-390.521) (-387.910) (-389.728) * (-387.016) (-386.472) (-389.369) [-390.380] -- 0:00:40
      321500 -- (-386.348) (-387.758) (-387.233) [-386.262] * [-388.198] (-387.981) (-390.511) (-387.355) -- 0:00:40
      322000 -- (-389.446) (-388.464) (-390.590) [-390.509] * [-389.451] (-387.729) (-387.400) (-389.097) -- 0:00:40
      322500 -- (-388.369) (-387.563) (-388.002) [-386.639] * (-387.759) (-389.166) (-386.726) [-388.206] -- 0:00:39
      323000 -- (-388.064) (-388.991) (-386.416) [-388.284] * (-388.382) [-393.410] (-387.037) (-386.469) -- 0:00:39
      323500 -- (-388.653) (-389.003) [-388.364] (-390.839) * (-388.225) (-388.850) [-390.313] (-388.896) -- 0:00:39
      324000 -- [-387.712] (-388.792) (-388.140) (-390.746) * (-388.849) [-386.299] (-388.210) (-386.416) -- 0:00:39
      324500 -- (-391.243) (-386.346) (-393.615) [-390.244] * (-388.898) [-387.104] (-388.041) (-387.277) -- 0:00:39
      325000 -- (-387.084) (-387.317) [-386.344] (-388.953) * (-388.163) (-386.536) [-387.549] (-387.205) -- 0:00:39

      Average standard deviation of split frequencies: 0.012334

      325500 -- [-387.958] (-388.133) (-390.748) (-387.067) * (-389.039) (-387.563) (-389.887) [-388.271] -- 0:00:39
      326000 -- (-389.177) [-388.386] (-388.779) (-390.102) * (-390.340) [-387.881] (-389.202) (-388.366) -- 0:00:41
      326500 -- (-394.494) [-387.085] (-387.327) (-387.828) * (-387.756) (-394.278) [-388.378] (-390.149) -- 0:00:41
      327000 -- (-391.796) [-386.833] (-387.633) (-386.864) * (-388.071) (-388.171) (-388.895) [-387.110] -- 0:00:41
      327500 -- [-394.431] (-386.279) (-391.068) (-389.692) * [-387.059] (-388.816) (-388.795) (-387.317) -- 0:00:41
      328000 -- (-386.144) (-389.680) [-388.340] (-386.680) * (-386.626) [-387.827] (-386.998) (-393.613) -- 0:00:40
      328500 -- (-387.080) [-387.171] (-386.551) (-392.867) * (-387.096) [-386.683] (-386.748) (-394.083) -- 0:00:40
      329000 -- [-387.733] (-391.495) (-388.436) (-387.167) * (-389.374) [-386.978] (-388.213) (-388.632) -- 0:00:40
      329500 -- (-388.281) (-389.688) (-388.711) [-387.912] * [-392.596] (-391.989) (-388.553) (-390.732) -- 0:00:40
      330000 -- (-388.941) (-386.820) (-389.452) [-392.274] * (-387.394) (-386.869) (-388.117) [-390.062] -- 0:00:40

      Average standard deviation of split frequencies: 0.011405

      330500 -- (-389.403) [-386.788] (-389.784) (-389.644) * (-386.490) (-390.725) (-389.168) [-387.130] -- 0:00:40
      331000 -- [-391.036] (-389.613) (-389.026) (-386.792) * (-386.129) [-386.919] (-388.910) (-391.285) -- 0:00:40
      331500 -- [-387.291] (-389.874) (-388.004) (-388.414) * (-390.530) (-390.496) [-387.985] (-386.873) -- 0:00:40
      332000 -- (-389.061) [-390.419] (-393.789) (-388.270) * (-389.235) (-388.123) (-388.307) [-387.176] -- 0:00:40
      332500 -- (-386.957) [-389.249] (-388.663) (-386.650) * (-388.018) [-391.434] (-389.705) (-388.095) -- 0:00:40
      333000 -- (-390.565) (-388.594) (-389.095) [-388.248] * (-387.286) (-387.067) [-391.206] (-388.353) -- 0:00:40
      333500 -- [-386.930] (-388.192) (-390.214) (-387.681) * (-387.531) (-386.717) (-388.396) [-387.720] -- 0:00:39
      334000 -- [-393.302] (-391.376) (-386.349) (-388.248) * (-390.482) (-386.801) [-389.347] (-389.279) -- 0:00:39
      334500 -- (-389.802) [-389.414] (-390.351) (-388.141) * (-387.194) (-389.822) (-387.128) [-386.623] -- 0:00:39
      335000 -- (-388.746) (-389.198) (-391.575) [-386.577] * (-391.049) [-387.153] (-387.181) (-388.715) -- 0:00:39

      Average standard deviation of split frequencies: 0.012013

      335500 -- [-389.064] (-389.310) (-387.251) (-390.971) * (-387.004) (-389.394) [-388.628] (-387.747) -- 0:00:39
      336000 -- (-388.498) (-391.530) [-387.137] (-386.864) * (-390.168) (-388.351) (-387.872) [-388.144] -- 0:00:39
      336500 -- (-387.760) (-391.378) [-388.267] (-388.584) * (-389.652) (-389.497) (-386.887) [-388.018] -- 0:00:39
      337000 -- [-387.048] (-387.783) (-389.630) (-389.056) * (-388.100) [-387.807] (-388.645) (-392.399) -- 0:00:39
      337500 -- (-386.889) [-387.738] (-390.997) (-388.000) * (-387.655) (-389.218) (-388.162) [-387.759] -- 0:00:39
      338000 -- (-389.760) (-391.446) [-390.014] (-386.759) * (-388.323) (-390.499) [-387.309] (-388.504) -- 0:00:39
      338500 -- [-388.159] (-386.433) (-389.115) (-389.328) * [-388.416] (-389.321) (-387.994) (-390.131) -- 0:00:39
      339000 -- (-388.712) [-388.049] (-392.913) (-390.634) * [-386.882] (-388.672) (-387.762) (-390.775) -- 0:00:38
      339500 -- (-390.790) (-388.430) [-387.457] (-388.537) * [-388.018] (-391.914) (-389.261) (-395.757) -- 0:00:38
      340000 -- (-386.876) [-389.211] (-387.945) (-394.605) * [-387.657] (-387.051) (-386.387) (-390.207) -- 0:00:38

      Average standard deviation of split frequencies: 0.011157

      340500 -- [-390.455] (-390.538) (-387.648) (-388.007) * (-388.923) (-389.641) [-386.787] (-390.890) -- 0:00:38
      341000 -- (-388.893) (-390.364) [-388.507] (-388.561) * (-387.860) (-389.597) [-386.638] (-387.642) -- 0:00:38
      341500 -- [-391.243] (-386.356) (-391.167) (-388.397) * (-389.172) (-390.994) (-388.836) [-387.463] -- 0:00:38
      342000 -- (-387.417) (-390.216) (-387.333) [-387.005] * (-388.627) (-388.846) (-389.003) [-388.716] -- 0:00:38
      342500 -- [-386.993] (-390.274) (-388.503) (-386.829) * (-389.221) (-391.210) (-387.262) [-387.663] -- 0:00:38
      343000 -- [-388.411] (-389.257) (-393.686) (-387.617) * (-393.830) (-389.933) (-387.327) [-387.027] -- 0:00:40
      343500 -- (-389.674) (-387.928) (-387.403) [-388.161] * [-389.741] (-389.722) (-390.699) (-388.307) -- 0:00:40
      344000 -- (-389.472) (-388.603) (-389.817) [-387.395] * (-391.853) (-391.174) [-388.024] (-393.222) -- 0:00:40
      344500 -- (-387.579) (-389.304) [-389.102] (-388.400) * (-391.891) [-388.001] (-389.343) (-389.371) -- 0:00:39
      345000 -- (-388.355) (-388.018) [-387.588] (-387.673) * (-388.101) (-387.726) (-390.804) [-390.648] -- 0:00:39

      Average standard deviation of split frequencies: 0.011581

      345500 -- (-388.783) [-386.872] (-388.771) (-386.922) * [-386.100] (-386.301) (-387.283) (-388.480) -- 0:00:39
      346000 -- (-389.451) (-386.989) (-391.280) [-386.979] * [-387.074] (-389.286) (-387.193) (-387.568) -- 0:00:39
      346500 -- (-392.851) [-387.442] (-388.656) (-386.220) * (-389.487) [-389.713] (-386.483) (-389.759) -- 0:00:39
      347000 -- (-388.609) [-387.454] (-388.953) (-387.202) * (-388.246) (-390.444) [-388.456] (-388.267) -- 0:00:39
      347500 -- (-388.220) (-386.228) (-389.817) [-391.032] * (-387.593) [-386.353] (-388.774) (-389.854) -- 0:00:39
      348000 -- (-388.285) [-388.029] (-394.949) (-392.031) * (-388.463) (-390.234) [-393.281] (-391.545) -- 0:00:39
      348500 -- (-387.996) (-390.201) (-389.056) [-387.920] * [-390.838] (-388.540) (-387.212) (-393.143) -- 0:00:39
      349000 -- (-387.445) [-388.316] (-389.592) (-386.444) * (-387.481) [-393.119] (-386.912) (-388.407) -- 0:00:39
      349500 -- (-388.082) (-391.351) [-388.411] (-386.787) * (-388.692) (-391.697) [-386.991] (-390.796) -- 0:00:39
      350000 -- (-388.536) (-389.346) [-387.750] (-386.852) * [-391.168] (-390.468) (-387.691) (-387.831) -- 0:00:39

      Average standard deviation of split frequencies: 0.011561

      350500 -- (-387.632) [-388.326] (-388.404) (-386.763) * [-388.093] (-390.868) (-387.337) (-386.963) -- 0:00:38
      351000 -- (-387.842) [-389.761] (-388.754) (-386.821) * (-387.048) (-388.178) (-388.808) [-389.234] -- 0:00:38
      351500 -- [-388.284] (-388.218) (-386.726) (-389.194) * (-389.080) [-388.405] (-388.275) (-389.371) -- 0:00:38
      352000 -- (-388.990) (-390.049) (-387.333) [-387.817] * (-388.367) (-386.892) [-396.327] (-386.352) -- 0:00:38
      352500 -- (-388.955) [-388.885] (-387.098) (-387.646) * [-390.564] (-388.688) (-387.897) (-387.176) -- 0:00:38
      353000 -- (-389.095) (-387.864) (-390.620) [-390.796] * [-389.417] (-386.694) (-388.547) (-387.609) -- 0:00:38
      353500 -- (-390.128) [-387.617] (-391.081) (-393.487) * [-386.684] (-390.247) (-387.570) (-386.831) -- 0:00:38
      354000 -- (-386.710) (-388.250) [-388.615] (-388.962) * (-388.779) [-388.315] (-388.236) (-389.752) -- 0:00:38
      354500 -- [-386.939] (-391.447) (-387.741) (-388.167) * (-389.557) (-387.683) (-388.863) [-392.485] -- 0:00:38
      355000 -- [-389.003] (-389.665) (-388.397) (-386.774) * [-387.858] (-387.545) (-392.887) (-394.225) -- 0:00:38

      Average standard deviation of split frequencies: 0.010858

      355500 -- [-387.413] (-388.744) (-387.062) (-386.724) * (-393.034) (-389.791) [-387.294] (-391.963) -- 0:00:38
      356000 -- [-387.479] (-388.871) (-387.872) (-387.013) * (-393.637) (-391.053) [-387.150] (-391.382) -- 0:00:37
      356500 -- (-392.918) (-388.844) (-388.707) [-387.189] * [-387.195] (-389.242) (-390.030) (-386.473) -- 0:00:37
      357000 -- (-391.496) (-391.932) (-386.726) [-387.971] * (-387.279) (-386.307) [-387.445] (-390.870) -- 0:00:37
      357500 -- (-389.147) (-388.134) (-389.138) [-387.634] * (-389.634) (-387.283) (-386.415) [-390.047] -- 0:00:37
      358000 -- (-388.875) (-386.879) [-387.503] (-391.374) * (-389.042) (-389.055) (-387.647) [-386.110] -- 0:00:37
      358500 -- (-388.631) (-388.078) (-389.449) [-386.791] * [-386.684] (-391.229) (-386.303) (-388.052) -- 0:00:37
      359000 -- (-388.680) (-389.799) (-389.265) [-389.831] * (-388.629) [-389.514] (-386.077) (-387.587) -- 0:00:37
      359500 -- [-387.371] (-388.618) (-388.486) (-389.613) * (-388.331) (-390.110) (-386.439) [-388.138] -- 0:00:37
      360000 -- (-387.893) (-386.980) [-388.191] (-388.483) * (-390.188) [-386.681] (-387.011) (-387.697) -- 0:00:39

      Average standard deviation of split frequencies: 0.010456

      360500 -- (-388.907) (-387.644) (-390.560) [-387.666] * (-387.963) [-387.886] (-391.209) (-389.179) -- 0:00:39
      361000 -- [-388.679] (-387.446) (-387.642) (-390.644) * [-389.250] (-387.021) (-387.878) (-388.465) -- 0:00:38
      361500 -- (-389.790) (-387.897) [-386.709] (-390.488) * (-390.318) [-388.330] (-389.052) (-386.250) -- 0:00:38
      362000 -- (-395.712) (-387.402) (-387.959) [-388.999] * (-392.049) (-389.997) (-388.357) [-387.955] -- 0:00:38
      362500 -- (-388.729) (-388.899) (-392.758) [-390.212] * (-390.022) (-389.760) [-388.293] (-387.406) -- 0:00:38
      363000 -- [-387.656] (-388.268) (-386.784) (-387.482) * [-388.793] (-388.237) (-392.273) (-389.145) -- 0:00:38
      363500 -- (-388.003) (-386.683) (-387.795) [-388.764] * (-386.700) [-388.631] (-387.975) (-387.840) -- 0:00:38
      364000 -- (-389.613) (-388.361) (-389.195) [-387.384] * (-390.225) (-389.491) [-387.477] (-387.706) -- 0:00:38
      364500 -- (-387.456) (-389.783) [-386.788] (-391.042) * [-387.500] (-390.120) (-388.324) (-386.363) -- 0:00:38
      365000 -- [-390.784] (-390.070) (-390.748) (-389.221) * (-386.963) (-391.439) [-389.395] (-389.278) -- 0:00:38

      Average standard deviation of split frequencies: 0.010046

      365500 -- (-393.082) [-389.231] (-387.124) (-389.039) * (-387.582) [-389.299] (-387.558) (-393.118) -- 0:00:38
      366000 -- (-386.976) [-390.755] (-386.687) (-390.767) * (-390.319) [-387.655] (-387.477) (-386.673) -- 0:00:38
      366500 -- (-390.705) [-390.620] (-386.818) (-389.573) * (-389.208) (-388.299) (-389.532) [-389.396] -- 0:00:38
      367000 -- [-390.222] (-390.134) (-389.826) (-386.908) * (-388.496) [-388.833] (-386.847) (-387.769) -- 0:00:37
      367500 -- [-390.776] (-387.164) (-387.782) (-387.979) * (-388.275) [-387.118] (-386.729) (-387.654) -- 0:00:37
      368000 -- [-390.190] (-387.904) (-392.331) (-388.596) * (-392.617) [-390.277] (-389.972) (-388.199) -- 0:00:37
      368500 -- (-387.493) [-390.809] (-394.211) (-390.828) * [-390.465] (-387.592) (-386.819) (-390.124) -- 0:00:37
      369000 -- (-386.239) [-388.940] (-388.386) (-388.533) * (-386.232) [-388.983] (-388.613) (-388.766) -- 0:00:37
      369500 -- [-390.215] (-389.139) (-390.236) (-390.186) * (-387.389) (-389.628) [-388.199] (-387.202) -- 0:00:37
      370000 -- (-391.833) [-387.854] (-387.620) (-387.961) * (-389.896) (-396.808) (-391.607) [-388.443] -- 0:00:37

      Average standard deviation of split frequencies: 0.009750

      370500 -- [-391.271] (-390.831) (-391.893) (-387.584) * (-388.180) (-395.744) (-386.640) [-387.851] -- 0:00:37
      371000 -- (-391.092) (-389.432) (-390.658) [-387.429] * (-387.228) (-387.406) (-390.476) [-387.039] -- 0:00:37
      371500 -- (-388.232) (-389.521) [-388.562] (-386.450) * [-388.416] (-388.207) (-391.979) (-387.401) -- 0:00:37
      372000 -- (-388.955) (-389.203) [-387.859] (-389.549) * (-389.989) [-387.674] (-389.847) (-388.777) -- 0:00:37
      372500 -- (-386.476) (-387.858) [-389.297] (-396.712) * (-386.830) [-387.282] (-390.891) (-389.825) -- 0:00:37
      373000 -- [-391.349] (-389.447) (-392.308) (-389.900) * [-387.569] (-392.973) (-388.839) (-387.955) -- 0:00:36
      373500 -- (-388.661) [-388.741] (-388.791) (-390.306) * [-389.095] (-387.780) (-391.255) (-392.647) -- 0:00:36
      374000 -- (-388.637) [-387.401] (-390.085) (-392.440) * (-390.001) (-388.011) [-387.611] (-389.183) -- 0:00:36
      374500 -- (-387.873) (-388.240) [-386.747] (-387.144) * (-389.685) (-387.585) [-389.081] (-387.699) -- 0:00:36
      375000 -- [-387.428] (-388.871) (-386.630) (-393.249) * (-389.440) (-386.597) [-392.857] (-391.566) -- 0:00:36

      Average standard deviation of split frequencies: 0.009361

      375500 -- (-386.399) (-386.729) [-387.968] (-390.905) * (-389.095) (-389.959) [-392.719] (-391.249) -- 0:00:36
      376000 -- [-387.148] (-388.330) (-392.588) (-392.243) * [-390.320] (-391.939) (-391.975) (-390.455) -- 0:00:36
      376500 -- [-387.680] (-387.117) (-390.606) (-386.780) * (-390.050) (-393.753) [-387.632] (-392.269) -- 0:00:36
      377000 -- [-387.424] (-388.545) (-391.400) (-389.108) * (-389.872) [-391.034] (-387.447) (-387.990) -- 0:00:38
      377500 -- [-390.213] (-389.009) (-387.671) (-391.770) * (-387.754) (-391.515) [-388.274] (-389.890) -- 0:00:37
      378000 -- (-388.837) (-387.129) [-386.517] (-386.968) * (-386.883) (-388.003) (-386.643) [-389.802] -- 0:00:37
      378500 -- (-391.812) (-388.052) [-388.808] (-387.629) * [-388.058] (-389.242) (-388.765) (-387.025) -- 0:00:37
      379000 -- (-388.893) (-386.294) (-390.216) [-386.986] * (-389.436) [-386.193] (-387.712) (-389.230) -- 0:00:37
      379500 -- (-386.274) (-393.407) [-386.705] (-389.641) * (-388.511) (-386.695) (-386.843) [-389.678] -- 0:00:37
      380000 -- (-391.830) (-390.964) [-390.264] (-388.646) * (-387.751) (-389.108) (-388.783) [-387.721] -- 0:00:37

      Average standard deviation of split frequencies: 0.008999

      380500 -- [-387.854] (-387.529) (-388.222) (-389.605) * (-386.851) (-390.156) (-386.832) [-388.829] -- 0:00:37
      381000 -- [-390.568] (-386.249) (-386.858) (-387.525) * (-388.624) [-386.715] (-387.702) (-394.438) -- 0:00:37
      381500 -- (-387.590) (-387.826) [-388.304] (-387.890) * (-390.337) (-389.006) (-386.463) [-392.490] -- 0:00:37
      382000 -- [-392.333] (-391.250) (-392.349) (-388.815) * (-390.548) [-392.293] (-387.530) (-386.336) -- 0:00:37
      382500 -- (-389.759) [-386.282] (-386.794) (-388.496) * (-386.197) (-387.780) (-387.391) [-387.078] -- 0:00:37
      383000 -- (-394.824) (-388.374) (-393.041) [-387.485] * (-387.155) (-387.409) [-390.263] (-387.792) -- 0:00:37
      383500 -- (-389.133) [-389.331] (-389.197) (-386.955) * (-390.767) (-390.859) (-392.237) [-389.452] -- 0:00:36
      384000 -- (-394.626) [-390.792] (-389.571) (-387.552) * (-388.310) (-388.486) [-387.500] (-388.739) -- 0:00:36
      384500 -- (-387.869) (-391.699) (-389.126) [-390.796] * (-388.929) (-387.204) [-390.011] (-389.747) -- 0:00:36
      385000 -- [-389.099] (-388.637) (-394.255) (-388.348) * [-389.940] (-390.143) (-388.319) (-391.587) -- 0:00:36

      Average standard deviation of split frequencies: 0.008793

      385500 -- [-389.069] (-386.939) (-388.209) (-387.919) * [-387.194] (-387.552) (-387.821) (-390.560) -- 0:00:36
      386000 -- (-388.645) [-387.852] (-390.240) (-386.644) * [-387.943] (-386.616) (-387.843) (-390.326) -- 0:00:36
      386500 -- (-387.467) (-387.983) (-389.833) [-386.426] * (-386.415) (-388.153) [-388.554] (-389.578) -- 0:00:36
      387000 -- (-389.303) (-392.078) (-388.164) [-388.931] * (-387.350) [-386.622] (-388.869) (-389.238) -- 0:00:36
      387500 -- (-389.336) [-393.113] (-389.868) (-387.036) * (-386.910) (-387.343) (-390.828) [-390.226] -- 0:00:36
      388000 -- [-386.984] (-389.682) (-391.654) (-388.562) * (-388.164) [-387.355] (-389.685) (-388.584) -- 0:00:36
      388500 -- (-389.227) (-388.036) (-392.104) [-388.699] * (-387.786) (-388.648) (-386.205) [-386.880] -- 0:00:36
      389000 -- [-387.656] (-388.033) (-390.091) (-386.079) * (-388.629) (-387.531) [-388.305] (-386.833) -- 0:00:36
      389500 -- (-388.235) [-388.099] (-387.306) (-387.073) * (-392.623) (-387.943) (-390.512) [-387.215] -- 0:00:36
      390000 -- [-390.165] (-391.569) (-386.239) (-390.187) * (-392.503) (-389.605) [-387.462] (-386.692) -- 0:00:35

      Average standard deviation of split frequencies: 0.008929

      390500 -- (-387.576) (-390.023) (-387.806) [-394.896] * (-394.190) [-389.555] (-386.755) (-387.666) -- 0:00:35
      391000 -- (-387.337) (-390.772) [-387.827] (-389.312) * [-389.773] (-386.949) (-389.460) (-388.668) -- 0:00:35
      391500 -- [-388.002] (-388.689) (-388.367) (-389.220) * [-390.861] (-388.213) (-392.455) (-386.411) -- 0:00:35
      392000 -- (-390.463) (-388.661) (-387.284) [-389.079] * (-388.240) [-386.838] (-396.152) (-385.991) -- 0:00:35
      392500 -- (-388.692) [-387.478] (-386.721) (-389.282) * (-387.872) [-387.078] (-387.842) (-387.140) -- 0:00:35
      393000 -- (-389.733) (-392.460) [-388.642] (-390.509) * (-389.674) (-385.994) (-386.307) [-389.973] -- 0:00:35
      393500 -- (-386.836) (-389.239) [-386.999] (-388.930) * (-388.015) (-387.450) (-388.378) [-389.719] -- 0:00:35
      394000 -- (-388.060) (-386.991) [-386.764] (-389.915) * (-388.884) (-388.223) [-387.436] (-388.101) -- 0:00:36
      394500 -- [-389.161] (-387.434) (-390.171) (-392.995) * (-398.600) (-387.283) (-391.200) [-389.185] -- 0:00:36
      395000 -- (-389.257) (-388.527) [-390.293] (-392.507) * (-388.656) [-389.124] (-392.129) (-391.328) -- 0:00:36

      Average standard deviation of split frequencies: 0.008968

      395500 -- (-386.955) (-387.352) (-391.196) [-387.420] * (-388.068) [-387.974] (-389.067) (-388.058) -- 0:00:36
      396000 -- (-388.153) (-387.614) (-389.609) [-387.778] * (-389.326) (-388.309) (-389.565) [-387.417] -- 0:00:36
      396500 -- (-386.852) [-388.426] (-386.826) (-392.240) * (-388.816) [-388.527] (-393.319) (-387.411) -- 0:00:36
      397000 -- (-387.755) (-387.188) (-387.735) [-390.778] * [-389.524] (-389.693) (-390.001) (-388.759) -- 0:00:36
      397500 -- [-390.718] (-389.282) (-387.521) (-388.196) * (-389.306) [-386.144] (-388.669) (-388.107) -- 0:00:36
      398000 -- [-387.311] (-388.454) (-388.131) (-389.431) * [-389.258] (-388.466) (-385.983) (-390.858) -- 0:00:36
      398500 -- (-389.297) (-388.643) [-391.047] (-389.527) * [-387.204] (-389.398) (-387.514) (-386.221) -- 0:00:36
      399000 -- (-391.218) [-387.322] (-388.661) (-388.025) * (-388.807) [-386.828] (-386.195) (-386.869) -- 0:00:36
      399500 -- (-387.593) (-389.640) [-387.100] (-386.893) * [-388.887] (-387.544) (-386.456) (-390.103) -- 0:00:36
      400000 -- (-388.754) [-389.868] (-390.464) (-389.161) * (-388.648) (-387.248) (-386.942) [-392.535] -- 0:00:36

      Average standard deviation of split frequencies: 0.008824

      400500 -- (-388.153) [-389.899] (-389.125) (-390.444) * [-389.670] (-389.451) (-392.176) (-389.217) -- 0:00:35
      401000 -- (-387.455) (-388.761) [-389.532] (-389.308) * (-386.250) (-391.121) (-395.011) [-387.051] -- 0:00:35
      401500 -- [-393.591] (-391.126) (-389.764) (-389.587) * (-393.451) (-390.990) (-388.098) [-387.471] -- 0:00:35
      402000 -- (-388.830) [-389.835] (-388.322) (-390.378) * (-393.139) [-387.763] (-390.183) (-386.499) -- 0:00:35
      402500 -- (-389.652) (-387.631) (-388.033) [-386.322] * (-387.818) [-390.125] (-387.847) (-387.238) -- 0:00:35
      403000 -- (-388.020) [-389.617] (-393.287) (-387.123) * (-387.761) (-388.776) (-388.207) [-388.578] -- 0:00:35
      403500 -- (-388.608) (-386.823) [-386.737] (-391.898) * (-386.386) (-388.500) [-388.465] (-388.720) -- 0:00:35
      404000 -- (-388.922) (-388.729) (-389.051) [-389.608] * (-390.207) [-387.292] (-391.111) (-390.497) -- 0:00:35
      404500 -- (-389.795) (-389.376) [-388.451] (-392.073) * (-387.059) [-387.030] (-387.251) (-391.676) -- 0:00:35
      405000 -- (-389.982) (-388.209) [-386.666] (-390.559) * [-386.841] (-386.735) (-395.724) (-387.293) -- 0:00:35

      Average standard deviation of split frequencies: 0.008264

      405500 -- (-386.353) [-388.837] (-389.455) (-388.341) * [-388.114] (-389.039) (-390.596) (-388.194) -- 0:00:35
      406000 -- (-388.923) (-387.999) (-387.360) [-388.047] * (-392.523) (-388.992) (-388.174) [-389.309] -- 0:00:35
      406500 -- (-388.103) [-386.593] (-387.544) (-387.110) * [-386.713] (-392.080) (-387.871) (-389.421) -- 0:00:35
      407000 -- (-388.609) (-386.026) (-387.862) [-388.818] * (-387.008) [-389.681] (-390.428) (-387.166) -- 0:00:34
      407500 -- (-386.704) [-387.048] (-390.656) (-386.989) * (-388.447) (-389.942) (-388.966) [-387.579] -- 0:00:34
      408000 -- (-386.496) [-398.657] (-395.004) (-388.307) * (-387.838) (-387.233) [-388.391] (-387.516) -- 0:00:34
      408500 -- [-386.722] (-400.153) (-386.424) (-389.150) * [-388.653] (-388.062) (-394.817) (-388.111) -- 0:00:34
      409000 -- (-388.480) (-390.842) [-387.488] (-386.653) * (-389.120) (-392.652) [-386.745] (-389.444) -- 0:00:34
      409500 -- (-388.958) (-388.996) [-386.386] (-390.059) * [-386.327] (-391.061) (-387.248) (-386.993) -- 0:00:34
      410000 -- (-395.978) (-389.526) (-387.235) [-388.389] * (-389.041) (-389.255) (-387.260) [-387.021] -- 0:00:34

      Average standard deviation of split frequencies: 0.008440

      410500 -- (-386.435) [-388.238] (-387.644) (-389.985) * [-389.439] (-389.470) (-387.799) (-387.210) -- 0:00:34
      411000 -- (-390.323) (-387.944) [-387.300] (-387.375) * [-389.816] (-389.726) (-387.575) (-394.071) -- 0:00:35
      411500 -- (-388.733) [-386.527] (-387.470) (-387.518) * [-388.493] (-388.062) (-387.913) (-389.460) -- 0:00:35
      412000 -- [-386.829] (-386.359) (-391.745) (-387.755) * [-387.639] (-386.827) (-386.820) (-386.248) -- 0:00:35
      412500 -- (-387.754) [-386.833] (-387.965) (-390.039) * [-388.660] (-389.760) (-386.644) (-390.169) -- 0:00:35
      413000 -- (-388.490) (-389.038) (-392.117) [-388.847] * (-386.407) (-387.853) [-388.703] (-390.278) -- 0:00:35
      413500 -- (-389.575) (-396.637) [-388.279] (-388.810) * (-393.031) (-387.978) [-388.310] (-389.454) -- 0:00:35
      414000 -- [-387.392] (-387.649) (-387.150) (-387.890) * [-389.333] (-386.675) (-388.844) (-390.675) -- 0:00:35
      414500 -- (-387.497) (-388.334) (-388.164) [-388.895] * (-391.934) (-388.294) [-387.083] (-386.635) -- 0:00:35
      415000 -- (-388.008) (-386.745) (-389.611) [-388.957] * (-386.357) (-386.727) (-391.495) [-387.828] -- 0:00:35

      Average standard deviation of split frequencies: 0.008711

      415500 -- [-388.089] (-389.698) (-390.113) (-392.902) * (-386.898) (-386.718) (-388.569) [-387.914] -- 0:00:35
      416000 -- (-387.082) [-389.162] (-387.316) (-387.147) * (-387.699) (-391.945) [-392.729] (-390.711) -- 0:00:35
      416500 -- (-389.238) (-386.443) (-386.944) [-387.884] * [-389.136] (-391.792) (-390.793) (-390.514) -- 0:00:35
      417000 -- (-388.129) (-391.849) [-389.814] (-388.920) * [-386.910] (-389.034) (-387.187) (-386.429) -- 0:00:34
      417500 -- (-387.658) [-386.249] (-388.938) (-388.224) * [-386.979] (-389.960) (-388.701) (-386.434) -- 0:00:34
      418000 -- (-390.420) [-387.097] (-388.041) (-388.777) * [-389.350] (-387.573) (-391.026) (-386.156) -- 0:00:34
      418500 -- [-388.167] (-386.851) (-390.011) (-390.387) * (-393.588) [-390.521] (-389.079) (-394.723) -- 0:00:34
      419000 -- [-389.077] (-389.437) (-392.111) (-387.615) * [-391.001] (-386.917) (-388.553) (-386.258) -- 0:00:34
      419500 -- (-388.316) (-388.855) [-389.241] (-387.979) * (-388.836) (-390.866) (-390.208) [-388.459] -- 0:00:34
      420000 -- (-386.937) [-397.301] (-387.536) (-387.777) * (-387.299) (-390.650) [-387.820] (-387.028) -- 0:00:34

      Average standard deviation of split frequencies: 0.008405

      420500 -- [-388.090] (-393.142) (-388.796) (-389.614) * (-388.192) (-390.639) [-387.919] (-386.847) -- 0:00:34
      421000 -- (-393.193) (-388.184) (-388.369) [-390.586] * (-389.452) (-389.963) [-390.207] (-387.965) -- 0:00:34
      421500 -- (-389.928) (-388.676) [-388.273] (-390.401) * (-387.913) (-388.785) [-387.737] (-387.470) -- 0:00:34
      422000 -- (-386.914) (-390.022) (-389.917) [-387.812] * (-387.293) (-387.980) [-387.062] (-389.188) -- 0:00:34
      422500 -- (-386.347) (-388.155) (-387.538) [-392.853] * (-390.120) (-386.973) (-389.659) [-386.042] -- 0:00:34
      423000 -- (-387.005) [-387.362] (-387.096) (-391.260) * (-388.952) (-391.124) (-389.165) [-389.282] -- 0:00:34
      423500 -- (-387.331) (-387.208) (-390.210) [-389.016] * [-388.377] (-387.961) (-387.650) (-389.371) -- 0:00:34
      424000 -- (-387.386) (-391.332) [-388.164] (-388.226) * (-388.257) [-387.544] (-388.597) (-390.537) -- 0:00:33
      424500 -- [-386.713] (-387.673) (-389.298) (-387.325) * (-390.070) (-392.640) [-388.017] (-387.343) -- 0:00:33
      425000 -- [-391.185] (-390.247) (-389.523) (-387.273) * (-386.932) (-393.670) (-388.598) [-387.845] -- 0:00:33

      Average standard deviation of split frequencies: 0.008507

      425500 -- (-388.442) (-388.988) [-388.839] (-390.090) * (-387.523) [-389.146] (-387.538) (-388.042) -- 0:00:33
      426000 -- (-390.365) (-392.105) [-387.320] (-386.917) * (-386.688) (-390.337) [-387.695] (-387.551) -- 0:00:33
      426500 -- (-391.679) (-392.735) [-387.974] (-395.920) * [-389.310] (-391.130) (-390.168) (-388.748) -- 0:00:33
      427000 -- (-393.822) [-388.344] (-389.226) (-394.078) * (-392.057) (-390.211) (-389.505) [-387.325] -- 0:00:33
      427500 -- (-386.229) [-388.119] (-389.900) (-386.722) * (-387.106) (-389.545) [-389.139] (-389.876) -- 0:00:34
      428000 -- (-386.052) (-386.767) [-387.951] (-387.967) * (-386.108) (-386.854) (-387.484) [-387.591] -- 0:00:34
      428500 -- [-386.090] (-390.342) (-386.711) (-389.109) * (-386.375) (-387.677) (-387.234) [-387.654] -- 0:00:34
      429000 -- [-386.289] (-387.410) (-388.029) (-387.154) * (-393.371) [-388.975] (-394.167) (-390.368) -- 0:00:34
      429500 -- (-387.016) (-389.300) (-389.037) [-389.396] * (-387.632) (-394.558) (-389.193) [-388.241] -- 0:00:34
      430000 -- (-388.410) [-392.401] (-390.483) (-389.625) * (-386.725) [-387.600] (-390.590) (-386.041) -- 0:00:34

      Average standard deviation of split frequencies: 0.008141

      430500 -- (-386.978) [-388.459] (-388.886) (-387.789) * (-386.347) (-391.252) (-387.666) [-387.206] -- 0:00:34
      431000 -- (-386.452) (-387.987) (-388.247) [-387.152] * (-386.519) [-387.010] (-390.671) (-388.468) -- 0:00:34
      431500 -- (-387.498) (-388.649) (-388.866) [-387.767] * (-389.329) [-388.666] (-389.433) (-388.523) -- 0:00:34
      432000 -- [-387.505] (-389.517) (-388.471) (-388.260) * (-387.223) (-390.293) (-389.081) [-389.818] -- 0:00:34
      432500 -- (-387.340) (-387.949) [-388.587] (-387.908) * (-387.158) (-391.587) (-387.311) [-387.120] -- 0:00:34
      433000 -- (-386.996) [-388.586] (-388.615) (-388.772) * (-387.209) (-388.020) [-389.444] (-389.456) -- 0:00:34
      433500 -- (-389.413) (-389.941) (-390.060) [-386.220] * (-387.841) [-389.015] (-390.883) (-389.822) -- 0:00:33
      434000 -- [-389.069] (-387.867) (-390.176) (-387.947) * (-388.205) (-389.271) [-391.106] (-389.471) -- 0:00:33
      434500 -- (-395.176) (-386.848) (-393.641) [-387.202] * (-389.385) (-386.869) [-388.372] (-387.787) -- 0:00:33
      435000 -- (-389.402) (-386.936) (-389.652) [-388.700] * [-389.619] (-388.391) (-387.149) (-389.854) -- 0:00:33

      Average standard deviation of split frequencies: 0.008204

      435500 -- (-389.862) (-386.841) [-390.579] (-387.625) * (-392.036) [-388.824] (-386.324) (-387.193) -- 0:00:33
      436000 -- (-387.052) (-387.712) [-387.146] (-388.580) * [-390.185] (-387.716) (-390.457) (-389.833) -- 0:00:33
      436500 -- (-388.381) [-387.324] (-388.177) (-389.958) * (-386.817) (-386.758) [-392.457] (-389.959) -- 0:00:33
      437000 -- (-386.441) [-388.104] (-388.940) (-389.211) * (-387.906) (-388.788) [-390.290] (-394.490) -- 0:00:33
      437500 -- (-386.366) (-386.345) (-389.632) [-389.131] * (-387.891) (-386.843) (-389.175) [-388.117] -- 0:00:33
      438000 -- (-387.314) (-387.696) [-387.224] (-391.647) * (-386.403) (-388.423) (-391.410) [-387.758] -- 0:00:33
      438500 -- (-388.283) (-387.214) [-388.142] (-391.829) * [-386.713] (-388.159) (-389.043) (-388.263) -- 0:00:33
      439000 -- [-394.254] (-387.886) (-389.628) (-392.165) * (-386.399) (-390.134) [-387.495] (-390.732) -- 0:00:33
      439500 -- (-387.150) [-387.121] (-388.714) (-387.332) * (-387.694) [-388.845] (-390.695) (-388.955) -- 0:00:33
      440000 -- (-386.831) (-390.263) [-386.407] (-389.260) * (-387.794) (-387.699) (-390.589) [-390.148] -- 0:00:33

      Average standard deviation of split frequencies: 0.008059

      440500 -- (-389.741) (-389.929) [-388.407] (-389.189) * (-389.144) [-387.890] (-391.780) (-394.477) -- 0:00:33
      441000 -- (-387.044) [-388.504] (-390.780) (-391.009) * (-392.041) [-387.047] (-389.475) (-389.511) -- 0:00:32
      441500 -- [-387.539] (-387.674) (-388.103) (-390.360) * (-386.597) (-390.920) [-390.223] (-389.004) -- 0:00:32
      442000 -- (-386.950) (-389.104) [-391.523] (-387.425) * (-387.010) (-392.606) [-389.337] (-391.522) -- 0:00:32
      442500 -- (-386.647) (-388.616) [-389.133] (-391.411) * (-388.234) (-390.761) [-390.173] (-388.308) -- 0:00:32
      443000 -- [-390.903] (-391.067) (-387.655) (-393.621) * (-387.221) (-390.980) [-389.942] (-389.808) -- 0:00:32
      443500 -- (-393.117) (-387.158) [-386.822] (-390.403) * (-386.910) [-387.121] (-387.594) (-391.167) -- 0:00:32
      444000 -- (-389.637) (-387.345) [-388.966] (-389.999) * (-393.321) (-388.492) [-387.567] (-388.539) -- 0:00:32
      444500 -- (-387.516) (-386.951) (-401.371) [-386.610] * (-389.362) (-387.790) (-391.064) [-386.753] -- 0:00:33
      445000 -- (-391.949) (-388.201) (-391.984) [-389.007] * (-389.330) (-387.146) [-387.851] (-387.898) -- 0:00:33

      Average standard deviation of split frequencies: 0.007993

      445500 -- (-387.517) [-392.076] (-388.939) (-387.058) * [-392.500] (-386.909) (-389.003) (-394.201) -- 0:00:33
      446000 -- (-391.274) (-393.336) (-387.978) [-386.645] * [-388.264] (-386.893) (-388.278) (-391.439) -- 0:00:33
      446500 -- (-387.099) (-387.779) (-392.231) [-388.245] * [-386.515] (-386.357) (-390.508) (-387.971) -- 0:00:33
      447000 -- (-388.784) [-386.344] (-387.731) (-390.801) * (-390.177) (-387.215) (-390.238) [-388.440] -- 0:00:33
      447500 -- (-387.330) (-388.687) [-387.944] (-388.130) * (-388.814) [-390.517] (-388.890) (-392.319) -- 0:00:33
      448000 -- (-389.661) (-387.565) [-387.306] (-389.765) * (-393.397) (-391.425) (-391.451) [-388.542] -- 0:00:33
      448500 -- (-394.663) (-388.712) (-389.000) [-387.692] * [-388.209] (-389.686) (-388.924) (-389.155) -- 0:00:33
      449000 -- (-399.367) (-387.239) (-386.565) [-387.928] * (-386.579) (-388.858) [-389.233] (-392.779) -- 0:00:33
      449500 -- (-389.071) (-388.686) [-386.939] (-391.391) * [-388.110] (-390.163) (-392.331) (-389.401) -- 0:00:33
      450000 -- (-386.836) (-392.250) [-386.562] (-390.921) * (-388.174) (-387.393) (-387.049) [-391.835] -- 0:00:33

      Average standard deviation of split frequencies: 0.008237

      450500 -- (-386.390) [-390.402] (-387.971) (-387.750) * [-388.365] (-388.431) (-387.151) (-386.253) -- 0:00:32
      451000 -- [-387.756] (-386.734) (-386.268) (-387.553) * (-389.776) (-393.365) (-390.448) [-388.480] -- 0:00:32
      451500 -- (-387.606) (-386.956) [-388.333] (-386.759) * [-393.032] (-389.608) (-389.271) (-387.625) -- 0:00:32
      452000 -- [-386.304] (-387.234) (-392.275) (-387.326) * (-389.598) (-389.120) [-387.409] (-387.317) -- 0:00:32
      452500 -- [-389.246] (-388.539) (-388.125) (-388.920) * [-387.986] (-390.063) (-389.588) (-390.061) -- 0:00:32
      453000 -- (-391.668) (-393.695) [-389.410] (-389.110) * (-386.336) (-390.987) (-390.083) [-388.417] -- 0:00:32
      453500 -- [-389.086] (-389.074) (-389.779) (-387.731) * (-388.369) (-391.096) (-386.633) [-392.018] -- 0:00:32
      454000 -- (-392.887) [-386.702] (-388.769) (-389.947) * (-387.727) (-389.783) (-389.946) [-386.561] -- 0:00:32
      454500 -- (-392.123) (-387.074) [-389.071] (-388.300) * (-386.708) (-390.522) [-387.269] (-386.411) -- 0:00:32
      455000 -- (-388.817) (-386.683) (-388.564) [-387.544] * [-387.584] (-388.075) (-389.079) (-387.218) -- 0:00:32

      Average standard deviation of split frequencies: 0.007947

      455500 -- (-389.472) (-387.503) [-388.652] (-387.253) * (-387.607) (-386.911) (-386.586) [-387.299] -- 0:00:32
      456000 -- (-387.912) (-387.442) (-386.712) [-389.483] * (-389.406) (-387.021) [-387.308] (-391.227) -- 0:00:32
      456500 -- (-386.961) (-389.689) (-387.893) [-388.832] * [-394.924] (-390.486) (-388.871) (-387.221) -- 0:00:32
      457000 -- (-387.680) [-386.272] (-387.741) (-388.596) * (-387.787) [-389.238] (-386.462) (-388.943) -- 0:00:32
      457500 -- (-388.332) (-388.630) [-390.213] (-389.269) * (-389.045) (-387.991) (-388.431) [-387.929] -- 0:00:32
      458000 -- (-387.420) [-389.536] (-387.780) (-389.227) * [-387.213] (-390.486) (-387.704) (-387.283) -- 0:00:31
      458500 -- (-389.742) (-389.279) [-387.603] (-387.405) * (-390.978) (-389.816) [-387.152] (-389.887) -- 0:00:31
      459000 -- (-387.695) (-393.854) (-388.258) [-387.549] * (-390.297) (-389.116) [-389.046] (-386.697) -- 0:00:31
      459500 -- [-386.546] (-387.191) (-388.203) (-386.284) * (-389.552) [-386.643] (-387.468) (-388.033) -- 0:00:31
      460000 -- (-389.983) (-388.175) [-389.130] (-386.493) * [-387.412] (-386.588) (-389.705) (-388.670) -- 0:00:31

      Average standard deviation of split frequencies: 0.007914

      460500 -- (-389.317) (-386.940) (-388.157) [-386.459] * [-387.725] (-387.532) (-388.553) (-390.684) -- 0:00:31
      461000 -- (-387.057) (-389.087) [-387.718] (-391.951) * (-389.671) (-388.360) [-390.248] (-386.856) -- 0:00:32
      461500 -- (-389.788) (-388.483) (-388.272) [-390.650] * (-387.739) [-390.754] (-387.599) (-387.626) -- 0:00:32
      462000 -- [-388.094] (-393.659) (-386.786) (-386.344) * (-387.135) (-389.249) [-387.390] (-387.810) -- 0:00:32
      462500 -- (-392.887) (-387.010) [-388.317] (-392.453) * [-387.507] (-389.481) (-387.464) (-386.674) -- 0:00:32
      463000 -- (-388.939) (-387.719) [-386.819] (-388.399) * (-387.406) [-388.499] (-386.757) (-387.838) -- 0:00:32
      463500 -- [-386.724] (-390.482) (-388.316) (-389.669) * (-387.553) [-387.136] (-386.601) (-389.258) -- 0:00:32
      464000 -- (-386.661) (-386.114) (-387.531) [-386.988] * (-389.212) [-386.605] (-386.524) (-388.274) -- 0:00:32
      464500 -- (-388.774) (-386.387) (-389.628) [-389.363] * (-388.786) (-388.223) [-386.505] (-387.672) -- 0:00:32
      465000 -- (-386.949) [-386.733] (-389.400) (-387.732) * (-388.306) (-389.262) (-388.589) [-387.681] -- 0:00:32

      Average standard deviation of split frequencies: 0.008156

      465500 -- (-387.643) (-390.465) (-388.064) [-391.507] * [-389.475] (-388.285) (-387.765) (-387.144) -- 0:00:32
      466000 -- (-386.398) (-386.616) [-388.883] (-388.510) * [-389.478] (-387.321) (-387.422) (-388.746) -- 0:00:32
      466500 -- (-386.773) (-391.994) (-388.812) [-386.758] * (-388.865) (-387.937) (-386.785) [-387.024] -- 0:00:32
      467000 -- (-391.240) [-389.880] (-388.860) (-389.647) * [-387.840] (-387.701) (-388.326) (-389.235) -- 0:00:31
      467500 -- (-388.503) (-388.732) (-387.879) [-389.182] * [-388.708] (-387.407) (-386.997) (-388.695) -- 0:00:31
      468000 -- (-391.082) [-386.636] (-388.196) (-389.393) * [-393.039] (-391.457) (-389.744) (-394.226) -- 0:00:31
      468500 -- (-391.472) (-388.166) (-387.433) [-386.517] * (-391.742) (-390.327) (-389.379) [-387.089] -- 0:00:31
      469000 -- (-388.861) (-388.435) (-388.795) [-386.909] * (-388.649) (-387.941) [-387.378] (-388.446) -- 0:00:31
      469500 -- (-390.105) (-387.253) (-390.424) [-389.204] * (-388.466) (-390.710) (-387.112) [-386.433] -- 0:00:31
      470000 -- [-392.193] (-386.876) (-393.799) (-388.137) * (-390.180) (-393.163) (-393.094) [-390.781] -- 0:00:31

      Average standard deviation of split frequencies: 0.008955

      470500 -- [-388.054] (-387.620) (-386.695) (-387.351) * (-388.717) (-387.579) (-386.656) [-387.131] -- 0:00:31
      471000 -- (-393.793) (-387.630) [-388.780] (-390.577) * (-388.227) (-389.388) [-388.119] (-387.276) -- 0:00:31
      471500 -- [-390.046] (-391.281) (-388.906) (-388.590) * (-390.823) (-388.421) [-388.048] (-386.276) -- 0:00:31
      472000 -- (-390.405) [-389.292] (-388.331) (-388.027) * (-388.195) (-393.413) (-386.575) [-388.672] -- 0:00:31
      472500 -- (-387.420) [-392.270] (-389.192) (-390.891) * (-390.144) (-389.001) (-386.309) [-386.378] -- 0:00:31
      473000 -- (-390.299) (-388.977) [-386.254] (-391.907) * [-388.576] (-388.861) (-389.708) (-391.531) -- 0:00:31
      473500 -- (-390.853) (-391.986) (-391.477) [-389.433] * [-388.128] (-388.330) (-388.425) (-388.006) -- 0:00:31
      474000 -- (-388.823) (-392.304) (-388.804) [-389.236] * (-390.020) [-386.629] (-388.445) (-387.099) -- 0:00:31
      474500 -- (-389.211) (-389.167) [-387.278] (-388.365) * [-388.770] (-387.437) (-391.667) (-391.182) -- 0:00:31
      475000 -- (-387.355) [-390.761] (-387.852) (-388.899) * (-389.032) (-388.195) [-391.353] (-389.962) -- 0:00:30

      Average standard deviation of split frequencies: 0.008789

      475500 -- (-389.329) (-388.715) [-393.754] (-386.834) * (-388.898) (-392.668) (-389.526) [-387.166] -- 0:00:30
      476000 -- (-389.300) (-387.401) (-390.957) [-390.825] * (-387.719) (-389.359) [-386.808] (-388.379) -- 0:00:30
      476500 -- (-387.999) [-388.727] (-389.203) (-391.235) * (-390.485) (-390.875) [-387.812] (-390.622) -- 0:00:30
      477000 -- (-386.921) (-392.082) [-387.865] (-389.286) * (-389.000) (-392.881) (-391.362) [-390.561] -- 0:00:30
      477500 -- (-388.453) (-390.969) (-389.048) [-391.612] * (-386.989) (-387.716) (-389.844) [-391.843] -- 0:00:30
      478000 -- (-390.043) (-389.063) [-393.320] (-387.316) * (-386.631) [-386.885] (-389.204) (-386.554) -- 0:00:31
      478500 -- (-388.902) [-389.671] (-392.868) (-391.044) * (-387.396) [-387.985] (-387.940) (-388.572) -- 0:00:31
      479000 -- (-388.694) (-386.245) [-387.024] (-389.445) * (-388.689) (-387.379) (-391.339) [-388.938] -- 0:00:31
      479500 -- (-389.458) [-386.679] (-386.905) (-387.432) * (-387.602) (-388.558) [-387.356] (-387.345) -- 0:00:31
      480000 -- (-389.413) (-389.475) [-387.486] (-387.403) * [-388.064] (-394.109) (-389.584) (-388.454) -- 0:00:31

      Average standard deviation of split frequencies: 0.008643

      480500 -- (-389.023) (-389.268) (-386.447) [-387.667] * (-388.603) [-389.565] (-388.616) (-386.214) -- 0:00:31
      481000 -- (-386.340) [-387.118] (-386.804) (-388.176) * (-388.830) [-386.656] (-388.634) (-386.074) -- 0:00:31
      481500 -- [-388.191] (-388.774) (-392.630) (-386.908) * (-389.622) (-387.703) (-388.904) [-391.477] -- 0:00:31
      482000 -- (-387.362) (-388.372) [-387.503] (-388.535) * (-392.086) [-387.467] (-388.908) (-387.498) -- 0:00:31
      482500 -- (-390.810) (-389.334) [-387.122] (-388.080) * [-387.371] (-387.403) (-391.495) (-388.014) -- 0:00:31
      483000 -- [-391.730] (-389.854) (-387.455) (-388.593) * [-390.188] (-386.475) (-386.971) (-387.548) -- 0:00:31
      483500 -- (-387.368) (-391.921) (-389.235) [-389.481] * (-391.663) (-388.519) [-390.398] (-389.995) -- 0:00:30
      484000 -- (-387.180) (-387.724) (-388.913) [-391.111] * (-386.404) (-387.534) [-387.528] (-388.844) -- 0:00:30
      484500 -- (-390.179) [-389.060] (-387.204) (-389.925) * [-387.707] (-388.276) (-391.728) (-387.727) -- 0:00:30
      485000 -- (-387.478) (-389.449) [-386.282] (-392.113) * (-394.845) [-388.520] (-392.425) (-387.963) -- 0:00:30

      Average standard deviation of split frequencies: 0.009015

      485500 -- [-387.418] (-386.834) (-387.459) (-390.542) * [-391.309] (-388.279) (-392.769) (-388.025) -- 0:00:30
      486000 -- (-387.980) (-387.389) (-389.231) [-388.821] * (-387.526) [-390.265] (-390.329) (-389.701) -- 0:00:30
      486500 -- [-389.530] (-388.592) (-387.976) (-391.263) * [-386.201] (-388.403) (-386.833) (-391.855) -- 0:00:30
      487000 -- (-388.186) (-387.108) [-388.688] (-386.339) * (-386.382) (-392.140) (-387.701) [-388.006] -- 0:00:30
      487500 -- (-388.648) (-388.317) (-392.752) [-391.637] * (-388.118) (-395.227) (-387.073) [-387.272] -- 0:00:30
      488000 -- (-386.508) (-387.281) (-391.024) [-386.244] * (-387.451) [-389.456] (-387.962) (-393.632) -- 0:00:30
      488500 -- (-391.336) (-391.614) [-388.104] (-387.330) * (-390.365) (-389.412) [-387.528] (-387.738) -- 0:00:30
      489000 -- (-388.526) (-387.006) (-391.930) [-389.555] * (-386.491) [-389.775] (-390.571) (-387.895) -- 0:00:30
      489500 -- [-387.743] (-388.818) (-388.359) (-388.278) * (-389.790) [-389.024] (-390.061) (-389.567) -- 0:00:30
      490000 -- (-388.291) (-390.094) [-388.689] (-390.086) * (-393.808) (-389.371) (-390.520) [-387.284] -- 0:00:30

      Average standard deviation of split frequencies: 0.008707

      490500 -- [-388.104] (-386.355) (-387.408) (-390.165) * [-389.093] (-395.593) (-391.205) (-387.548) -- 0:00:30
      491000 -- (-391.541) [-386.963] (-387.563) (-388.630) * [-388.972] (-388.640) (-390.014) (-387.872) -- 0:00:30
      491500 -- (-387.477) (-387.545) [-389.652] (-387.784) * (-388.564) (-386.678) (-388.299) [-389.361] -- 0:00:30
      492000 -- (-388.252) (-386.006) [-390.048] (-387.025) * (-389.700) (-389.684) [-387.022] (-389.280) -- 0:00:29
      492500 -- [-387.895] (-386.186) (-389.542) (-386.465) * [-388.659] (-387.516) (-388.295) (-389.772) -- 0:00:29
      493000 -- (-388.621) (-387.041) (-388.720) [-386.854] * (-388.996) (-389.729) [-388.610] (-390.394) -- 0:00:29
      493500 -- (-391.806) (-391.457) (-389.111) [-387.967] * [-390.614] (-390.784) (-388.834) (-388.911) -- 0:00:29
      494000 -- (-393.015) (-392.164) (-389.784) [-389.017] * (-388.551) [-388.940] (-388.740) (-389.568) -- 0:00:29
      494500 -- (-393.212) (-388.947) [-388.513] (-386.652) * (-389.068) [-389.773] (-387.136) (-388.688) -- 0:00:30
      495000 -- (-389.512) [-389.561] (-387.699) (-386.999) * (-388.188) (-388.653) (-386.363) [-387.009] -- 0:00:30

      Average standard deviation of split frequencies: 0.009385

      495500 -- [-388.338] (-386.114) (-393.148) (-387.182) * (-389.257) (-387.863) (-389.896) [-386.374] -- 0:00:30
      496000 -- (-388.696) (-387.071) (-391.630) [-387.457] * (-388.504) (-390.037) [-395.424] (-386.558) -- 0:00:30
      496500 -- (-386.844) (-389.008) (-389.118) [-388.267] * (-388.267) [-388.250] (-394.222) (-388.321) -- 0:00:30
      497000 -- (-388.822) (-389.725) (-389.495) [-389.007] * [-389.576] (-387.669) (-392.470) (-387.335) -- 0:00:30
      497500 -- (-387.875) (-389.497) (-387.418) [-389.758] * (-389.674) (-386.895) [-390.543] (-388.099) -- 0:00:30
      498000 -- (-387.557) [-392.365] (-388.283) (-387.486) * (-387.077) (-389.675) (-388.310) [-386.539] -- 0:00:30
      498500 -- [-388.623] (-389.465) (-390.125) (-386.911) * (-386.865) (-389.807) [-386.408] (-387.911) -- 0:00:30
      499000 -- [-389.146] (-390.387) (-387.938) (-388.170) * [-388.032] (-386.789) (-386.448) (-388.153) -- 0:00:30
      499500 -- (-386.900) (-387.406) [-387.515] (-391.524) * (-390.745) [-386.897] (-387.628) (-389.111) -- 0:00:30
      500000 -- (-386.556) [-387.806] (-389.257) (-388.535) * [-388.447] (-386.456) (-387.944) (-388.569) -- 0:00:30

      Average standard deviation of split frequencies: 0.009474

      500500 -- (-389.879) (-387.121) [-387.539] (-388.735) * [-387.429] (-388.171) (-386.497) (-392.318) -- 0:00:29
      501000 -- (-388.934) (-387.059) (-389.714) [-386.843] * (-387.377) [-388.755] (-387.893) (-390.697) -- 0:00:29
      501500 -- (-391.577) (-386.739) (-388.912) [-387.618] * (-388.760) (-388.449) [-387.551] (-388.523) -- 0:00:29
      502000 -- (-387.702) (-391.097) [-387.007] (-387.944) * (-389.101) (-391.363) (-391.120) [-387.181] -- 0:00:29
      502500 -- [-388.378] (-391.279) (-386.364) (-386.384) * [-387.760] (-386.793) (-392.504) (-387.875) -- 0:00:29
      503000 -- (-386.900) (-389.323) (-387.518) [-388.025] * (-387.356) (-386.930) [-389.018] (-388.638) -- 0:00:29
      503500 -- [-387.007] (-388.471) (-387.130) (-389.150) * (-387.443) (-386.403) (-390.842) [-387.029] -- 0:00:29
      504000 -- (-388.281) (-390.655) [-386.321] (-387.186) * [-389.868] (-388.119) (-391.751) (-389.330) -- 0:00:29
      504500 -- (-390.933) [-387.379] (-388.462) (-386.875) * [-390.589] (-386.370) (-388.129) (-387.390) -- 0:00:29
      505000 -- (-389.673) (-387.964) (-389.567) [-390.976] * (-388.149) [-387.151] (-393.687) (-388.136) -- 0:00:29

      Average standard deviation of split frequencies: 0.008792

      505500 -- (-391.280) (-387.722) (-387.473) [-387.187] * (-390.222) (-389.229) (-390.075) [-386.122] -- 0:00:29
      506000 -- (-389.722) (-389.164) [-388.600] (-386.845) * (-389.409) (-389.454) [-387.591] (-386.952) -- 0:00:29
      506500 -- [-387.197] (-386.521) (-388.232) (-387.501) * [-389.108] (-390.346) (-386.141) (-399.663) -- 0:00:29
      507000 -- (-387.470) (-386.708) (-388.179) [-387.098] * (-386.732) (-387.690) [-386.772] (-386.843) -- 0:00:29
      507500 -- (-388.109) [-387.660] (-391.289) (-386.493) * [-386.954] (-388.899) (-389.228) (-387.230) -- 0:00:29
      508000 -- (-391.658) (-391.255) (-390.855) [-391.403] * (-388.514) (-387.507) (-389.486) [-389.981] -- 0:00:29
      508500 -- (-386.256) [-387.198] (-386.809) (-392.804) * (-387.983) [-388.529] (-389.889) (-392.781) -- 0:00:28
      509000 -- (-388.943) (-387.343) [-393.808] (-391.021) * (-390.999) (-387.566) [-387.464] (-389.052) -- 0:00:28
      509500 -- [-386.781] (-388.234) (-390.140) (-392.568) * (-389.349) (-389.421) [-389.120] (-389.715) -- 0:00:28
      510000 -- [-387.094] (-386.471) (-389.834) (-387.791) * (-388.022) (-389.470) (-386.903) [-387.351] -- 0:00:28

      Average standard deviation of split frequencies: 0.009347

      510500 -- (-388.854) [-386.336] (-391.039) (-391.726) * [-388.046] (-390.005) (-387.147) (-387.896) -- 0:00:28
      511000 -- [-390.292] (-387.384) (-386.784) (-389.976) * (-388.337) [-388.923] (-388.919) (-389.323) -- 0:00:28
      511500 -- (-391.283) [-387.129] (-387.724) (-392.097) * (-388.419) (-390.050) (-389.094) [-388.228] -- 0:00:29
      512000 -- (-389.159) [-386.660] (-387.032) (-389.742) * (-387.904) (-388.959) [-388.416] (-387.209) -- 0:00:29
      512500 -- (-387.907) (-389.570) (-388.433) [-390.320] * (-389.579) [-386.591] (-388.515) (-387.718) -- 0:00:29
      513000 -- [-391.571] (-388.857) (-387.774) (-390.574) * [-386.894] (-386.317) (-386.397) (-387.126) -- 0:00:29
      513500 -- (-387.553) (-388.108) (-387.937) [-387.669] * (-389.065) (-386.660) [-389.741] (-390.624) -- 0:00:29
      514000 -- (-389.019) (-388.412) [-386.728] (-388.822) * [-387.413] (-387.025) (-391.629) (-388.795) -- 0:00:29
      514500 -- (-388.188) [-388.329] (-389.465) (-386.554) * (-388.988) [-387.025] (-390.425) (-390.289) -- 0:00:29
      515000 -- [-389.486] (-394.126) (-389.792) (-388.680) * [-389.264] (-386.896) (-389.950) (-389.120) -- 0:00:29

      Average standard deviation of split frequencies: 0.008964

      515500 -- (-388.307) [-387.294] (-387.704) (-390.552) * [-389.628] (-386.278) (-387.343) (-386.221) -- 0:00:29
      516000 -- (-387.068) (-388.778) [-387.209] (-387.696) * (-391.022) (-386.825) [-387.398] (-387.949) -- 0:00:29
      516500 -- (-387.421) (-390.929) [-386.978] (-386.501) * (-392.733) [-386.340] (-387.815) (-388.736) -- 0:00:29
      517000 -- (-387.369) (-390.903) [-388.875] (-387.352) * (-391.175) [-388.041] (-389.868) (-389.702) -- 0:00:28
      517500 -- (-387.803) (-388.170) [-389.552] (-387.361) * [-388.521] (-390.273) (-388.660) (-388.889) -- 0:00:28
      518000 -- [-387.869] (-387.991) (-390.130) (-389.502) * (-386.792) [-389.948] (-390.867) (-390.319) -- 0:00:28
      518500 -- (-389.535) [-387.805] (-389.583) (-390.848) * [-387.845] (-388.378) (-386.883) (-387.249) -- 0:00:28
      519000 -- (-389.543) (-389.666) [-391.263] (-387.262) * [-386.661] (-388.022) (-387.496) (-386.997) -- 0:00:28
      519500 -- (-386.213) (-390.093) (-392.585) [-387.423] * (-387.548) [-391.366] (-388.904) (-390.392) -- 0:00:28
      520000 -- [-386.294] (-389.702) (-387.815) (-390.110) * (-388.794) [-391.198] (-390.505) (-390.147) -- 0:00:28

      Average standard deviation of split frequencies: 0.008658

      520500 -- (-390.760) (-388.837) [-388.224] (-388.494) * (-389.908) (-395.454) (-392.157) [-391.429] -- 0:00:28
      521000 -- (-387.034) (-388.497) [-387.856] (-386.398) * (-390.083) (-388.805) (-388.584) [-391.268] -- 0:00:28
      521500 -- (-388.314) [-390.189] (-387.943) (-388.083) * (-388.373) [-387.560] (-390.567) (-391.677) -- 0:00:28
      522000 -- (-388.825) (-389.715) (-388.696) [-387.782] * [-386.928] (-387.233) (-389.750) (-391.405) -- 0:00:28
      522500 -- (-388.433) (-387.033) [-389.118] (-387.421) * (-386.431) (-389.012) [-388.635] (-388.328) -- 0:00:28
      523000 -- [-388.353] (-388.233) (-388.997) (-387.815) * [-387.120] (-387.276) (-388.968) (-387.835) -- 0:00:28
      523500 -- (-386.912) (-388.510) [-386.191] (-388.162) * (-387.242) (-387.266) (-389.619) [-387.155] -- 0:00:28
      524000 -- (-386.961) (-386.463) (-387.215) [-387.984] * (-387.968) (-388.243) [-388.336] (-388.154) -- 0:00:28
      524500 -- (-391.020) (-387.379) (-390.817) [-386.076] * (-391.901) (-388.317) [-393.484] (-388.384) -- 0:00:28
      525000 -- (-390.951) (-387.204) [-388.865] (-389.815) * (-388.500) (-389.435) (-390.877) [-387.275] -- 0:00:28

      Average standard deviation of split frequencies: 0.009141

      525500 -- (-387.047) (-386.406) (-389.042) [-390.413] * (-386.777) [-387.642] (-387.265) (-388.744) -- 0:00:27
      526000 -- (-386.512) (-388.047) (-393.828) [-387.571] * (-391.386) (-389.863) (-389.083) [-387.138] -- 0:00:27
      526500 -- (-388.289) (-389.986) (-391.225) [-388.984] * (-387.224) (-386.647) [-389.615] (-390.119) -- 0:00:27
      527000 -- [-386.593] (-387.091) (-387.553) (-388.843) * (-387.196) (-389.007) [-387.539] (-389.904) -- 0:00:27
      527500 -- (-391.644) (-387.025) (-388.426) [-388.555] * (-387.604) (-390.741) [-386.909] (-391.952) -- 0:00:27
      528000 -- (-387.614) (-388.761) (-389.761) [-387.614] * [-388.086] (-390.340) (-389.404) (-389.051) -- 0:00:27
      528500 -- [-392.291] (-387.948) (-389.397) (-387.805) * (-389.614) (-390.610) (-388.477) [-386.611] -- 0:00:28
      529000 -- (-389.504) (-388.986) [-387.576] (-386.437) * [-387.643] (-391.197) (-387.442) (-389.864) -- 0:00:28
      529500 -- (-390.827) (-386.281) (-387.119) [-387.302] * (-387.984) (-390.632) [-386.387] (-392.430) -- 0:00:28
      530000 -- (-389.826) (-389.284) [-388.295] (-395.613) * (-389.118) (-390.412) [-388.254] (-389.478) -- 0:00:28

      Average standard deviation of split frequencies: 0.008350

      530500 -- (-389.963) [-387.445] (-387.193) (-387.587) * (-388.136) [-387.534] (-391.387) (-388.010) -- 0:00:28
      531000 -- (-395.593) [-387.639] (-391.655) (-387.059) * [-387.765] (-388.370) (-389.250) (-388.458) -- 0:00:28
      531500 -- [-390.682] (-390.477) (-386.816) (-388.304) * (-392.249) [-388.154] (-389.196) (-387.328) -- 0:00:28
      532000 -- (-389.641) (-396.393) [-387.876] (-387.658) * (-390.190) (-387.093) [-388.638] (-387.740) -- 0:00:28
      532500 -- (-388.698) [-389.414] (-392.360) (-386.323) * (-387.762) [-386.498] (-387.149) (-386.659) -- 0:00:28
      533000 -- (-387.326) (-388.668) [-386.606] (-386.748) * (-387.823) (-386.416) [-387.148] (-388.705) -- 0:00:28
      533500 -- (-387.705) (-390.355) [-389.564] (-388.569) * [-389.712] (-386.104) (-387.995) (-388.199) -- 0:00:27
      534000 -- (-386.778) (-390.029) [-390.867] (-388.607) * (-390.902) (-389.654) (-387.355) [-389.192] -- 0:00:27
      534500 -- (-388.282) (-387.500) (-387.345) [-387.943] * (-391.430) (-388.276) (-388.343) [-386.612] -- 0:00:27
      535000 -- (-388.597) [-387.117] (-387.908) (-388.134) * (-388.321) (-392.474) (-387.980) [-387.678] -- 0:00:27

      Average standard deviation of split frequencies: 0.008209

      535500 -- (-389.604) (-388.910) [-389.894] (-388.010) * (-387.822) [-388.842] (-387.434) (-387.630) -- 0:00:27
      536000 -- (-390.042) [-390.726] (-392.245) (-387.518) * (-389.369) (-390.405) (-388.162) [-388.011] -- 0:00:27
      536500 -- [-387.314] (-387.760) (-387.572) (-387.492) * (-389.665) [-387.919] (-389.963) (-390.903) -- 0:00:27
      537000 -- (-389.151) (-389.965) [-387.898] (-387.040) * (-388.293) (-387.176) (-388.397) [-386.927] -- 0:00:27
      537500 -- (-388.579) (-387.666) (-386.210) [-387.943] * [-386.835] (-388.187) (-388.620) (-386.690) -- 0:00:27
      538000 -- (-387.791) (-387.447) (-390.958) [-389.414] * [-387.533] (-388.315) (-386.704) (-391.263) -- 0:00:27
      538500 -- [-386.635] (-387.381) (-389.480) (-386.116) * (-387.788) (-391.253) (-387.163) [-389.444] -- 0:00:27
      539000 -- [-388.275] (-392.678) (-394.173) (-386.965) * (-387.022) (-387.727) (-390.861) [-388.389] -- 0:00:27
      539500 -- [-392.781] (-387.630) (-392.248) (-389.681) * (-387.984) [-389.460] (-389.412) (-386.414) -- 0:00:27
      540000 -- (-389.101) (-390.080) [-386.702] (-389.102) * (-387.391) (-388.573) (-389.686) [-388.115] -- 0:00:27

      Average standard deviation of split frequencies: 0.008428

      540500 -- (-392.292) [-387.210] (-391.802) (-396.638) * (-391.711) (-389.181) [-387.675] (-389.101) -- 0:00:27
      541000 -- [-387.877] (-390.598) (-386.619) (-390.920) * (-388.231) (-387.711) [-387.705] (-388.630) -- 0:00:27
      541500 -- (-392.048) [-393.355] (-392.260) (-398.372) * [-388.530] (-390.731) (-387.441) (-386.431) -- 0:00:27
      542000 -- (-388.064) (-392.243) [-387.237] (-392.359) * (-388.963) (-394.656) (-388.347) [-386.796] -- 0:00:27
      542500 -- (-392.291) [-386.633] (-387.890) (-386.019) * (-386.765) (-395.293) (-392.387) [-387.213] -- 0:00:26
      543000 -- [-392.425] (-391.391) (-387.610) (-386.384) * (-387.143) (-389.707) [-389.115] (-387.315) -- 0:00:26
      543500 -- [-389.026] (-389.935) (-387.788) (-386.796) * [-387.342] (-388.390) (-388.431) (-386.994) -- 0:00:26
      544000 -- (-386.627) [-388.803] (-388.756) (-387.329) * (-386.674) [-387.990] (-389.711) (-388.264) -- 0:00:26
      544500 -- (-390.038) (-386.378) [-386.314] (-386.734) * [-387.967] (-389.940) (-388.109) (-386.617) -- 0:00:27
      545000 -- (-388.114) [-387.117] (-388.026) (-387.470) * [-386.091] (-387.246) (-386.657) (-388.393) -- 0:00:27

      Average standard deviation of split frequencies: 0.008404

      545500 -- (-389.489) [-388.065] (-387.871) (-391.896) * (-387.401) [-387.053] (-388.021) (-395.204) -- 0:00:27
      546000 -- [-387.798] (-392.050) (-387.040) (-391.963) * (-387.034) (-389.720) (-387.469) [-394.870] -- 0:00:27
      546500 -- (-388.162) (-387.559) (-387.017) [-389.008] * [-386.485] (-386.807) (-387.070) (-390.684) -- 0:00:27
      547000 -- [-387.235] (-387.825) (-391.917) (-388.832) * (-387.228) [-388.092] (-387.256) (-388.495) -- 0:00:27
      547500 -- (-388.928) (-396.395) (-388.541) [-386.910] * (-386.627) (-387.937) (-392.338) [-386.602] -- 0:00:27
      548000 -- (-387.645) (-388.495) (-387.018) [-387.393] * (-388.528) (-390.395) (-386.525) [-388.140] -- 0:00:27
      548500 -- (-386.972) [-388.439] (-386.485) (-389.125) * (-387.802) (-389.289) (-392.792) [-387.408] -- 0:00:27
      549000 -- (-388.375) (-389.436) (-389.766) [-390.600] * (-386.953) [-388.341] (-388.708) (-386.697) -- 0:00:27
      549500 -- (-388.605) (-391.210) (-389.417) [-390.559] * (-390.646) (-389.190) [-388.133] (-386.913) -- 0:00:27
      550000 -- (-388.777) (-388.550) (-387.767) [-387.935] * (-391.975) [-386.794] (-390.457) (-388.911) -- 0:00:27

      Average standard deviation of split frequencies: 0.008079

      550500 -- [-391.125] (-387.238) (-390.867) (-388.613) * [-389.855] (-387.806) (-391.344) (-388.259) -- 0:00:26
      551000 -- (-388.540) [-390.632] (-386.476) (-392.615) * (-389.058) (-386.311) (-389.230) [-387.333] -- 0:00:26
      551500 -- (-387.961) (-386.256) (-386.052) [-388.728] * (-393.407) (-388.278) [-387.598] (-386.797) -- 0:00:26
      552000 -- (-386.999) (-387.442) [-387.615] (-388.645) * (-386.863) (-391.603) (-387.229) [-386.400] -- 0:00:26
      552500 -- (-388.501) (-386.808) (-386.681) [-386.735] * (-389.804) (-388.323) [-388.936] (-388.658) -- 0:00:26
      553000 -- (-388.131) (-389.193) (-386.601) [-387.869] * (-387.765) [-388.015] (-390.195) (-390.098) -- 0:00:26
      553500 -- (-388.220) [-389.391] (-394.139) (-387.519) * (-387.603) [-389.061] (-391.784) (-389.137) -- 0:00:26
      554000 -- (-387.142) [-387.005] (-390.320) (-387.796) * (-388.248) [-389.037] (-386.575) (-389.633) -- 0:00:26
      554500 -- (-389.430) [-388.319] (-386.791) (-387.432) * (-386.866) [-388.645] (-387.640) (-389.665) -- 0:00:26
      555000 -- (-392.020) (-389.502) [-392.509] (-390.779) * [-387.204] (-391.362) (-388.995) (-388.823) -- 0:00:26

      Average standard deviation of split frequencies: 0.008648

      555500 -- (-389.256) [-387.163] (-387.315) (-388.055) * (-388.331) (-390.300) (-391.789) [-388.291] -- 0:00:26
      556000 -- (-389.554) (-387.260) (-387.348) [-392.102] * (-387.360) (-394.437) (-387.245) [-388.373] -- 0:00:26
      556500 -- (-389.653) (-388.604) [-386.792] (-391.803) * [-386.435] (-391.079) (-389.794) (-388.548) -- 0:00:26
      557000 -- (-390.151) [-388.037] (-388.708) (-387.913) * (-386.612) (-389.280) (-392.537) [-387.874] -- 0:00:26
      557500 -- (-389.108) (-386.974) (-387.424) [-388.850] * (-389.139) (-394.184) [-388.590] (-388.295) -- 0:00:26
      558000 -- (-387.087) [-389.855] (-387.805) (-387.039) * [-389.399] (-394.072) (-386.893) (-391.899) -- 0:00:26
      558500 -- [-390.057] (-392.068) (-389.033) (-389.135) * (-388.793) [-387.356] (-388.658) (-389.514) -- 0:00:26
      559000 -- [-389.744] (-390.083) (-389.055) (-390.454) * (-389.919) (-389.292) [-392.987] (-388.609) -- 0:00:26
      559500 -- [-387.204] (-391.226) (-390.756) (-388.595) * (-388.597) [-387.067] (-389.631) (-387.329) -- 0:00:25
      560000 -- (-387.680) (-387.281) (-388.142) [-390.099] * (-388.605) [-390.590] (-388.722) (-386.959) -- 0:00:25

      Average standard deviation of split frequencies: 0.008198

      560500 -- [-387.385] (-387.134) (-391.369) (-390.171) * (-389.020) [-387.413] (-388.530) (-388.564) -- 0:00:26
      561000 -- (-388.576) (-387.196) (-390.522) [-391.548] * (-386.343) (-387.497) [-391.249] (-387.372) -- 0:00:26
      561500 -- (-386.728) [-388.081] (-388.864) (-389.926) * (-389.097) [-389.078] (-386.887) (-388.779) -- 0:00:26
      562000 -- [-386.993] (-387.016) (-388.049) (-387.365) * [-386.705] (-387.690) (-386.636) (-388.580) -- 0:00:26
      562500 -- [-387.650] (-386.698) (-389.597) (-389.244) * [-387.736] (-386.655) (-386.780) (-390.409) -- 0:00:26
      563000 -- [-386.729] (-387.689) (-388.816) (-387.285) * [-387.756] (-386.558) (-390.477) (-391.142) -- 0:00:26
      563500 -- (-386.995) (-391.585) (-389.275) [-391.199] * (-387.199) (-389.503) [-387.521] (-387.578) -- 0:00:26
      564000 -- (-388.885) (-390.040) [-388.352] (-389.897) * (-387.296) [-389.029] (-388.221) (-388.991) -- 0:00:26
      564500 -- (-386.584) (-394.177) [-388.080] (-386.572) * (-388.004) (-386.561) (-390.078) [-390.049] -- 0:00:26
      565000 -- (-387.795) (-387.230) (-386.785) [-391.220] * [-389.475] (-387.470) (-387.312) (-391.848) -- 0:00:26

      Average standard deviation of split frequencies: 0.008225

      565500 -- [-391.890] (-387.893) (-388.920) (-387.848) * (-391.018) (-387.163) (-389.063) [-393.186] -- 0:00:26
      566000 -- (-392.341) (-387.595) (-389.912) [-389.441] * (-389.553) (-386.894) (-390.743) [-389.593] -- 0:00:26
      566500 -- [-390.004] (-392.244) (-388.961) (-387.506) * (-386.333) (-389.085) (-393.931) [-391.794] -- 0:00:26
      567000 -- (-389.834) (-391.459) [-393.940] (-389.136) * (-387.036) [-387.438] (-387.917) (-388.270) -- 0:00:25
      567500 -- (-388.932) [-387.187] (-394.417) (-386.365) * (-388.784) [-390.984] (-387.148) (-389.030) -- 0:00:25
      568000 -- (-387.482) (-387.812) [-390.230] (-388.459) * (-388.449) [-386.928] (-389.533) (-389.267) -- 0:00:25
      568500 -- (-390.258) [-388.671] (-389.266) (-387.553) * [-389.558] (-386.983) (-391.333) (-389.843) -- 0:00:25
      569000 -- (-389.604) (-391.115) (-388.431) [-389.849] * (-390.726) (-386.441) (-389.541) [-390.449] -- 0:00:25
      569500 -- [-388.454] (-387.074) (-388.907) (-390.011) * (-387.766) [-387.263] (-388.721) (-393.091) -- 0:00:25
      570000 -- [-387.895] (-391.267) (-391.074) (-386.802) * [-390.246] (-387.321) (-386.662) (-391.026) -- 0:00:25

      Average standard deviation of split frequencies: 0.008054

      570500 -- (-390.225) (-386.635) [-387.936] (-386.612) * (-386.309) [-386.697] (-387.243) (-389.902) -- 0:00:25
      571000 -- (-393.968) (-394.741) (-390.490) [-387.991] * (-387.076) (-389.058) (-388.077) [-389.236] -- 0:00:25
      571500 -- [-389.950] (-386.886) (-390.764) (-386.353) * (-389.555) (-388.619) (-386.868) [-387.244] -- 0:00:25
      572000 -- [-387.481] (-386.601) (-386.902) (-390.682) * [-389.853] (-390.872) (-387.614) (-386.685) -- 0:00:25
      572500 -- (-387.682) [-387.747] (-387.975) (-387.609) * (-390.969) (-387.677) (-388.228) [-388.333] -- 0:00:25
      573000 -- (-386.997) (-390.251) (-388.962) [-389.489] * (-389.925) (-388.522) [-387.309] (-387.233) -- 0:00:25
      573500 -- (-388.359) (-387.757) (-395.692) [-386.159] * (-388.970) (-389.341) [-388.707] (-387.933) -- 0:00:25
      574000 -- (-387.165) [-387.203] (-389.339) (-388.180) * (-391.183) [-386.264] (-389.905) (-391.781) -- 0:00:25
      574500 -- (-387.011) [-386.888] (-393.859) (-386.388) * (-387.012) (-386.169) [-389.615] (-388.315) -- 0:00:25
      575000 -- (-387.810) (-388.002) (-390.662) [-390.552] * (-387.008) (-391.628) [-389.661] (-388.619) -- 0:00:25

      Average standard deviation of split frequencies: 0.008075

      575500 -- [-388.408] (-390.791) (-388.629) (-389.286) * (-389.961) (-402.738) [-388.614] (-387.140) -- 0:00:25
      576000 -- (-389.420) (-393.896) (-387.743) [-391.724] * (-386.693) (-394.234) [-387.935] (-388.562) -- 0:00:25
      576500 -- (-387.369) [-392.721] (-390.111) (-391.686) * (-389.807) (-390.049) [-388.595] (-387.968) -- 0:00:25
      577000 -- [-388.175] (-391.743) (-388.744) (-397.012) * [-386.902] (-391.296) (-389.002) (-392.047) -- 0:00:25
      577500 -- (-387.464) (-392.319) [-389.830] (-388.159) * (-391.295) (-390.001) (-387.467) [-386.811] -- 0:00:25
      578000 -- (-390.198) [-388.573] (-386.598) (-389.825) * (-387.012) [-388.778] (-389.088) (-386.375) -- 0:00:25
      578500 -- (-387.814) [-389.079] (-388.675) (-388.797) * [-386.802] (-387.070) (-389.688) (-386.972) -- 0:00:25
      579000 -- [-387.362] (-387.369) (-388.941) (-388.448) * (-387.445) (-388.065) [-386.791] (-388.889) -- 0:00:25
      579500 -- [-387.903] (-388.848) (-386.156) (-389.542) * (-387.582) [-386.878] (-386.358) (-389.490) -- 0:00:25
      580000 -- (-390.454) (-391.526) [-389.594] (-390.380) * (-387.164) (-389.524) [-386.405] (-387.792) -- 0:00:25

      Average standard deviation of split frequencies: 0.008497

      580500 -- (-390.827) (-393.727) (-387.214) [-386.911] * [-387.375] (-389.716) (-388.443) (-386.964) -- 0:00:25
      581000 -- (-387.247) (-392.756) (-388.210) [-386.801] * (-389.597) (-394.177) [-387.912] (-393.993) -- 0:00:25
      581500 -- (-388.959) (-390.754) (-387.800) [-387.153] * (-388.513) (-386.980) (-388.674) [-390.330] -- 0:00:25
      582000 -- (-387.170) (-393.967) (-391.982) [-389.291] * (-390.922) (-387.479) [-386.528] (-389.855) -- 0:00:25
      582500 -- (-390.500) (-388.331) (-387.938) [-386.124] * (-386.843) (-386.575) [-386.971] (-386.731) -- 0:00:25
      583000 -- (-387.265) (-386.674) [-392.614] (-390.390) * (-389.201) [-390.273] (-387.145) (-387.248) -- 0:00:25
      583500 -- (-390.763) [-386.783] (-388.809) (-387.625) * (-388.765) (-388.644) [-388.732] (-388.693) -- 0:00:24
      584000 -- [-386.683] (-388.879) (-387.009) (-386.734) * [-386.944] (-389.964) (-386.970) (-389.093) -- 0:00:24
      584500 -- (-389.384) (-390.168) [-387.515] (-388.763) * [-388.939] (-386.962) (-391.389) (-388.554) -- 0:00:24
      585000 -- [-388.959] (-388.661) (-386.743) (-393.737) * (-390.687) (-386.446) [-394.596] (-388.112) -- 0:00:24

      Average standard deviation of split frequencies: 0.008195

      585500 -- (-387.377) (-389.210) (-387.506) [-387.573] * [-392.184] (-387.844) (-391.919) (-390.763) -- 0:00:24
      586000 -- (-386.230) (-392.773) [-387.419] (-389.870) * (-389.323) [-389.310] (-390.780) (-388.635) -- 0:00:24
      586500 -- (-386.292) (-389.766) [-389.412] (-388.825) * [-390.122] (-386.902) (-386.629) (-391.627) -- 0:00:24
      587000 -- (-386.377) (-387.021) (-388.401) [-388.177] * (-387.384) (-390.455) (-391.539) [-389.789] -- 0:00:24
      587500 -- [-385.930] (-386.588) (-392.609) (-388.726) * (-388.732) [-390.811] (-388.265) (-388.634) -- 0:00:24
      588000 -- [-389.010] (-387.497) (-387.344) (-387.864) * [-388.759] (-390.063) (-388.214) (-388.919) -- 0:00:24
      588500 -- (-392.637) (-387.784) (-391.584) [-386.482] * (-390.291) (-387.246) (-386.712) [-387.498] -- 0:00:24
      589000 -- (-390.194) (-387.629) [-389.722] (-386.687) * (-390.342) (-388.011) [-387.149] (-386.368) -- 0:00:24
      589500 -- (-386.289) [-390.635] (-388.422) (-388.946) * (-388.213) (-386.925) (-386.762) [-386.663] -- 0:00:24
      590000 -- (-386.843) [-390.049] (-388.319) (-388.943) * (-391.624) (-386.606) [-388.318] (-391.304) -- 0:00:24

      Average standard deviation of split frequencies: 0.008230

      590500 -- (-387.143) [-388.729] (-388.897) (-387.255) * (-391.797) (-387.113) (-388.096) [-389.699] -- 0:00:24
      591000 -- (-389.740) (-392.428) [-387.959] (-386.523) * [-392.447] (-390.872) (-389.526) (-389.615) -- 0:00:24
      591500 -- (-391.988) (-392.115) [-387.757] (-390.032) * (-393.092) (-390.828) (-386.064) [-388.697] -- 0:00:24
      592000 -- [-386.910] (-391.338) (-389.663) (-387.441) * (-389.811) (-391.902) (-390.491) [-386.534] -- 0:00:24
      592500 -- [-390.085] (-388.165) (-392.243) (-388.193) * [-387.428] (-387.696) (-390.192) (-388.636) -- 0:00:24
      593000 -- (-387.148) (-386.642) [-387.421] (-386.671) * [-387.022] (-388.781) (-387.514) (-390.266) -- 0:00:24
      593500 -- [-386.864] (-387.416) (-386.660) (-389.565) * (-390.754) (-389.335) (-388.375) [-387.796] -- 0:00:24
      594000 -- (-386.878) (-392.201) (-388.578) [-389.078] * (-387.566) (-388.939) [-387.489] (-388.382) -- 0:00:24
      594500 -- (-386.890) (-391.955) (-389.143) [-396.339] * [-388.924] (-386.460) (-388.672) (-389.225) -- 0:00:24
      595000 -- (-387.198) [-389.467] (-387.040) (-387.902) * (-390.384) (-387.967) [-389.131] (-389.162) -- 0:00:24

      Average standard deviation of split frequencies: 0.008849

      595500 -- (-387.964) (-388.950) (-390.269) [-387.373] * [-387.752] (-388.214) (-388.542) (-389.643) -- 0:00:24
      596000 -- (-386.521) [-389.073] (-390.527) (-389.800) * (-387.837) (-387.219) [-390.104] (-388.133) -- 0:00:24
      596500 -- (-387.551) (-386.580) [-387.659] (-390.243) * (-388.700) (-387.980) (-391.402) [-387.128] -- 0:00:24
      597000 -- (-388.681) [-386.733] (-394.812) (-389.500) * (-388.062) [-389.482] (-389.324) (-390.465) -- 0:00:24
      597500 -- (-388.268) [-388.864] (-388.997) (-387.646) * (-388.083) (-389.906) (-389.796) [-388.410] -- 0:00:24
      598000 -- (-386.354) (-387.486) [-389.555] (-387.603) * (-389.437) (-390.856) [-388.137] (-389.472) -- 0:00:24
      598500 -- (-386.984) [-388.128] (-387.071) (-387.632) * [-388.035] (-388.473) (-387.363) (-387.817) -- 0:00:24
      599000 -- (-387.510) (-388.826) [-388.292] (-387.076) * [-390.756] (-387.737) (-389.019) (-387.444) -- 0:00:24
      599500 -- [-388.845] (-387.057) (-388.249) (-387.935) * (-388.551) [-390.180] (-387.064) (-388.317) -- 0:00:24
      600000 -- (-388.570) [-388.682] (-387.691) (-389.146) * (-387.055) (-388.651) (-387.064) [-387.659] -- 0:00:24

      Average standard deviation of split frequencies: 0.009123

      600500 -- (-387.361) (-390.006) (-388.146) [-388.656] * (-389.838) (-389.421) (-390.645) [-390.443] -- 0:00:23
      601000 -- (-388.398) (-388.651) [-387.055] (-389.758) * (-387.599) (-390.957) [-389.052] (-388.021) -- 0:00:23
      601500 -- [-386.815] (-386.655) (-390.519) (-390.816) * [-386.889] (-395.214) (-386.953) (-387.192) -- 0:00:23
      602000 -- (-391.499) [-390.533] (-393.445) (-392.047) * (-387.539) (-391.755) [-395.762] (-388.947) -- 0:00:23
      602500 -- [-388.386] (-389.173) (-391.435) (-388.332) * (-388.033) (-393.437) [-389.892] (-390.240) -- 0:00:23
      603000 -- (-389.396) (-387.282) [-389.376] (-386.900) * [-387.889] (-394.137) (-387.712) (-387.388) -- 0:00:23
      603500 -- [-386.321] (-387.920) (-386.806) (-387.695) * (-387.340) (-387.968) [-389.142] (-387.116) -- 0:00:23
      604000 -- (-387.826) (-390.169) [-387.487] (-387.335) * (-387.789) (-387.890) [-387.775] (-388.539) -- 0:00:23
      604500 -- (-390.010) (-389.102) [-387.870] (-386.938) * [-389.965] (-389.423) (-391.746) (-389.453) -- 0:00:23
      605000 -- (-387.015) (-389.774) [-387.171] (-389.214) * [-388.291] (-396.314) (-387.643) (-386.579) -- 0:00:23

      Average standard deviation of split frequencies: 0.009238

      605500 -- (-387.756) (-389.296) [-387.068] (-389.293) * (-387.611) [-390.539] (-389.309) (-386.423) -- 0:00:24
      606000 -- (-386.296) (-387.521) (-386.931) [-387.082] * (-387.433) (-387.088) (-390.009) [-387.898] -- 0:00:24
      606500 -- (-386.446) [-387.401] (-386.986) (-391.164) * (-387.008) (-387.123) [-389.402] (-386.768) -- 0:00:24
      607000 -- (-386.064) (-389.484) (-386.575) [-389.316] * (-386.360) (-390.082) (-391.007) [-387.707] -- 0:00:23
      607500 -- [-389.565] (-387.822) (-389.267) (-388.694) * (-389.552) (-387.591) (-388.688) [-390.810] -- 0:00:23
      608000 -- [-389.162] (-387.242) (-393.006) (-391.911) * [-387.679] (-389.171) (-388.910) (-388.631) -- 0:00:23
      608500 -- (-390.619) (-388.428) (-389.253) [-391.256] * (-390.188) (-387.647) (-387.446) [-388.918] -- 0:00:23
      609000 -- (-386.910) (-394.115) [-388.112] (-387.871) * [-389.482] (-388.928) (-387.741) (-387.302) -- 0:00:23
      609500 -- (-388.133) (-389.587) [-388.158] (-386.624) * (-387.642) (-389.215) (-390.217) [-387.267] -- 0:00:23
      610000 -- (-388.515) (-388.896) (-387.742) [-386.672] * [-387.942] (-386.509) (-388.598) (-388.176) -- 0:00:23

      Average standard deviation of split frequencies: 0.008900

      610500 -- [-386.546] (-389.405) (-386.438) (-389.189) * (-386.935) (-391.390) [-390.226] (-388.184) -- 0:00:23
      611000 -- (-386.644) [-390.561] (-388.087) (-389.297) * (-386.633) (-386.971) [-391.112] (-387.583) -- 0:00:23
      611500 -- (-389.304) [-388.159] (-391.202) (-387.583) * (-388.623) [-388.660] (-389.283) (-388.115) -- 0:00:23
      612000 -- (-387.767) (-386.083) (-386.610) [-388.523] * (-391.247) (-391.337) [-387.984] (-389.346) -- 0:00:23
      612500 -- [-388.442] (-387.790) (-389.166) (-387.283) * (-388.130) (-387.874) [-388.879] (-386.969) -- 0:00:23
      613000 -- (-387.843) [-388.552] (-391.765) (-389.073) * (-387.757) (-389.126) (-386.311) [-389.377] -- 0:00:23
      613500 -- (-388.635) [-388.264] (-387.200) (-386.817) * (-389.620) [-386.792] (-386.390) (-389.439) -- 0:00:23
      614000 -- (-389.227) (-387.297) (-386.852) [-388.501] * (-388.279) (-387.936) [-389.378] (-386.391) -- 0:00:23
      614500 -- [-388.493] (-387.022) (-389.148) (-387.483) * (-389.593) (-386.880) (-386.928) [-386.667] -- 0:00:23
      615000 -- (-388.139) (-386.829) [-387.783] (-388.766) * (-387.300) (-387.268) [-387.164] (-389.449) -- 0:00:23

      Average standard deviation of split frequencies: 0.008609

      615500 -- (-389.272) (-387.062) [-391.384] (-388.398) * (-388.618) (-389.263) [-391.152] (-391.754) -- 0:00:23
      616000 -- (-387.158) (-388.211) (-387.501) [-389.199] * (-387.440) (-387.048) (-389.859) [-390.478] -- 0:00:23
      616500 -- (-389.099) (-386.934) [-386.349] (-390.056) * (-390.908) [-388.841] (-388.579) (-394.396) -- 0:00:23
      617000 -- (-389.846) [-387.397] (-389.650) (-388.834) * (-388.223) (-389.910) (-387.512) [-391.387] -- 0:00:22
      617500 -- [-386.983] (-388.327) (-389.078) (-388.100) * (-387.822) [-386.338] (-387.835) (-389.195) -- 0:00:22
      618000 -- (-387.303) (-388.001) [-389.530] (-391.846) * (-386.434) (-388.200) (-388.417) [-386.229] -- 0:00:22
      618500 -- (-387.667) (-387.178) [-389.147] (-391.521) * (-386.336) (-389.737) [-387.992] (-386.634) -- 0:00:22
      619000 -- (-390.319) [-387.846] (-388.898) (-389.633) * (-392.127) (-388.506) (-390.773) [-386.408] -- 0:00:22
      619500 -- (-390.511) (-388.977) (-390.470) [-387.547] * [-388.391] (-389.459) (-387.122) (-388.641) -- 0:00:22
      620000 -- (-390.481) (-394.181) [-386.462] (-386.965) * [-389.503] (-389.830) (-388.768) (-388.779) -- 0:00:22

      Average standard deviation of split frequencies: 0.007595

      620500 -- (-388.884) (-389.331) (-389.272) [-387.803] * (-387.015) (-390.645) [-389.896] (-387.368) -- 0:00:22
      621000 -- (-389.150) (-389.076) [-388.524] (-389.769) * (-388.280) [-388.391] (-388.825) (-387.287) -- 0:00:23
      621500 -- (-388.194) (-388.046) [-389.386] (-395.750) * (-389.225) (-388.064) [-388.671] (-387.830) -- 0:00:23
      622000 -- (-391.740) [-387.664] (-387.745) (-389.224) * (-388.291) (-391.014) (-390.835) [-387.083] -- 0:00:23
      622500 -- (-389.869) (-387.385) [-388.811] (-388.998) * (-386.544) [-390.700] (-386.091) (-387.664) -- 0:00:23
      623000 -- (-390.190) [-389.435] (-391.338) (-387.183) * (-390.118) [-392.405] (-387.431) (-388.467) -- 0:00:22
      623500 -- [-389.598] (-388.776) (-390.044) (-390.499) * (-388.915) (-389.152) (-387.874) [-388.862] -- 0:00:22
      624000 -- (-387.288) [-386.977] (-393.045) (-390.021) * (-393.546) [-388.757] (-389.361) (-388.531) -- 0:00:22
      624500 -- (-387.256) (-390.301) [-392.660] (-386.520) * (-386.432) (-387.386) [-387.578] (-394.499) -- 0:00:22
      625000 -- (-386.931) [-389.554] (-389.082) (-389.500) * (-386.978) (-389.542) [-387.352] (-386.501) -- 0:00:22

      Average standard deviation of split frequencies: 0.007973

      625500 -- (-387.484) [-389.145] (-387.787) (-388.843) * (-392.269) (-387.742) (-388.243) [-387.164] -- 0:00:22
      626000 -- (-392.383) (-390.662) [-386.507] (-386.869) * (-388.060) (-391.918) [-388.787] (-387.898) -- 0:00:22
      626500 -- [-388.773] (-390.187) (-391.297) (-388.330) * (-387.273) (-388.298) [-386.508] (-388.435) -- 0:00:22
      627000 -- (-391.112) (-388.765) (-391.815) [-387.717] * (-388.460) (-389.653) (-386.348) [-389.459] -- 0:00:22
      627500 -- (-388.640) [-389.014] (-392.627) (-387.585) * (-389.225) (-387.500) (-387.785) [-388.361] -- 0:00:22
      628000 -- [-387.485] (-390.416) (-390.096) (-387.517) * (-388.123) (-390.418) [-388.883] (-387.062) -- 0:00:22
      628500 -- (-390.375) (-388.891) [-388.442] (-387.263) * (-387.048) [-387.537] (-390.669) (-392.582) -- 0:00:22
      629000 -- (-392.289) [-395.256] (-387.857) (-387.203) * [-388.033] (-391.206) (-394.126) (-389.860) -- 0:00:22
      629500 -- (-389.412) (-390.029) [-388.484] (-388.921) * (-388.095) (-391.719) [-390.717] (-387.677) -- 0:00:22
      630000 -- (-386.773) (-387.698) (-387.094) [-389.159] * (-387.853) [-388.548] (-391.453) (-386.390) -- 0:00:22

      Average standard deviation of split frequencies: 0.008316

      630500 -- (-388.019) (-386.827) [-389.264] (-387.655) * (-388.485) [-386.139] (-387.701) (-389.012) -- 0:00:22
      631000 -- (-387.606) [-387.087] (-389.201) (-387.393) * (-388.826) (-386.082) (-390.690) [-388.335] -- 0:00:22
      631500 -- [-387.411] (-388.928) (-388.542) (-388.556) * (-390.808) (-386.567) [-387.267] (-389.311) -- 0:00:22
      632000 -- (-393.370) [-389.894] (-387.415) (-390.426) * [-386.550] (-387.849) (-389.768) (-387.047) -- 0:00:22
      632500 -- (-390.281) (-389.362) (-387.322) [-391.243] * (-387.809) (-390.104) [-390.434] (-386.560) -- 0:00:22
      633000 -- (-392.694) (-388.727) [-390.696] (-392.968) * (-387.770) [-386.374] (-388.480) (-387.468) -- 0:00:22
      633500 -- [-387.368] (-389.177) (-393.868) (-389.101) * (-387.948) [-387.478] (-388.652) (-389.592) -- 0:00:21
      634000 -- (-386.442) (-390.333) (-388.304) [-387.122] * (-391.162) (-387.496) [-390.138] (-388.149) -- 0:00:21
      634500 -- (-386.944) (-387.255) [-391.679] (-388.687) * (-387.568) (-387.224) [-393.115] (-386.629) -- 0:00:21
      635000 -- (-386.600) (-388.178) (-388.705) [-389.278] * [-387.253] (-389.674) (-389.258) (-386.666) -- 0:00:21

      Average standard deviation of split frequencies: 0.008385

      635500 -- [-389.381] (-388.978) (-389.747) (-388.303) * (-388.269) (-391.482) (-387.515) [-389.047] -- 0:00:21
      636000 -- (-389.870) [-392.429] (-392.407) (-387.787) * [-388.256] (-389.142) (-389.107) (-390.781) -- 0:00:21
      636500 -- (-387.922) (-390.078) [-393.166] (-388.961) * (-386.439) (-391.982) (-386.995) [-387.529] -- 0:00:21
      637000 -- (-388.111) (-387.775) (-387.569) [-389.103] * (-388.593) (-390.998) [-389.957] (-388.905) -- 0:00:21
      637500 -- [-386.324] (-387.950) (-389.108) (-389.640) * (-390.390) (-388.525) [-389.110] (-389.236) -- 0:00:22
      638000 -- (-389.626) (-390.083) [-387.704] (-390.028) * (-393.732) [-389.157] (-387.749) (-387.313) -- 0:00:22
      638500 -- (-389.989) (-389.716) [-390.206] (-388.075) * (-388.899) (-388.370) (-396.099) [-386.263] -- 0:00:22
      639000 -- (-395.345) (-387.216) [-387.979] (-387.541) * [-389.576] (-386.948) (-390.438) (-387.388) -- 0:00:22
      639500 -- (-389.558) (-388.393) [-388.788] (-388.298) * (-387.430) (-388.074) (-392.323) [-386.494] -- 0:00:21
      640000 -- (-392.105) [-387.620] (-389.165) (-386.466) * (-386.616) (-388.360) [-391.447] (-387.791) -- 0:00:21

      Average standard deviation of split frequencies: 0.008738

      640500 -- (-387.107) (-388.682) [-388.451] (-386.501) * (-388.006) [-386.600] (-387.128) (-389.860) -- 0:00:21
      641000 -- (-388.126) (-386.629) [-387.582] (-387.062) * (-389.760) [-388.107] (-386.792) (-388.164) -- 0:00:21
      641500 -- (-388.100) [-388.349] (-388.359) (-387.045) * (-387.098) (-386.199) (-388.334) [-391.360] -- 0:00:21
      642000 -- (-388.747) (-388.684) (-387.034) [-387.664] * (-388.338) [-387.726] (-388.824) (-387.095) -- 0:00:21
      642500 -- [-386.913] (-388.730) (-387.318) (-388.926) * (-389.553) (-389.191) (-389.976) [-387.823] -- 0:00:21
      643000 -- (-388.860) (-386.369) (-388.138) [-388.337] * (-387.773) (-388.856) (-390.259) [-388.886] -- 0:00:21
      643500 -- [-391.122] (-389.405) (-390.704) (-387.354) * (-388.440) (-391.431) (-390.334) [-387.628] -- 0:00:21
      644000 -- [-387.863] (-390.451) (-388.822) (-389.391) * [-388.582] (-389.717) (-387.071) (-390.127) -- 0:00:21
      644500 -- [-388.596] (-387.289) (-388.982) (-388.899) * (-389.814) (-387.591) (-390.532) [-388.753] -- 0:00:21
      645000 -- (-388.214) (-391.734) (-388.066) [-388.985] * (-389.812) [-386.975] (-388.338) (-388.510) -- 0:00:21

      Average standard deviation of split frequencies: 0.008585

      645500 -- (-389.484) [-387.730] (-387.602) (-389.460) * (-390.008) (-392.879) [-389.399] (-391.192) -- 0:00:21
      646000 -- (-388.458) (-389.923) [-388.506] (-386.978) * (-387.409) [-388.132] (-387.733) (-387.851) -- 0:00:21
      646500 -- (-388.322) (-387.801) [-389.488] (-387.593) * [-387.935] (-388.468) (-387.410) (-391.699) -- 0:00:21
      647000 -- (-390.584) (-390.055) (-392.986) [-386.398] * [-387.483] (-389.428) (-390.760) (-387.752) -- 0:00:21
      647500 -- (-389.163) [-386.687] (-389.118) (-387.859) * (-387.189) [-388.974] (-387.830) (-387.064) -- 0:00:21
      648000 -- (-389.370) (-386.946) [-388.449] (-388.137) * (-386.974) (-387.408) (-390.620) [-387.374] -- 0:00:21
      648500 -- (-388.647) [-388.243] (-387.059) (-386.687) * [-387.827] (-388.014) (-387.750) (-386.203) -- 0:00:21
      649000 -- [-387.388] (-390.722) (-393.929) (-387.307) * (-386.847) (-389.337) (-387.418) [-387.073] -- 0:00:21
      649500 -- (-387.725) [-388.580] (-390.625) (-386.866) * (-392.391) (-390.163) (-387.922) [-386.742] -- 0:00:21
      650000 -- [-387.895] (-389.048) (-389.026) (-388.106) * (-389.279) (-389.454) (-387.577) [-388.362] -- 0:00:21

      Average standard deviation of split frequencies: 0.008268

      650500 -- (-392.962) (-387.924) [-387.275] (-388.537) * (-387.783) (-389.235) [-387.876] (-390.516) -- 0:00:20
      651000 -- [-386.529] (-387.652) (-388.128) (-389.673) * (-389.059) (-386.696) (-387.483) [-387.935] -- 0:00:20
      651500 -- [-386.928] (-393.222) (-386.760) (-388.698) * (-389.435) (-388.009) (-390.537) [-388.440] -- 0:00:20
      652000 -- (-389.072) (-388.940) [-389.915] (-388.547) * [-389.301] (-388.340) (-388.315) (-386.878) -- 0:00:20
      652500 -- (-389.284) (-386.439) [-386.578] (-387.777) * (-387.310) (-386.748) [-388.615] (-387.097) -- 0:00:20
      653000 -- (-390.933) [-388.823] (-388.269) (-389.054) * (-386.476) [-386.419] (-391.397) (-386.982) -- 0:00:20
      653500 -- [-388.957] (-388.292) (-386.891) (-390.104) * (-389.221) (-387.781) [-387.261] (-392.164) -- 0:00:21
      654000 -- (-386.361) (-388.356) (-389.808) [-389.983] * (-387.110) [-387.386] (-389.418) (-387.840) -- 0:00:21
      654500 -- [-390.728] (-387.575) (-392.680) (-387.240) * (-387.168) [-390.047] (-387.464) (-387.193) -- 0:00:21
      655000 -- [-387.564] (-388.020) (-387.593) (-387.877) * (-386.560) (-387.197) [-387.678] (-388.594) -- 0:00:21

      Average standard deviation of split frequencies: 0.008158

      655500 -- [-387.135] (-387.062) (-389.277) (-390.102) * (-389.795) [-391.739] (-386.673) (-389.368) -- 0:00:21
      656000 -- (-387.340) (-387.500) [-389.814] (-386.290) * (-390.464) (-387.818) (-388.941) [-386.897] -- 0:00:20
      656500 -- [-387.245] (-386.616) (-388.399) (-390.960) * (-388.892) (-388.269) (-389.036) [-386.583] -- 0:00:20
      657000 -- (-388.080) (-387.359) [-386.960] (-386.193) * (-387.418) (-388.168) (-388.516) [-386.756] -- 0:00:20
      657500 -- (-389.187) (-389.961) [-387.358] (-389.199) * (-392.059) (-388.044) (-387.592) [-389.266] -- 0:00:20
      658000 -- (-387.831) [-387.167] (-390.122) (-387.507) * (-388.055) [-386.848] (-388.919) (-389.415) -- 0:00:20
      658500 -- [-388.480] (-388.785) (-389.899) (-387.664) * (-388.979) [-387.880] (-388.037) (-390.213) -- 0:00:20
      659000 -- (-389.181) (-392.448) (-388.460) [-387.534] * [-386.830] (-390.443) (-389.055) (-388.898) -- 0:00:20
      659500 -- (-389.437) (-386.957) [-387.774] (-387.972) * [-388.404] (-390.365) (-388.129) (-387.025) -- 0:00:20
      660000 -- [-386.421] (-387.366) (-390.884) (-389.536) * (-391.031) (-387.822) (-387.064) [-387.479] -- 0:00:20

      Average standard deviation of split frequencies: 0.008101

      660500 -- (-388.610) (-386.162) [-387.997] (-386.076) * [-387.135] (-390.998) (-389.763) (-386.688) -- 0:00:20
      661000 -- (-388.298) (-386.025) (-389.973) [-386.863] * [-388.685] (-386.154) (-392.071) (-388.474) -- 0:00:20
      661500 -- (-387.065) (-390.832) [-387.139] (-390.800) * (-386.241) (-387.973) [-387.626] (-387.338) -- 0:00:20
      662000 -- (-388.485) [-390.066] (-387.514) (-387.185) * [-389.522] (-387.034) (-386.592) (-390.126) -- 0:00:20
      662500 -- [-387.717] (-388.432) (-386.881) (-391.362) * (-393.211) (-391.120) [-390.723] (-393.328) -- 0:00:20
      663000 -- (-388.789) (-387.288) (-387.911) [-388.879] * (-386.476) (-391.730) (-390.393) [-388.256] -- 0:00:20
      663500 -- (-388.666) [-392.787] (-386.921) (-391.037) * (-386.784) [-388.651] (-388.738) (-387.751) -- 0:00:20
      664000 -- [-387.369] (-391.687) (-388.188) (-390.603) * (-387.799) (-389.336) [-393.672] (-387.402) -- 0:00:20
      664500 -- (-387.650) [-387.875] (-389.177) (-389.798) * (-386.894) [-386.858] (-387.758) (-387.334) -- 0:00:20
      665000 -- [-386.669] (-390.060) (-389.065) (-389.039) * [-387.946] (-387.704) (-387.399) (-386.613) -- 0:00:20

      Average standard deviation of split frequencies: 0.008369

      665500 -- (-387.688) (-387.022) [-386.998] (-387.777) * (-389.271) (-391.702) (-388.548) [-388.815] -- 0:00:20
      666000 -- (-390.258) [-387.422] (-387.139) (-387.717) * [-387.317] (-389.379) (-388.856) (-389.574) -- 0:00:20
      666500 -- (-388.470) (-386.959) [-388.544] (-390.169) * [-389.698] (-391.577) (-389.650) (-388.606) -- 0:00:20
      667000 -- (-388.381) (-388.904) [-387.738] (-388.523) * (-386.616) [-390.279] (-387.718) (-393.240) -- 0:00:19
      667500 -- [-389.841] (-389.036) (-386.103) (-391.529) * (-392.017) (-388.183) [-386.228] (-390.957) -- 0:00:19
      668000 -- [-390.096] (-390.881) (-391.284) (-387.207) * (-387.755) (-390.451) (-395.926) [-387.575] -- 0:00:19
      668500 -- (-388.490) (-392.665) [-389.270] (-387.423) * (-387.664) (-391.086) (-387.473) [-388.515] -- 0:00:19
      669000 -- (-387.351) [-390.460] (-390.164) (-390.239) * [-392.692] (-389.682) (-387.530) (-387.639) -- 0:00:19
      669500 -- (-387.347) [-390.752] (-392.384) (-387.678) * (-389.265) [-390.307] (-388.457) (-390.431) -- 0:00:19
      670000 -- (-386.366) [-389.243] (-394.375) (-387.193) * [-386.950] (-387.174) (-388.079) (-391.459) -- 0:00:19

      Average standard deviation of split frequencies: 0.008311

      670500 -- (-389.403) [-386.905] (-389.136) (-388.009) * [-387.006] (-389.187) (-389.507) (-389.241) -- 0:00:20
      671000 -- (-389.329) (-386.904) [-387.458] (-388.686) * (-387.664) [-390.827] (-390.383) (-390.717) -- 0:00:20
      671500 -- [-389.436] (-387.185) (-390.273) (-388.264) * (-388.561) (-390.219) [-387.670] (-387.555) -- 0:00:20
      672000 -- (-388.931) (-386.897) (-398.634) [-386.716] * (-387.328) [-388.909] (-387.218) (-389.401) -- 0:00:20
      672500 -- (-386.910) [-388.635] (-389.561) (-389.927) * (-387.193) (-387.447) (-386.679) [-387.778] -- 0:00:19
      673000 -- (-388.836) (-388.127) [-391.654] (-387.826) * (-387.040) [-388.418] (-387.329) (-386.966) -- 0:00:19
      673500 -- (-390.412) (-387.124) [-391.585] (-386.278) * (-388.135) [-387.653] (-389.058) (-394.143) -- 0:00:19
      674000 -- (-388.802) (-387.151) [-389.237] (-387.094) * (-387.919) (-390.388) (-390.340) [-387.187] -- 0:00:19
      674500 -- [-389.596] (-388.474) (-387.814) (-390.244) * (-387.354) [-386.759] (-385.950) (-387.102) -- 0:00:19
      675000 -- (-394.777) [-389.154] (-388.117) (-390.021) * (-389.718) [-386.842] (-388.075) (-386.703) -- 0:00:19

      Average standard deviation of split frequencies: 0.008655

      675500 -- (-388.061) (-387.826) [-387.184] (-389.642) * [-390.290] (-386.623) (-388.764) (-388.978) -- 0:00:19
      676000 -- (-389.877) (-390.115) [-387.261] (-393.836) * [-389.504] (-387.296) (-391.314) (-388.904) -- 0:00:19
      676500 -- (-387.949) [-387.077] (-393.184) (-388.076) * (-389.370) [-393.782] (-392.339) (-388.026) -- 0:00:19
      677000 -- (-386.702) (-387.723) (-386.880) [-387.295] * [-390.507] (-387.603) (-387.303) (-386.946) -- 0:00:19
      677500 -- (-391.735) (-386.537) [-389.458] (-387.777) * (-386.895) [-389.289] (-386.832) (-391.752) -- 0:00:19
      678000 -- [-387.812] (-386.456) (-386.972) (-389.554) * (-390.499) [-388.745] (-389.767) (-391.274) -- 0:00:19
      678500 -- (-391.208) (-387.225) (-387.165) [-388.785] * (-388.116) [-388.561] (-387.174) (-388.250) -- 0:00:19
      679000 -- [-386.320] (-386.665) (-389.488) (-389.317) * (-388.989) (-388.412) [-388.362] (-386.397) -- 0:00:19
      679500 -- [-387.104] (-386.534) (-389.708) (-388.067) * (-388.362) (-387.501) [-388.024] (-386.584) -- 0:00:19
      680000 -- (-389.355) [-387.813] (-389.362) (-392.210) * [-389.112] (-387.567) (-388.739) (-387.690) -- 0:00:19

      Average standard deviation of split frequencies: 0.008787

      680500 -- [-389.208] (-390.020) (-390.312) (-389.181) * [-389.299] (-391.180) (-388.902) (-387.158) -- 0:00:19
      681000 -- [-390.019] (-387.939) (-390.763) (-388.579) * (-389.478) (-391.474) [-389.105] (-388.596) -- 0:00:19
      681500 -- [-389.800] (-391.151) (-389.821) (-389.178) * (-388.437) [-390.666] (-387.955) (-391.339) -- 0:00:19
      682000 -- (-388.501) [-389.167] (-393.268) (-388.504) * (-387.202) [-390.523] (-387.355) (-388.062) -- 0:00:19
      682500 -- (-386.839) [-389.827] (-386.960) (-387.263) * [-387.522] (-388.120) (-392.500) (-387.166) -- 0:00:19
      683000 -- (-387.146) (-390.348) [-387.225] (-386.688) * (-388.776) (-387.619) [-388.950] (-387.201) -- 0:00:19
      683500 -- [-386.371] (-389.335) (-386.993) (-388.774) * (-390.406) (-386.695) (-387.390) [-388.962] -- 0:00:18
      684000 -- (-386.339) [-387.573] (-388.195) (-393.774) * (-389.031) [-386.958] (-392.659) (-388.872) -- 0:00:18
      684500 -- (-391.480) (-388.402) [-386.986] (-388.752) * [-388.359] (-387.364) (-390.545) (-390.040) -- 0:00:18
      685000 -- [-386.761] (-392.568) (-386.584) (-388.757) * (-397.921) (-390.324) [-386.779] (-391.450) -- 0:00:18

      Average standard deviation of split frequencies: 0.008976

      685500 -- (-386.124) [-386.477] (-387.403) (-387.312) * (-387.295) (-387.304) [-386.928] (-388.240) -- 0:00:18
      686000 -- (-388.179) (-389.499) (-386.522) [-387.111] * (-392.033) (-389.494) (-389.346) [-388.429] -- 0:00:18
      686500 -- (-390.704) (-389.376) [-387.300] (-387.237) * [-387.352] (-391.866) (-388.647) (-387.829) -- 0:00:18
      687000 -- [-387.995] (-387.927) (-387.169) (-386.931) * (-387.174) (-387.462) [-390.196] (-390.820) -- 0:00:19
      687500 -- (-386.534) (-389.443) (-387.742) [-389.261] * (-387.373) (-388.863) (-386.735) [-389.253] -- 0:00:19
      688000 -- [-392.440] (-388.891) (-387.178) (-390.204) * [-387.416] (-386.576) (-391.477) (-386.764) -- 0:00:19
      688500 -- [-390.565] (-387.175) (-387.858) (-388.715) * (-391.029) (-386.414) (-386.425) [-391.105] -- 0:00:19
      689000 -- [-387.388] (-390.162) (-386.399) (-386.558) * (-388.463) (-390.517) [-388.174] (-389.300) -- 0:00:18
      689500 -- (-387.287) [-389.881] (-387.881) (-386.111) * [-390.552] (-388.191) (-387.391) (-388.487) -- 0:00:18
      690000 -- (-391.708) (-387.330) [-386.829] (-386.592) * (-390.547) [-386.102] (-389.199) (-387.023) -- 0:00:18

      Average standard deviation of split frequencies: 0.008471

      690500 -- (-390.514) (-387.007) [-392.895] (-387.223) * [-388.140] (-386.457) (-389.493) (-386.886) -- 0:00:18
      691000 -- [-389.887] (-387.761) (-390.294) (-388.450) * (-386.490) (-392.693) (-388.830) [-387.451] -- 0:00:18
      691500 -- [-390.340] (-388.902) (-387.016) (-387.584) * (-386.232) [-389.654] (-393.432) (-388.409) -- 0:00:18
      692000 -- [-389.670] (-386.215) (-388.590) (-387.072) * (-388.381) (-387.947) [-395.865] (-387.298) -- 0:00:18
      692500 -- [-387.606] (-388.056) (-386.451) (-387.276) * [-387.338] (-389.166) (-393.275) (-386.847) -- 0:00:18
      693000 -- (-387.654) (-388.431) [-386.742] (-387.937) * (-388.304) [-390.256] (-390.780) (-388.172) -- 0:00:18
      693500 -- (-387.024) [-389.859] (-390.092) (-386.339) * (-387.843) (-387.484) [-390.519] (-388.804) -- 0:00:18
      694000 -- (-387.116) (-390.244) [-386.211] (-387.564) * (-387.914) (-389.748) (-389.850) [-386.145] -- 0:00:18
      694500 -- [-387.635] (-392.208) (-387.635) (-387.461) * (-390.885) (-390.628) (-388.698) [-387.145] -- 0:00:18
      695000 -- (-387.662) (-392.921) (-387.236) [-387.023] * (-386.937) (-391.669) (-388.642) [-388.740] -- 0:00:18

      Average standard deviation of split frequencies: 0.008247

      695500 -- (-390.790) [-387.964] (-389.448) (-387.914) * (-388.528) [-390.314] (-390.708) (-386.863) -- 0:00:18
      696000 -- (-388.898) (-386.367) (-387.691) [-388.867] * [-387.241] (-387.295) (-393.186) (-386.707) -- 0:00:18
      696500 -- (-389.462) (-387.739) (-388.814) [-388.637] * [-390.103] (-388.333) (-388.389) (-388.110) -- 0:00:18
      697000 -- (-389.959) (-387.097) [-387.223] (-389.268) * [-388.861] (-387.938) (-386.919) (-386.431) -- 0:00:18
      697500 -- (-390.287) (-388.989) [-387.086] (-387.501) * (-387.789) (-386.461) [-386.685] (-387.685) -- 0:00:18
      698000 -- (-387.243) (-387.590) [-388.891] (-391.885) * (-387.380) (-389.264) (-386.518) [-388.456] -- 0:00:18
      698500 -- (-389.609) (-389.221) (-387.305) [-387.435] * (-388.374) (-389.726) [-385.970] (-386.578) -- 0:00:18
      699000 -- (-387.340) [-390.190] (-387.174) (-387.071) * [-389.496] (-386.128) (-386.029) (-388.858) -- 0:00:18
      699500 -- [-387.947] (-391.252) (-390.888) (-388.994) * (-388.310) (-387.841) [-386.638] (-390.526) -- 0:00:18
      700000 -- (-389.110) (-388.093) (-390.507) [-388.768] * (-387.212) (-389.923) (-388.897) [-390.298] -- 0:00:18

      Average standard deviation of split frequencies: 0.007955

      700500 -- (-397.235) (-387.205) (-389.962) [-386.694] * (-387.900) [-392.592] (-390.213) (-388.647) -- 0:00:17
      701000 -- (-389.564) [-389.038] (-388.277) (-387.000) * (-386.814) (-388.315) (-389.721) [-387.749] -- 0:00:17
      701500 -- (-391.716) (-386.632) [-387.179] (-389.877) * (-391.228) (-388.329) (-386.802) [-388.687] -- 0:00:17
      702000 -- [-388.682] (-392.770) (-388.300) (-391.047) * (-389.114) (-389.473) (-386.748) [-388.674] -- 0:00:17
      702500 -- [-388.275] (-387.668) (-386.942) (-394.193) * (-387.539) [-386.708] (-390.619) (-389.096) -- 0:00:17
      703000 -- (-387.172) (-387.810) [-388.222] (-389.784) * [-387.638] (-388.520) (-391.425) (-394.108) -- 0:00:17
      703500 -- (-388.837) (-388.339) [-388.999] (-391.065) * (-387.605) [-386.526] (-387.918) (-389.351) -- 0:00:17
      704000 -- [-386.030] (-388.408) (-390.160) (-389.479) * (-388.473) [-388.688] (-387.289) (-390.447) -- 0:00:18
      704500 -- (-393.553) (-386.606) (-388.422) [-388.466] * [-389.855] (-390.313) (-386.638) (-390.857) -- 0:00:18
      705000 -- (-387.511) (-388.543) [-389.201] (-387.054) * (-387.816) [-388.091] (-389.527) (-386.377) -- 0:00:17

      Average standard deviation of split frequencies: 0.008327

      705500 -- (-388.469) [-391.336] (-388.765) (-389.370) * (-388.767) (-388.321) [-386.468] (-387.498) -- 0:00:17
      706000 -- (-389.704) (-389.335) [-387.102] (-389.342) * (-387.170) (-389.296) (-390.422) [-387.511] -- 0:00:17
      706500 -- (-387.600) (-391.730) [-387.282] (-390.504) * (-388.961) [-387.216] (-386.613) (-387.030) -- 0:00:17
      707000 -- [-387.368] (-387.102) (-388.426) (-390.454) * (-387.195) (-387.641) [-387.499] (-390.811) -- 0:00:17
      707500 -- (-386.864) [-387.103] (-388.457) (-387.810) * [-389.702] (-386.929) (-388.119) (-389.807) -- 0:00:17
      708000 -- (-389.120) (-388.550) [-386.464] (-390.447) * (-391.098) (-388.515) [-389.806] (-391.793) -- 0:00:17
      708500 -- (-387.934) (-387.091) (-385.988) [-387.248] * [-388.148] (-388.004) (-392.286) (-388.216) -- 0:00:17
      709000 -- (-393.036) [-387.769] (-386.649) (-388.574) * (-387.631) [-389.425] (-387.649) (-389.704) -- 0:00:17
      709500 -- (-390.539) [-390.377] (-390.379) (-386.979) * (-388.404) (-389.194) [-388.106] (-389.054) -- 0:00:17
      710000 -- [-389.883] (-386.421) (-394.406) (-388.684) * (-386.677) (-389.874) [-386.462] (-391.123) -- 0:00:17

      Average standard deviation of split frequencies: 0.008311

      710500 -- (-387.636) (-387.324) [-391.492] (-392.010) * [-387.158] (-391.177) (-387.910) (-387.130) -- 0:00:17
      711000 -- (-392.430) (-389.500) (-387.455) [-388.894] * (-389.866) (-388.711) [-387.781] (-387.406) -- 0:00:17
      711500 -- (-393.291) (-387.531) (-387.559) [-386.938] * (-390.667) (-387.567) (-393.181) [-390.563] -- 0:00:17
      712000 -- (-388.224) (-389.513) (-389.355) [-388.526] * [-392.876] (-387.295) (-388.647) (-388.674) -- 0:00:17
      712500 -- (-390.207) (-389.820) (-389.920) [-388.704] * (-389.356) (-388.860) [-387.374] (-390.171) -- 0:00:17
      713000 -- (-390.458) (-390.114) [-388.780] (-399.978) * (-388.608) (-387.112) [-388.891] (-388.709) -- 0:00:17
      713500 -- (-386.899) [-386.591] (-389.588) (-386.227) * [-389.961] (-392.806) (-388.217) (-387.457) -- 0:00:17
      714000 -- (-387.827) (-389.041) (-387.685) [-386.607] * (-393.185) (-394.297) (-390.077) [-388.042] -- 0:00:17
      714500 -- [-387.882] (-386.773) (-389.079) (-386.275) * (-391.524) (-387.459) [-387.485] (-386.501) -- 0:00:17
      715000 -- [-388.649] (-388.130) (-387.873) (-387.642) * (-389.157) [-386.865] (-391.400) (-388.731) -- 0:00:17

      Average standard deviation of split frequencies: 0.007823

      715500 -- (-387.608) (-388.124) [-387.755] (-388.018) * (-387.921) (-389.970) (-388.719) [-389.019] -- 0:00:17
      716000 -- (-389.132) (-393.626) [-389.666] (-387.448) * (-386.874) (-389.140) (-390.721) [-387.768] -- 0:00:17
      716500 -- (-388.195) (-387.367) [-388.113] (-389.372) * [-387.270] (-387.601) (-389.166) (-388.006) -- 0:00:17
      717000 -- (-387.536) (-387.928) [-388.406] (-386.954) * (-389.153) [-391.319] (-386.922) (-386.735) -- 0:00:16
      717500 -- (-389.249) (-388.962) [-388.493] (-387.735) * (-386.997) (-388.924) [-386.239] (-389.611) -- 0:00:16
      718000 -- [-390.022] (-387.635) (-388.385) (-390.137) * [-388.093] (-387.081) (-388.898) (-389.362) -- 0:00:16
      718500 -- [-387.130] (-389.472) (-388.580) (-389.153) * (-387.466) [-388.423] (-387.830) (-386.095) -- 0:00:16
      719000 -- (-387.413) [-388.226] (-395.497) (-390.199) * (-387.115) [-388.465] (-392.864) (-387.923) -- 0:00:16
      719500 -- (-392.678) (-387.613) (-395.354) [-391.985] * (-387.255) (-387.516) [-389.265] (-389.375) -- 0:00:16
      720000 -- (-392.876) [-387.995] (-387.465) (-395.164) * (-387.477) [-388.948] (-389.167) (-388.873) -- 0:00:16

      Average standard deviation of split frequencies: 0.007195

      720500 -- [-391.815] (-388.950) (-390.447) (-387.130) * (-386.909) [-387.707] (-388.681) (-393.032) -- 0:00:16
      721000 -- (-392.920) (-392.301) [-387.677] (-387.922) * [-387.103] (-389.922) (-387.612) (-390.336) -- 0:00:17
      721500 -- (-391.410) [-389.102] (-387.844) (-387.887) * (-386.540) (-387.726) (-388.746) [-388.989] -- 0:00:16
      722000 -- (-387.163) [-387.550] (-386.541) (-388.250) * [-387.044] (-387.137) (-389.643) (-393.237) -- 0:00:16
      722500 -- (-387.222) [-387.097] (-388.078) (-387.221) * [-386.324] (-388.735) (-389.713) (-390.287) -- 0:00:16
      723000 -- [-388.327] (-387.330) (-386.421) (-389.065) * [-386.645] (-388.399) (-389.827) (-388.366) -- 0:00:16
      723500 -- (-388.952) (-389.397) (-386.977) [-390.477] * (-389.205) (-389.302) (-389.355) [-390.547] -- 0:00:16
      724000 -- (-390.354) (-388.751) [-386.275] (-390.035) * (-388.749) [-391.498] (-390.262) (-387.671) -- 0:00:16
      724500 -- (-387.110) (-389.039) [-388.213] (-387.680) * (-387.922) (-387.148) (-393.139) [-387.547] -- 0:00:16
      725000 -- (-390.252) (-386.864) [-388.094] (-388.644) * (-387.899) (-387.641) [-389.999] (-388.126) -- 0:00:16

      Average standard deviation of split frequencies: 0.007295

      725500 -- [-390.068] (-390.064) (-387.439) (-392.231) * (-386.620) (-387.147) (-390.213) [-389.594] -- 0:00:16
      726000 -- (-387.048) (-386.697) [-390.897] (-390.332) * (-387.430) (-386.656) [-387.797] (-386.625) -- 0:00:16
      726500 -- (-393.790) (-386.795) (-389.027) [-389.505] * (-386.854) [-392.466] (-389.265) (-386.924) -- 0:00:16
      727000 -- (-386.752) (-387.365) [-389.798] (-388.384) * (-390.320) [-386.469] (-389.118) (-387.908) -- 0:00:16
      727500 -- (-387.747) (-390.276) (-394.637) [-387.374] * [-388.308] (-386.660) (-388.034) (-389.020) -- 0:00:16
      728000 -- (-388.214) (-388.357) (-389.468) [-387.013] * (-387.189) [-386.833] (-387.806) (-390.512) -- 0:00:16
      728500 -- [-387.615] (-389.006) (-389.684) (-388.626) * [-386.916] (-387.501) (-389.759) (-389.638) -- 0:00:16
      729000 -- (-388.131) [-387.749] (-391.184) (-389.543) * [-387.250] (-387.055) (-386.922) (-386.768) -- 0:00:16
      729500 -- [-390.666] (-391.131) (-388.634) (-391.518) * (-388.264) [-387.722] (-388.520) (-392.692) -- 0:00:16
      730000 -- (-387.863) (-387.695) (-387.695) [-387.896] * (-387.907) [-386.762] (-387.839) (-389.366) -- 0:00:16

      Average standard deviation of split frequencies: 0.006983

      730500 -- [-386.932] (-387.983) (-389.158) (-387.701) * (-387.605) [-386.856] (-388.421) (-390.509) -- 0:00:16
      731000 -- [-386.561] (-386.759) (-389.491) (-388.405) * (-388.533) [-391.333] (-386.873) (-387.919) -- 0:00:16
      731500 -- (-390.264) [-387.680] (-390.336) (-389.620) * (-390.320) (-388.545) (-388.678) [-387.510] -- 0:00:16
      732000 -- [-386.860] (-386.589) (-392.392) (-386.824) * (-387.312) (-387.459) (-390.316) [-387.783] -- 0:00:16
      732500 -- [-388.638] (-389.971) (-388.473) (-389.766) * (-386.508) (-388.643) (-387.835) [-389.811] -- 0:00:16
      733000 -- [-387.130] (-388.835) (-388.124) (-390.989) * (-386.708) (-388.496) (-388.802) [-386.575] -- 0:00:16
      733500 -- (-389.378) (-388.810) [-388.330] (-390.506) * [-386.427] (-390.118) (-386.869) (-387.255) -- 0:00:15
      734000 -- [-386.434] (-388.136) (-388.841) (-389.858) * (-387.666) [-389.814] (-388.098) (-386.226) -- 0:00:15
      734500 -- (-392.720) [-388.705] (-390.445) (-387.729) * (-390.338) (-391.374) (-392.961) [-387.614] -- 0:00:15
      735000 -- (-389.763) [-392.183] (-387.404) (-394.493) * (-387.721) (-386.903) [-388.621] (-386.655) -- 0:00:15

      Average standard deviation of split frequencies: 0.007158

      735500 -- (-387.341) (-396.024) [-390.303] (-388.029) * (-390.066) (-389.910) (-387.196) [-391.540] -- 0:00:15
      736000 -- [-386.341] (-387.689) (-388.401) (-388.140) * (-386.739) (-389.254) (-390.027) [-388.350] -- 0:00:15
      736500 -- [-388.970] (-387.306) (-390.082) (-390.627) * (-386.610) [-388.182] (-388.402) (-388.034) -- 0:00:15
      737000 -- (-387.722) (-393.101) [-390.349] (-389.410) * (-388.908) [-392.544] (-387.106) (-388.131) -- 0:00:15
      737500 -- (-387.775) (-389.064) (-387.253) [-389.047] * (-390.296) (-389.840) (-387.839) [-387.185] -- 0:00:15
      738000 -- (-386.451) (-389.642) (-387.375) [-391.124] * (-389.736) (-396.166) (-389.028) [-387.659] -- 0:00:15
      738500 -- (-388.151) (-388.091) (-389.655) [-388.564] * (-387.897) (-389.920) [-390.760] (-390.075) -- 0:00:15
      739000 -- (-388.497) [-388.699] (-389.261) (-388.038) * (-387.280) [-387.818] (-386.496) (-389.065) -- 0:00:15
      739500 -- (-386.824) (-387.977) [-388.291] (-387.182) * (-387.326) (-390.305) (-386.928) [-386.415] -- 0:00:15
      740000 -- (-388.452) (-388.391) [-387.329] (-387.737) * (-388.218) [-389.064] (-390.389) (-388.604) -- 0:00:15

      Average standard deviation of split frequencies: 0.007301

      740500 -- [-386.851] (-389.371) (-386.744) (-387.747) * [-388.648] (-392.042) (-387.443) (-388.419) -- 0:00:15
      741000 -- (-387.813) (-390.835) (-389.527) [-387.767] * (-386.372) (-392.431) (-386.475) [-387.567] -- 0:00:15
      741500 -- (-387.711) [-386.955] (-387.799) (-388.430) * (-388.857) (-390.620) (-387.239) [-386.629] -- 0:00:15
      742000 -- (-390.864) (-387.240) (-390.114) [-388.724] * (-387.458) (-389.169) (-386.111) [-387.149] -- 0:00:15
      742500 -- (-391.034) [-387.572] (-389.921) (-387.725) * (-386.802) [-387.468] (-386.375) (-389.231) -- 0:00:15
      743000 -- (-388.353) (-389.060) [-389.389] (-386.414) * (-387.451) (-388.782) [-388.189] (-390.190) -- 0:00:15
      743500 -- (-388.866) (-390.155) [-386.929] (-389.936) * (-389.762) (-387.628) (-388.429) [-386.332] -- 0:00:15
      744000 -- (-386.555) [-395.517] (-389.421) (-387.931) * (-387.375) [-389.900] (-387.840) (-388.944) -- 0:00:15
      744500 -- [-389.909] (-389.174) (-386.819) (-388.216) * (-388.697) (-389.447) [-386.133] (-387.127) -- 0:00:15
      745000 -- [-387.443] (-387.229) (-386.805) (-390.062) * (-391.569) (-388.721) [-386.037] (-387.208) -- 0:00:15

      Average standard deviation of split frequencies: 0.007211

      745500 -- [-387.181] (-386.798) (-387.468) (-388.498) * [-391.798] (-386.668) (-388.152) (-387.615) -- 0:00:15
      746000 -- (-391.479) (-387.990) (-388.668) [-387.039] * (-390.002) (-387.212) (-387.137) [-386.745] -- 0:00:15
      746500 -- (-389.347) (-396.087) [-387.640] (-387.281) * (-388.952) [-390.798] (-386.987) (-387.976) -- 0:00:15
      747000 -- (-387.739) (-392.818) (-389.565) [-388.333] * [-387.754] (-390.917) (-387.201) (-386.780) -- 0:00:15
      747500 -- (-388.541) (-390.313) [-389.395] (-388.933) * (-388.849) (-389.695) [-390.090] (-386.789) -- 0:00:15
      748000 -- (-387.113) (-390.334) [-386.674] (-389.332) * [-388.212] (-389.737) (-388.141) (-386.364) -- 0:00:15
      748500 -- (-388.827) (-392.424) (-387.659) [-390.174] * (-389.658) [-387.102] (-388.212) (-389.156) -- 0:00:15
      749000 -- [-389.557] (-388.719) (-387.958) (-390.482) * (-390.296) (-388.688) [-390.477] (-388.914) -- 0:00:15
      749500 -- (-390.159) [-389.795] (-390.790) (-386.865) * (-388.422) (-387.547) (-387.545) [-388.380] -- 0:00:15
      750000 -- (-389.518) [-387.309] (-387.376) (-389.015) * (-392.084) (-391.113) (-388.378) [-386.088] -- 0:00:15

      Average standard deviation of split frequencies: 0.007203

      750500 -- (-388.257) (-391.540) [-389.326] (-388.482) * [-389.922] (-389.598) (-386.072) (-387.768) -- 0:00:14
      751000 -- [-387.005] (-386.588) (-390.728) (-386.690) * (-388.761) (-387.644) (-390.498) [-388.489] -- 0:00:14
      751500 -- (-387.329) (-387.212) (-386.411) [-388.706] * (-389.403) (-388.337) (-388.574) [-388.631] -- 0:00:14
      752000 -- (-389.368) [-388.253] (-386.538) (-388.967) * [-389.850] (-392.404) (-388.441) (-386.782) -- 0:00:14
      752500 -- (-390.321) [-388.734] (-388.490) (-386.482) * (-388.713) [-389.105] (-390.551) (-388.038) -- 0:00:14
      753000 -- (-396.168) [-387.763] (-389.980) (-387.103) * (-387.872) [-390.090] (-388.807) (-388.504) -- 0:00:14
      753500 -- (-388.020) (-390.720) (-388.990) [-388.122] * [-386.434] (-388.414) (-388.177) (-390.810) -- 0:00:14
      754000 -- (-389.884) [-389.267] (-387.534) (-390.394) * [-388.021] (-389.405) (-388.018) (-387.712) -- 0:00:14
      754500 -- [-387.571] (-388.130) (-387.680) (-386.747) * (-386.330) [-389.142] (-390.657) (-388.647) -- 0:00:14
      755000 -- [-388.312] (-389.019) (-387.134) (-386.763) * (-387.864) (-386.791) [-391.427] (-388.388) -- 0:00:14

      Average standard deviation of split frequencies: 0.007519

      755500 -- (-389.042) (-389.425) (-388.390) [-386.934] * (-387.873) (-388.166) [-390.156] (-391.735) -- 0:00:14
      756000 -- (-390.447) [-390.272] (-387.647) (-389.521) * [-387.757] (-387.200) (-389.346) (-389.926) -- 0:00:14
      756500 -- (-388.481) (-393.233) [-386.334] (-392.228) * (-389.199) (-390.210) (-388.535) [-390.345] -- 0:00:14
      757000 -- (-387.702) (-392.008) [-387.466] (-391.579) * (-387.601) (-390.691) (-389.797) [-387.418] -- 0:00:14
      757500 -- (-388.959) (-391.499) (-386.897) [-388.730] * (-386.358) (-387.303) (-389.092) [-393.647] -- 0:00:14
      758000 -- (-386.395) (-386.679) [-389.679] (-387.150) * (-386.234) [-387.420] (-388.176) (-386.995) -- 0:00:14
      758500 -- (-387.070) (-389.455) [-387.265] (-388.333) * (-388.163) [-387.471] (-389.892) (-386.741) -- 0:00:14
      759000 -- (-390.108) (-395.440) [-387.528] (-389.705) * (-387.856) (-390.803) (-386.645) [-389.084] -- 0:00:14
      759500 -- (-386.702) [-389.086] (-387.804) (-388.427) * (-388.356) [-389.092] (-386.451) (-390.820) -- 0:00:14
      760000 -- (-389.353) (-388.626) (-387.553) [-388.126] * [-386.583] (-386.697) (-388.528) (-391.700) -- 0:00:14

      Average standard deviation of split frequencies: 0.007874

      760500 -- [-387.905] (-388.738) (-387.986) (-393.066) * (-387.972) [-388.994] (-390.683) (-387.316) -- 0:00:14
      761000 -- (-387.585) [-388.523] (-387.346) (-390.618) * (-387.208) (-389.775) [-389.872] (-390.920) -- 0:00:14
      761500 -- (-389.126) (-387.628) [-387.500] (-386.937) * (-388.146) (-387.928) (-388.922) [-387.381] -- 0:00:14
      762000 -- (-389.440) [-386.246] (-387.097) (-391.759) * (-391.522) [-387.690] (-386.842) (-386.985) -- 0:00:14
      762500 -- (-388.810) (-388.858) (-389.405) [-391.825] * (-389.593) [-389.877] (-387.219) (-387.472) -- 0:00:14
      763000 -- (-386.426) [-389.607] (-389.894) (-387.409) * (-388.765) [-387.428] (-387.544) (-387.695) -- 0:00:14
      763500 -- (-386.798) (-390.929) (-390.354) [-390.164] * (-392.912) (-390.469) [-388.497] (-387.494) -- 0:00:14
      764000 -- [-387.326] (-388.068) (-388.037) (-392.636) * (-386.478) (-388.908) (-388.325) [-387.357] -- 0:00:14
      764500 -- [-389.439] (-393.010) (-387.083) (-388.364) * [-386.954] (-389.377) (-389.259) (-389.475) -- 0:00:14
      765000 -- (-389.817) (-391.085) (-387.356) [-388.201] * [-388.889] (-390.024) (-387.697) (-387.912) -- 0:00:14

      Average standard deviation of split frequencies: 0.007892

      765500 -- [-389.363] (-387.536) (-390.284) (-387.995) * (-386.921) [-389.809] (-387.141) (-389.620) -- 0:00:14
      766000 -- [-388.010] (-387.620) (-389.455) (-388.228) * [-387.374] (-389.009) (-388.279) (-387.588) -- 0:00:14
      766500 -- [-388.964] (-386.975) (-393.329) (-390.178) * [-389.907] (-387.365) (-386.316) (-388.382) -- 0:00:14
      767000 -- (-387.663) (-390.952) (-387.827) [-389.145] * (-387.973) (-389.002) (-390.677) [-389.824] -- 0:00:13
      767500 -- (-387.011) [-389.497] (-388.910) (-388.285) * (-389.851) [-390.406] (-390.934) (-389.511) -- 0:00:13
      768000 -- (-386.922) (-388.383) (-387.505) [-389.537] * (-389.541) [-387.691] (-387.461) (-386.697) -- 0:00:13
      768500 -- (-386.422) [-387.341] (-387.997) (-390.129) * (-391.133) (-387.304) (-389.608) [-386.540] -- 0:00:13
      769000 -- (-387.334) [-386.273] (-390.900) (-389.150) * [-390.786] (-386.744) (-391.889) (-387.988) -- 0:00:13
      769500 -- (-389.232) [-391.091] (-386.987) (-388.826) * (-387.513) (-387.821) (-390.072) [-386.218] -- 0:00:13
      770000 -- (-389.503) (-391.090) [-386.666] (-390.791) * (-386.622) (-386.154) (-387.187) [-387.885] -- 0:00:13

      Average standard deviation of split frequencies: 0.007880

      770500 -- (-388.384) [-387.732] (-387.290) (-387.780) * (-388.117) (-387.254) [-389.983] (-393.442) -- 0:00:13
      771000 -- (-387.894) (-391.406) (-388.708) [-389.532] * (-391.026) [-388.975] (-389.528) (-386.900) -- 0:00:13
      771500 -- (-389.493) (-386.687) (-389.775) [-388.218] * (-391.924) [-387.992] (-388.294) (-388.006) -- 0:00:13
      772000 -- (-388.050) [-387.529] (-387.596) (-389.166) * (-389.223) (-392.009) [-389.199] (-386.579) -- 0:00:13
      772500 -- (-389.646) (-389.041) (-386.787) [-387.861] * (-387.818) (-397.204) [-386.211] (-390.700) -- 0:00:13
      773000 -- (-389.587) [-386.751] (-388.383) (-390.142) * (-388.933) (-390.414) (-390.549) [-388.245] -- 0:00:13
      773500 -- (-386.351) (-386.853) (-389.990) [-386.738] * (-390.400) [-388.211] (-391.590) (-392.581) -- 0:00:13
      774000 -- (-388.801) (-388.271) [-388.249] (-387.740) * (-402.490) (-387.561) (-394.348) [-390.139] -- 0:00:13
      774500 -- [-386.901] (-388.791) (-388.755) (-388.467) * (-386.291) (-388.104) (-391.127) [-387.591] -- 0:00:13
      775000 -- (-386.322) (-388.554) (-391.644) [-388.880] * (-389.088) (-387.449) (-388.847) [-387.989] -- 0:00:13

      Average standard deviation of split frequencies: 0.008040

      775500 -- (-386.712) (-387.143) (-389.454) [-388.028] * (-393.625) (-388.443) [-390.985] (-388.508) -- 0:00:13
      776000 -- [-389.127] (-387.150) (-389.158) (-388.401) * (-393.116) (-386.366) (-388.680) [-387.272] -- 0:00:13
      776500 -- (-390.064) (-388.757) [-388.219] (-389.057) * (-391.506) (-386.978) [-388.652] (-387.242) -- 0:00:13
      777000 -- (-389.581) (-388.156) (-390.083) [-388.168] * (-386.720) (-387.195) (-387.815) [-388.336] -- 0:00:13
      777500 -- (-386.548) (-391.065) (-387.576) [-387.109] * (-390.542) [-388.459] (-387.170) (-389.320) -- 0:00:13
      778000 -- (-388.491) (-389.223) (-388.891) [-386.184] * (-391.744) (-388.314) (-388.997) [-387.905] -- 0:00:13
      778500 -- [-389.740] (-392.684) (-387.647) (-389.118) * [-389.176] (-393.671) (-389.333) (-389.199) -- 0:00:13
      779000 -- (-386.695) (-390.976) (-387.126) [-386.381] * (-390.086) [-388.935] (-392.357) (-391.334) -- 0:00:13
      779500 -- (-392.362) (-386.928) (-388.221) [-387.611] * [-388.009] (-390.093) (-390.070) (-391.154) -- 0:00:13
      780000 -- [-388.177] (-387.335) (-388.545) (-389.073) * [-389.013] (-389.200) (-386.794) (-394.616) -- 0:00:13

      Average standard deviation of split frequencies: 0.007495

      780500 -- (-386.876) (-389.705) [-389.202] (-390.658) * (-388.520) [-386.312] (-387.823) (-390.365) -- 0:00:13
      781000 -- (-389.155) (-38