--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:57:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1575/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.70 -392.02
2 -387.68 -391.12
--------------------------------------
TOTAL -387.69 -391.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900367 0.091236 0.380552 1.503334 0.861904 1501.00 1501.00 1.002
r(A<->C){all} 0.155940 0.018780 0.000040 0.431289 0.117792 98.80 215.40 1.002
r(A<->G){all} 0.177329 0.020981 0.000060 0.460676 0.139571 110.37 148.84 1.003
r(A<->T){all} 0.165944 0.020037 0.000239 0.446151 0.131487 188.23 227.51 1.002
r(C<->G){all} 0.160616 0.018578 0.000108 0.426750 0.128281 265.68 281.96 1.001
r(C<->T){all} 0.169222 0.020580 0.000103 0.455421 0.133132 193.14 222.73 1.001
r(G<->T){all} 0.170950 0.020322 0.000140 0.457791 0.134163 177.55 186.75 1.000
pi(A){all} 0.136050 0.000415 0.098245 0.176363 0.135393 884.93 1099.83 1.000
pi(C){all} 0.270058 0.000700 0.220641 0.323632 0.269999 1308.40 1336.91 1.000
pi(G){all} 0.369925 0.000806 0.315444 0.423611 0.368996 1150.09 1179.74 1.000
pi(T){all} 0.223966 0.000618 0.177142 0.271704 0.222862 1271.07 1285.55 1.000
alpha{1,2} 0.419797 0.234434 0.000111 1.372967 0.246198 757.89 950.99 1.000
alpha{3} 0.445862 0.215030 0.000173 1.355229 0.301002 1167.29 1208.25 1.001
pinvar{all} 0.994019 0.000056 0.979377 0.999995 0.996487 1132.10 1264.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -371.170695
Model 2: PositiveSelection -371.170772
Model 0: one-ratio -371.170799
Model 7: beta -371.170731
Model 8: beta&w>1 -371.170713
Model 0 vs 1 2.0799999992959783E-4
Model 2 vs 1 1.539999999522479E-4
Model 8 vs 7 3.6000000022795575E-5
>C1
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C2
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C3
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C4
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C5
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C6
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=97
C1 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C2 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C3 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C4 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C5 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C6 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
**************************************************
C1 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C2 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C3 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C4 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C5 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C6 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 97 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 97 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2910]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2910]--->[2910]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.621 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C2 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C3 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C4 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C5 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
C6 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
**************************************************
C1 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C2 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C3 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C4 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C5 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
C6 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C2 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C3 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C4 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C5 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
C6 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
**************************************************
C1 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C2 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C3 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C4 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C5 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
C6 GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
**************************************************
C1 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C2 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C3 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C4 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C5 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
C6 TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
**************************************************
C1 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C2 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C3 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C4 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C5 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
C6 GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
**************************************************
C1 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C2 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C3 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C4 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C5 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
C6 CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
**************************************************
C1 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C2 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C3 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C4 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C5 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
C6 GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
*****************************************
>C1
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C2
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C3
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C4
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C5
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C6
TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC
GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT
TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG
GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG
CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG
GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>C1
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C2
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C3
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C4
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C5
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
>C6
LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 291 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856143
Setting output file names to "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1862162734
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5694859264
Seed = 1298528830
Swapseed = 1579856143
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -651.271909 -- -24.965149
Chain 2 -- -651.271947 -- -24.965149
Chain 3 -- -651.271849 -- -24.965149
Chain 4 -- -651.271947 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -651.271947 -- -24.965149
Chain 2 -- -651.271947 -- -24.965149
Chain 3 -- -651.271947 -- -24.965149
Chain 4 -- -651.271947 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-651.272] (-651.272) (-651.272) (-651.272) * [-651.272] (-651.272) (-651.272) (-651.272)
500 -- (-417.423) (-403.825) [-394.481] (-393.869) * (-409.950) (-396.375) [-409.797] (-404.517) -- 0:00:00
1000 -- (-403.692) (-399.401) [-402.104] (-399.075) * (-401.870) (-395.142) (-410.785) [-399.173] -- 0:00:00
1500 -- (-399.560) (-397.604) [-400.015] (-405.806) * [-391.436] (-394.839) (-399.909) (-398.542) -- 0:00:00
2000 -- (-402.628) (-394.992) (-403.040) [-399.874] * [-396.201] (-400.219) (-402.038) (-400.430) -- 0:00:00
2500 -- (-393.847) [-396.007] (-395.873) (-397.227) * (-393.170) [-394.025] (-400.306) (-396.615) -- 0:00:00
3000 -- (-401.937) [-399.537] (-395.360) (-409.283) * (-399.050) (-403.056) [-395.148] (-403.785) -- 0:00:00
3500 -- (-397.494) (-395.138) [-398.727] (-399.586) * (-396.707) [-392.264] (-403.825) (-401.181) -- 0:00:00
4000 -- (-391.573) (-399.660) (-397.935) [-400.472] * (-398.850) (-401.635) (-400.554) [-396.872] -- 0:00:00
4500 -- (-400.883) (-391.862) (-395.255) [-389.710] * (-401.199) (-403.383) (-395.586) [-404.836] -- 0:00:00
5000 -- (-401.459) [-398.096] (-402.596) (-399.731) * (-400.424) (-395.067) (-404.816) [-393.305] -- 0:00:00
Average standard deviation of split frequencies: 0.114280
5500 -- (-400.296) (-402.313) [-395.734] (-401.402) * (-405.960) (-394.404) [-393.784] (-394.315) -- 0:03:00
6000 -- (-397.853) (-395.814) (-400.492) [-399.952] * (-406.781) [-391.125] (-394.331) (-407.295) -- 0:02:45
6500 -- (-398.799) (-393.620) [-397.911] (-405.890) * (-397.271) (-394.889) [-396.470] (-404.367) -- 0:02:32
7000 -- [-394.181] (-396.984) (-395.781) (-405.314) * [-399.588] (-396.541) (-400.078) (-403.273) -- 0:02:21
7500 -- [-393.914] (-401.613) (-392.367) (-388.006) * (-409.132) (-395.474) (-400.438) [-399.902] -- 0:02:12
8000 -- (-398.599) [-395.434] (-395.919) (-387.379) * (-394.900) (-399.628) (-395.429) [-400.380] -- 0:02:04
8500 -- [-397.732] (-395.796) (-397.670) (-390.068) * (-409.720) [-396.854] (-398.090) (-401.388) -- 0:01:56
9000 -- (-397.559) (-399.195) (-403.335) [-387.588] * (-397.223) (-398.950) [-393.772] (-405.531) -- 0:01:50
9500 -- (-393.491) (-402.152) (-399.394) [-388.221] * (-392.676) [-402.159] (-390.303) (-402.662) -- 0:01:44
10000 -- (-401.098) (-396.438) (-395.306) [-389.784] * (-392.623) [-400.835] (-398.390) (-403.803) -- 0:01:39
Average standard deviation of split frequencies: 0.079970
10500 -- [-399.146] (-393.937) (-400.174) (-389.032) * [-388.085] (-400.350) (-399.436) (-401.405) -- 0:01:34
11000 -- (-400.732) (-396.717) [-395.314] (-390.479) * [-387.757] (-398.221) (-404.090) (-394.189) -- 0:01:29
11500 -- (-404.305) [-399.885] (-401.410) (-389.120) * (-387.882) (-393.772) [-395.729] (-394.074) -- 0:01:25
12000 -- (-397.988) [-391.502] (-401.205) (-390.576) * [-388.672] (-396.009) (-398.157) (-396.823) -- 0:01:22
12500 -- (-398.463) [-393.627] (-407.865) (-389.017) * [-387.210] (-396.536) (-395.172) (-395.909) -- 0:01:19
13000 -- [-391.441] (-397.629) (-402.670) (-388.291) * (-388.250) (-393.081) [-394.972] (-395.375) -- 0:01:15
13500 -- (-400.017) [-396.544] (-392.477) (-389.343) * (-388.385) [-394.557] (-396.034) (-393.960) -- 0:01:13
14000 -- (-397.213) (-400.841) (-395.851) [-390.219] * (-391.856) [-391.780] (-401.419) (-389.942) -- 0:01:10
14500 -- (-397.753) [-396.037] (-398.471) (-389.405) * (-388.602) (-400.100) [-392.835] (-388.518) -- 0:01:07
15000 -- (-404.164) (-399.600) (-395.207) [-388.350] * (-388.168) [-396.017] (-400.448) (-388.832) -- 0:01:05
Average standard deviation of split frequencies: 0.072675
15500 -- [-395.452] (-404.309) (-402.946) (-389.354) * [-387.406] (-394.190) (-391.959) (-389.361) -- 0:01:03
16000 -- [-394.829] (-388.367) (-408.376) (-387.278) * [-386.995] (-399.227) (-398.700) (-387.196) -- 0:01:01
16500 -- (-396.090) (-391.313) [-395.113] (-391.077) * (-387.666) [-394.739] (-394.231) (-387.499) -- 0:00:59
17000 -- (-402.878) (-389.072) [-390.648] (-388.372) * [-389.286] (-395.795) (-402.436) (-387.921) -- 0:00:57
17500 -- [-392.431] (-390.702) (-400.758) (-386.957) * (-388.986) (-393.389) (-394.238) [-387.879] -- 0:00:56
18000 -- [-393.826] (-387.997) (-396.561) (-386.219) * (-387.325) (-401.014) (-399.105) [-390.420] -- 0:00:54
18500 -- (-399.758) (-387.965) (-403.850) [-386.428] * (-390.970) (-403.198) (-400.172) [-388.267] -- 0:00:53
19000 -- [-393.031] (-392.686) (-396.589) (-386.487) * (-393.954) (-397.069) (-418.624) [-387.812] -- 0:00:51
19500 -- (-395.718) (-389.605) (-400.450) [-386.839] * (-387.618) (-403.696) (-410.082) [-393.485] -- 0:00:50
20000 -- [-400.693] (-389.255) (-398.063) (-387.062) * (-390.297) (-397.970) [-386.891] (-387.231) -- 0:00:49
Average standard deviation of split frequencies: 0.043085
20500 -- [-394.888] (-387.549) (-393.329) (-387.074) * [-389.623] (-405.361) (-387.797) (-388.387) -- 0:00:47
21000 -- (-397.854) (-389.304) (-397.860) [-387.560] * [-386.995] (-395.706) (-387.292) (-387.866) -- 0:00:46
21500 -- [-393.441] (-387.444) (-398.454) (-388.602) * (-388.518) (-392.934) (-390.405) [-389.686] -- 0:00:45
22000 -- (-399.974) (-389.182) (-412.401) [-387.881] * (-388.451) (-388.296) (-387.323) [-392.900] -- 0:01:28
22500 -- (-400.582) (-387.934) (-389.422) [-390.010] * (-389.538) [-388.078] (-387.032) (-387.634) -- 0:01:26
23000 -- (-404.337) [-386.717] (-389.030) (-388.898) * [-387.412] (-386.750) (-386.602) (-388.107) -- 0:01:24
23500 -- [-403.087] (-388.523) (-388.387) (-388.256) * (-387.318) (-390.525) [-387.281] (-390.541) -- 0:01:23
24000 -- (-404.258) (-391.566) (-387.932) [-386.799] * (-388.414) (-386.759) [-388.118] (-387.987) -- 0:01:21
24500 -- (-398.595) (-394.028) [-388.163] (-389.792) * [-389.073] (-388.524) (-386.407) (-386.280) -- 0:01:19
25000 -- [-397.039] (-387.535) (-387.525) (-389.196) * (-389.266) [-391.044] (-390.111) (-387.105) -- 0:01:18
Average standard deviation of split frequencies: 0.045327
25500 -- (-402.079) [-387.724] (-388.207) (-389.087) * (-387.258) [-388.983] (-386.986) (-387.989) -- 0:01:16
26000 -- (-395.575) (-390.699) [-388.249] (-390.442) * (-390.308) (-386.344) (-389.167) [-392.017] -- 0:01:14
26500 -- [-394.314] (-388.957) (-389.563) (-388.643) * (-386.024) (-395.763) [-388.254] (-386.404) -- 0:01:13
27000 -- (-395.095) (-386.267) (-390.012) [-388.033] * (-386.353) (-389.182) [-388.498] (-386.776) -- 0:01:12
27500 -- (-397.571) (-388.560) [-386.830] (-389.280) * (-389.224) (-388.071) [-388.784] (-392.051) -- 0:01:10
28000 -- (-400.585) (-392.551) [-390.066] (-390.729) * (-387.830) [-388.378] (-389.713) (-390.051) -- 0:01:09
28500 -- (-404.897) [-388.361] (-390.852) (-388.318) * (-386.516) (-389.832) (-387.685) [-388.944] -- 0:01:08
29000 -- (-407.309) (-388.256) (-389.709) [-387.632] * (-388.379) [-390.041] (-387.831) (-393.445) -- 0:01:06
29500 -- [-397.240] (-386.684) (-390.962) (-387.221) * (-387.751) [-390.236] (-389.697) (-387.357) -- 0:01:05
30000 -- (-403.337) (-387.566) [-390.015] (-388.122) * (-386.459) (-387.209) (-387.166) [-387.479] -- 0:01:04
Average standard deviation of split frequencies: 0.043041
30500 -- (-391.581) [-387.093] (-386.541) (-389.753) * (-386.766) (-387.645) (-388.348) [-389.486] -- 0:01:03
31000 -- (-389.651) (-388.096) [-386.160] (-386.481) * (-389.659) (-388.696) (-388.361) [-389.779] -- 0:01:02
31500 -- (-386.231) (-390.598) (-387.688) [-388.895] * [-387.132] (-386.413) (-389.470) (-388.421) -- 0:01:01
32000 -- (-386.642) (-388.068) (-386.269) [-387.735] * (-386.303) [-386.654] (-387.812) (-388.682) -- 0:01:00
32500 -- [-388.194] (-386.432) (-387.652) (-392.051) * (-387.463) (-387.158) [-388.575] (-388.334) -- 0:00:59
33000 -- (-388.277) [-387.399] (-389.872) (-388.112) * (-388.050) (-388.491) (-387.237) [-389.685] -- 0:00:58
33500 -- (-389.623) (-391.238) [-388.366] (-389.865) * [-387.563] (-389.624) (-388.029) (-388.972) -- 0:00:57
34000 -- (-387.801) (-389.075) (-388.117) [-389.404] * (-388.652) (-389.759) (-387.823) [-387.542] -- 0:00:56
34500 -- (-387.881) (-389.884) (-386.539) [-390.021] * [-387.940] (-387.678) (-387.551) (-386.908) -- 0:00:55
35000 -- [-387.679] (-391.311) (-387.578) (-387.188) * [-389.834] (-387.859) (-387.323) (-387.532) -- 0:00:55
Average standard deviation of split frequencies: 0.039973
35500 -- (-387.882) [-392.526] (-386.967) (-388.789) * [-391.192] (-388.617) (-388.163) (-388.242) -- 0:00:54
36000 -- (-388.244) (-389.612) (-386.365) [-387.164] * (-390.980) (-389.163) (-388.541) [-388.617] -- 0:00:53
36500 -- (-387.914) [-389.678] (-388.788) (-387.622) * [-386.982] (-388.563) (-390.608) (-387.291) -- 0:00:52
37000 -- (-386.989) (-388.973) [-389.106] (-387.075) * (-388.367) (-389.066) (-387.516) [-388.932] -- 0:00:52
37500 -- (-391.423) [-388.451] (-388.140) (-388.317) * (-388.944) (-388.775) [-387.844] (-389.925) -- 0:00:51
38000 -- (-388.533) [-388.979] (-387.494) (-388.683) * (-390.262) [-386.773] (-387.516) (-389.079) -- 0:00:50
38500 -- [-387.922] (-388.724) (-388.747) (-390.707) * [-388.731] (-387.167) (-386.818) (-389.144) -- 0:00:49
39000 -- (-386.313) [-389.868] (-390.450) (-389.778) * (-389.555) (-394.597) (-386.793) [-386.811] -- 0:01:13
39500 -- (-386.939) (-390.658) (-387.438) [-387.416] * (-386.591) (-388.880) [-386.416] (-387.637) -- 0:01:12
40000 -- (-386.760) [-390.059] (-388.750) (-390.903) * (-387.209) [-390.272] (-389.572) (-388.098) -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-387.311) (-388.638) [-387.290] (-387.608) * (-387.516) (-389.826) (-389.123) [-386.121] -- 0:01:11
41000 -- (-389.225) (-387.720) (-387.017) [-387.009] * [-390.700] (-389.257) (-388.065) (-390.353) -- 0:01:10
41500 -- (-387.044) (-391.222) [-389.909] (-388.206) * (-387.405) (-388.639) (-388.041) [-388.572] -- 0:01:09
42000 -- (-386.736) [-389.962] (-388.223) (-387.311) * [-385.997] (-388.175) (-388.947) (-387.316) -- 0:01:08
42500 -- (-389.418) (-387.087) [-386.688] (-387.899) * (-391.127) (-387.545) (-389.032) [-388.584] -- 0:01:07
43000 -- (-390.666) (-389.720) [-389.314] (-387.754) * [-387.728] (-387.673) (-387.443) (-392.085) -- 0:01:06
43500 -- (-388.551) (-386.510) (-392.582) [-387.121] * (-392.099) (-387.048) [-387.787] (-387.800) -- 0:01:05
44000 -- [-387.627] (-389.379) (-392.827) (-390.446) * (-386.817) (-387.451) [-388.199] (-387.499) -- 0:01:05
44500 -- (-387.592) [-388.617] (-391.105) (-388.323) * [-387.935] (-393.806) (-388.838) (-388.228) -- 0:01:04
45000 -- (-387.109) (-386.774) [-390.813] (-388.287) * (-398.841) [-388.318] (-389.831) (-392.212) -- 0:01:03
Average standard deviation of split frequencies: 0.032607
45500 -- (-389.839) (-391.044) (-390.919) [-386.485] * (-388.010) (-388.783) (-387.962) [-388.554] -- 0:01:02
46000 -- (-389.587) (-386.884) (-390.677) [-388.901] * [-387.034] (-386.749) (-390.462) (-387.394) -- 0:01:02
46500 -- [-386.532] (-392.282) (-389.077) (-387.674) * (-387.487) (-387.107) [-387.867] (-387.933) -- 0:01:01
47000 -- (-389.930) (-389.849) (-391.028) [-389.432] * (-388.353) [-386.593] (-388.782) (-388.487) -- 0:01:00
47500 -- (-387.481) [-389.817] (-388.031) (-388.383) * [-387.384] (-387.460) (-391.608) (-387.670) -- 0:01:00
48000 -- (-386.622) [-389.751] (-390.338) (-390.777) * (-390.294) (-389.659) [-386.615] (-388.441) -- 0:00:59
48500 -- (-391.181) (-388.020) [-387.890] (-390.076) * (-387.604) (-388.330) [-389.258] (-390.086) -- 0:00:58
49000 -- (-387.687) (-389.036) (-388.836) [-388.820] * (-388.926) (-387.877) [-387.554] (-387.237) -- 0:00:58
49500 -- [-386.770] (-387.726) (-386.685) (-390.084) * (-389.249) (-389.818) [-387.003] (-390.704) -- 0:00:57
50000 -- (-387.686) (-388.615) (-387.179) [-389.252] * (-390.126) [-389.985] (-387.524) (-391.774) -- 0:00:57
Average standard deviation of split frequencies: 0.033495
50500 -- (-389.751) (-394.315) [-387.167] (-386.524) * (-388.391) (-388.355) [-386.520] (-389.903) -- 0:00:56
51000 -- (-386.224) [-387.762] (-387.476) (-394.182) * [-387.679] (-389.641) (-388.947) (-387.767) -- 0:00:55
51500 -- (-387.174) (-391.125) (-387.072) [-390.171] * [-386.957] (-390.024) (-391.142) (-390.238) -- 0:00:55
52000 -- (-387.076) (-387.916) [-388.507] (-387.285) * (-388.214) [-386.337] (-387.692) (-387.795) -- 0:00:54
52500 -- (-389.225) [-387.841] (-389.054) (-387.409) * (-386.203) [-389.786] (-388.327) (-387.243) -- 0:00:54
53000 -- [-387.437] (-388.047) (-388.081) (-388.828) * (-387.859) [-388.099] (-387.196) (-388.457) -- 0:00:53
53500 -- [-388.552] (-389.712) (-389.475) (-389.004) * (-390.466) [-389.853] (-390.365) (-388.943) -- 0:00:53
54000 -- [-389.100] (-388.641) (-388.304) (-395.539) * (-387.928) [-390.503] (-391.002) (-388.542) -- 0:00:52
54500 -- [-390.281] (-390.770) (-387.782) (-388.851) * (-387.834) [-388.150] (-395.350) (-389.009) -- 0:00:52
55000 -- (-387.128) [-387.169] (-390.154) (-387.374) * (-388.655) (-386.379) [-387.637] (-389.475) -- 0:00:51
Average standard deviation of split frequencies: 0.030866
55500 -- (-387.745) (-386.752) [-387.679] (-389.563) * (-389.069) [-386.392] (-388.346) (-388.554) -- 0:00:51
56000 -- (-388.771) (-386.964) (-387.558) [-390.152] * (-390.535) (-388.590) [-389.605] (-387.134) -- 0:01:07
56500 -- (-387.795) [-389.644] (-388.384) (-388.299) * (-388.620) (-388.638) [-389.413] (-389.123) -- 0:01:06
57000 -- [-388.289] (-390.772) (-391.063) (-389.443) * (-388.840) [-386.800] (-389.023) (-389.685) -- 0:01:06
57500 -- (-388.277) [-389.864] (-388.241) (-389.036) * (-388.363) (-387.074) [-386.868] (-389.545) -- 0:01:05
58000 -- (-387.840) (-388.438) [-389.190] (-388.902) * (-388.199) (-388.561) [-387.303] (-387.405) -- 0:01:04
58500 -- (-387.830) (-393.486) [-391.149] (-389.443) * (-386.850) [-389.175] (-386.670) (-390.051) -- 0:01:04
59000 -- [-389.170] (-395.158) (-388.146) (-389.234) * (-387.307) (-389.799) [-386.866] (-388.711) -- 0:01:03
59500 -- (-388.159) (-393.135) [-386.894] (-387.195) * [-389.223] (-390.396) (-393.098) (-386.847) -- 0:01:03
60000 -- (-386.948) (-390.746) (-388.768) [-387.858] * (-387.138) (-389.651) (-386.806) [-386.363] -- 0:01:02
Average standard deviation of split frequencies: 0.031539
60500 -- (-388.768) (-388.785) [-390.791] (-390.311) * (-386.639) (-391.379) [-390.876] (-386.263) -- 0:01:02
61000 -- (-389.134) [-387.404] (-387.301) (-387.687) * (-388.226) (-389.705) [-387.887] (-390.974) -- 0:01:01
61500 -- (-388.821) [-387.795] (-388.487) (-388.762) * (-387.363) (-391.563) [-388.037] (-390.934) -- 0:01:01
62000 -- [-389.591] (-391.613) (-392.368) (-388.026) * [-386.974] (-387.702) (-389.397) (-386.809) -- 0:01:00
62500 -- (-390.229) (-388.301) [-386.771] (-390.209) * (-386.617) [-387.537] (-388.211) (-387.299) -- 0:01:00
63000 -- (-389.126) [-387.490] (-396.987) (-389.282) * (-387.855) (-392.483) (-387.468) [-387.078] -- 0:00:59
63500 -- (-386.203) (-387.393) (-393.028) [-390.736] * (-386.277) (-392.378) [-387.875] (-386.445) -- 0:00:58
64000 -- (-386.608) (-395.353) [-389.578] (-390.769) * (-390.289) (-386.507) [-387.089] (-391.517) -- 0:00:58
64500 -- (-386.194) (-386.368) (-390.144) [-388.193] * (-389.059) (-389.997) (-387.012) [-387.161] -- 0:00:58
65000 -- (-389.564) (-386.304) [-388.214] (-386.982) * (-389.191) (-390.062) (-387.871) [-387.146] -- 0:00:57
Average standard deviation of split frequencies: 0.027818
65500 -- [-387.472] (-386.860) (-388.362) (-387.480) * (-389.097) [-389.651] (-386.709) (-388.447) -- 0:00:57
66000 -- (-387.788) (-388.027) [-387.666] (-387.150) * (-389.752) (-386.790) [-386.780] (-387.196) -- 0:00:56
66500 -- (-389.202) (-389.049) [-389.575] (-387.269) * (-389.851) [-387.616] (-388.526) (-393.085) -- 0:00:56
67000 -- (-390.625) (-390.174) (-389.297) [-387.587] * [-387.102] (-388.482) (-388.913) (-388.338) -- 0:00:55
67500 -- (-393.282) (-387.838) (-390.048) [-389.531] * [-388.531] (-388.330) (-389.133) (-389.413) -- 0:00:55
68000 -- (-389.930) [-388.909] (-389.104) (-388.610) * (-390.080) (-386.583) (-388.540) [-391.242] -- 0:00:54
68500 -- (-386.915) (-391.002) (-388.385) [-387.992] * [-391.126] (-389.936) (-387.394) (-387.579) -- 0:00:54
69000 -- (-387.324) [-393.243] (-389.450) (-392.523) * [-389.688] (-389.257) (-388.448) (-387.363) -- 0:00:53
69500 -- (-392.994) (-387.600) [-388.553] (-389.525) * [-389.211] (-388.445) (-388.499) (-390.693) -- 0:00:53
70000 -- (-388.894) [-386.705] (-386.454) (-391.692) * [-388.663] (-389.516) (-391.608) (-386.002) -- 0:00:53
Average standard deviation of split frequencies: 0.026683
70500 -- (-389.405) (-386.621) (-387.280) [-390.454] * (-389.300) (-387.860) (-390.855) [-389.151] -- 0:00:52
71000 -- (-387.612) [-388.272] (-386.672) (-392.866) * (-392.246) (-388.118) [-388.164] (-388.567) -- 0:00:52
71500 -- (-386.054) (-388.637) [-387.114] (-389.190) * (-389.433) (-390.979) [-387.944] (-391.117) -- 0:00:51
72000 -- (-387.837) [-389.623] (-389.831) (-388.211) * [-388.630] (-390.674) (-387.415) (-388.999) -- 0:00:51
72500 -- (-388.895) (-388.564) (-390.144) [-388.945] * (-391.943) (-387.369) [-386.889] (-386.934) -- 0:00:51
73000 -- (-389.363) [-387.546] (-391.517) (-388.775) * (-395.502) [-388.956] (-387.992) (-388.981) -- 0:01:03
73500 -- (-390.335) [-387.041] (-390.129) (-390.121) * [-388.814] (-389.439) (-388.793) (-389.604) -- 0:01:03
74000 -- (-388.746) (-386.816) [-388.651] (-388.316) * (-391.333) (-388.851) (-389.133) [-389.209] -- 0:01:02
74500 -- (-388.162) (-388.286) (-391.002) [-386.876] * (-389.428) (-388.505) [-389.142] (-389.274) -- 0:01:02
75000 -- (-388.061) (-395.708) [-391.864] (-387.656) * (-389.326) (-388.063) (-386.567) [-386.600] -- 0:01:01
Average standard deviation of split frequencies: 0.023178
75500 -- (-388.074) [-391.955] (-388.778) (-392.550) * (-389.183) (-390.316) [-387.304] (-389.026) -- 0:01:01
76000 -- (-390.132) (-388.870) [-389.890] (-390.656) * (-388.403) (-388.626) (-388.109) [-388.216] -- 0:01:00
76500 -- [-386.610] (-386.926) (-389.567) (-387.672) * (-388.496) (-390.043) (-387.115) [-387.208] -- 0:01:00
77000 -- (-389.896) [-386.012] (-389.075) (-388.853) * (-386.935) (-387.878) [-387.500] (-392.480) -- 0:00:59
77500 -- [-388.399] (-387.430) (-387.442) (-395.435) * (-389.508) (-387.402) (-387.253) [-391.536] -- 0:00:59
78000 -- (-388.607) [-386.771] (-387.569) (-391.708) * (-388.004) (-388.035) (-393.217) [-387.208] -- 0:00:59
78500 -- [-386.772] (-387.509) (-388.138) (-388.059) * (-389.715) (-391.093) (-388.862) [-391.191] -- 0:00:58
79000 -- (-386.008) [-387.284] (-386.728) (-389.007) * [-388.203] (-391.991) (-389.136) (-387.254) -- 0:00:58
79500 -- [-386.017] (-388.125) (-389.743) (-391.435) * (-387.610) [-395.395] (-386.951) (-391.645) -- 0:00:57
80000 -- (-389.198) (-389.649) (-388.676) [-386.578] * (-388.306) (-386.631) (-386.741) [-389.197] -- 0:00:57
Average standard deviation of split frequencies: 0.023375
80500 -- [-387.148] (-386.646) (-388.979) (-387.394) * (-387.249) (-388.061) [-388.095] (-387.361) -- 0:00:57
81000 -- (-387.637) (-391.359) (-386.925) [-387.194] * (-386.758) (-388.018) [-386.599] (-390.389) -- 0:00:56
81500 -- (-386.620) (-387.191) (-387.881) [-388.799] * (-386.328) [-387.368] (-391.540) (-390.066) -- 0:00:56
82000 -- [-387.997] (-386.018) (-387.904) (-388.400) * (-387.890) (-388.347) [-392.697] (-391.551) -- 0:00:55
82500 -- [-387.068] (-386.160) (-390.795) (-388.141) * [-387.382] (-388.907) (-392.036) (-389.748) -- 0:00:55
83000 -- (-388.018) [-390.097] (-388.167) (-391.748) * (-388.021) (-389.520) (-394.295) [-389.122] -- 0:00:55
83500 -- (-389.802) [-387.053] (-390.602) (-390.325) * (-387.980) (-390.638) (-391.099) [-390.713] -- 0:00:54
84000 -- (-386.689) (-390.531) (-392.502) [-388.792] * [-386.748] (-388.531) (-387.748) (-389.926) -- 0:00:54
84500 -- [-393.250] (-386.870) (-394.820) (-392.452) * [-388.201] (-388.512) (-389.070) (-388.352) -- 0:00:54
85000 -- (-387.198) [-386.917] (-392.083) (-389.751) * (-388.982) (-389.575) (-388.352) [-388.486] -- 0:00:53
Average standard deviation of split frequencies: 0.024667
85500 -- [-388.635] (-386.753) (-388.609) (-392.477) * (-388.776) [-388.336] (-387.161) (-386.786) -- 0:00:53
86000 -- (-387.683) [-386.634] (-388.391) (-387.997) * (-386.914) [-387.307] (-388.454) (-388.659) -- 0:00:53
86500 -- [-388.884] (-387.382) (-387.011) (-389.393) * [-386.403] (-388.737) (-388.737) (-388.731) -- 0:00:52
87000 -- (-387.336) [-389.561] (-386.569) (-395.825) * (-386.215) (-387.576) [-388.105] (-390.329) -- 0:00:52
87500 -- (-391.091) (-388.519) [-387.719] (-395.668) * (-387.742) [-389.131] (-392.739) (-386.782) -- 0:00:52
88000 -- (-387.266) (-388.258) (-392.003) [-389.887] * [-387.033] (-390.380) (-386.380) (-390.437) -- 0:00:51
88500 -- [-388.691] (-389.240) (-388.729) (-386.694) * (-387.325) (-387.063) [-387.332] (-388.737) -- 0:00:51
89000 -- (-388.228) (-387.613) [-391.507] (-388.626) * (-395.953) (-387.507) (-388.441) [-388.764] -- 0:00:51
89500 -- (-388.370) [-387.302] (-386.341) (-390.158) * (-389.086) (-390.679) [-389.706] (-386.658) -- 0:01:01
90000 -- [-387.486] (-390.676) (-387.320) (-389.896) * (-387.908) [-391.821] (-387.149) (-387.554) -- 0:01:00
Average standard deviation of split frequencies: 0.023137
90500 -- (-389.308) [-389.235] (-388.506) (-388.021) * [-389.784] (-389.654) (-386.455) (-388.653) -- 0:01:00
91000 -- [-388.823] (-390.965) (-389.147) (-387.437) * [-387.428] (-387.037) (-387.768) (-388.031) -- 0:00:59
91500 -- (-390.599) [-391.022] (-386.932) (-388.326) * (-389.847) [-393.307] (-387.519) (-390.563) -- 0:00:59
92000 -- (-390.201) (-388.117) [-388.920] (-388.356) * [-387.549] (-391.632) (-388.128) (-389.316) -- 0:00:59
92500 -- (-390.906) (-387.272) [-386.193] (-391.408) * (-386.600) [-387.268] (-388.338) (-388.750) -- 0:00:58
93000 -- (-389.304) [-388.135] (-388.721) (-388.144) * (-386.074) (-390.407) [-387.049] (-386.544) -- 0:00:58
93500 -- (-389.726) [-388.765] (-388.960) (-387.831) * (-390.824) (-389.375) (-386.728) [-387.358] -- 0:00:58
94000 -- (-390.228) (-388.270) [-388.088] (-387.242) * [-388.822] (-389.219) (-388.396) (-390.437) -- 0:00:57
94500 -- (-389.588) (-388.664) (-388.011) [-387.262] * (-391.351) [-388.576] (-389.676) (-389.168) -- 0:00:57
95000 -- (-388.041) (-388.587) (-387.045) [-387.646] * (-392.131) [-391.643] (-391.849) (-388.691) -- 0:00:57
Average standard deviation of split frequencies: 0.018005
95500 -- [-389.444] (-386.634) (-387.979) (-390.556) * (-389.772) (-390.222) [-390.190] (-386.824) -- 0:00:56
96000 -- (-391.029) (-386.546) (-390.049) [-388.569] * (-396.796) [-387.149] (-388.357) (-392.213) -- 0:00:56
96500 -- (-386.497) (-389.504) [-386.496] (-387.861) * [-387.667] (-388.555) (-390.076) (-395.068) -- 0:00:56
97000 -- (-388.871) (-387.883) (-388.430) [-388.253] * (-390.143) (-386.581) (-389.477) [-387.420] -- 0:00:55
97500 -- (-388.150) [-389.066] (-387.991) (-386.616) * (-390.969) (-387.106) [-389.512] (-391.073) -- 0:00:55
98000 -- (-389.722) [-386.457] (-386.987) (-389.189) * [-389.830] (-390.694) (-387.820) (-389.199) -- 0:00:55
98500 -- (-391.626) (-389.521) (-387.949) [-389.289] * (-386.981) (-388.955) (-386.287) [-390.296] -- 0:00:54
99000 -- (-386.593) [-386.375] (-388.950) (-390.122) * [-388.321] (-389.481) (-390.990) (-387.869) -- 0:00:54
99500 -- (-387.327) [-388.570] (-387.521) (-392.750) * (-392.874) [-386.520] (-389.809) (-387.534) -- 0:00:54
100000 -- (-389.344) [-387.789] (-389.868) (-390.612) * (-389.952) (-388.376) [-388.068] (-392.881) -- 0:00:54
Average standard deviation of split frequencies: 0.017691
100500 -- [-389.417] (-387.218) (-387.966) (-386.591) * (-390.980) [-386.938] (-391.427) (-390.477) -- 0:00:53
101000 -- [-388.009] (-387.461) (-386.921) (-386.670) * (-389.006) [-393.715] (-387.905) (-388.723) -- 0:00:53
101500 -- (-386.724) (-387.902) [-386.548] (-390.930) * (-388.739) (-396.512) [-388.271] (-393.408) -- 0:00:53
102000 -- [-386.200] (-388.626) (-390.143) (-388.182) * (-388.910) [-389.771] (-387.149) (-391.175) -- 0:00:52
102500 -- (-390.216) (-387.404) (-390.093) [-387.664] * (-388.998) [-386.788] (-389.293) (-387.033) -- 0:00:52
103000 -- (-388.748) [-387.249] (-387.421) (-386.984) * (-392.981) [-389.206] (-389.835) (-389.218) -- 0:00:52
103500 -- (-390.240) (-387.634) [-387.543] (-388.151) * (-387.829) (-388.378) [-388.655] (-388.721) -- 0:00:51
104000 -- (-390.235) (-392.461) [-389.348] (-386.635) * (-387.149) (-387.703) (-389.315) [-392.069] -- 0:00:51
104500 -- (-391.461) (-391.296) [-387.772] (-390.779) * (-387.920) (-390.692) [-390.390] (-387.200) -- 0:00:51
105000 -- (-387.804) (-387.252) (-386.383) [-389.785] * [-386.946] (-387.275) (-388.868) (-389.837) -- 0:00:51
Average standard deviation of split frequencies: 0.017048
105500 -- (-387.557) [-386.497] (-389.885) (-388.467) * (-387.849) (-388.156) [-386.924] (-387.654) -- 0:00:50
106000 -- (-386.815) [-392.036] (-388.836) (-389.495) * (-389.054) (-388.167) [-386.223] (-390.534) -- 0:00:50
106500 -- (-387.443) (-388.335) [-389.841] (-392.236) * (-387.335) [-389.730] (-386.505) (-393.545) -- 0:00:58
107000 -- (-386.372) [-391.763] (-387.072) (-388.902) * (-388.936) (-392.181) (-387.361) [-387.528] -- 0:00:58
107500 -- (-389.509) (-391.191) (-387.368) [-388.435] * [-389.679] (-389.341) (-387.083) (-389.553) -- 0:00:58
108000 -- (-388.557) [-389.060] (-389.827) (-391.386) * (-387.459) (-387.086) [-385.988] (-387.844) -- 0:00:57
108500 -- (-391.208) (-388.464) (-390.661) [-390.691] * [-388.539] (-389.103) (-386.855) (-389.289) -- 0:00:57
109000 -- [-388.479] (-388.472) (-389.599) (-388.288) * (-387.171) [-388.214] (-390.216) (-390.157) -- 0:00:57
109500 -- (-396.209) (-388.770) (-389.346) [-386.766] * [-391.284] (-390.338) (-388.170) (-387.885) -- 0:00:56
110000 -- (-391.536) [-387.442] (-387.593) (-393.863) * [-388.740] (-390.317) (-388.359) (-388.163) -- 0:00:56
Average standard deviation of split frequencies: 0.021074
110500 -- [-389.489] (-386.790) (-387.401) (-387.402) * (-387.517) (-389.936) (-390.698) [-388.351] -- 0:00:56
111000 -- (-390.543) (-387.063) (-387.831) [-387.429] * (-388.033) [-389.094] (-387.874) (-386.696) -- 0:00:56
111500 -- [-386.252] (-389.728) (-386.765) (-390.202) * (-386.161) (-391.410) [-389.221] (-388.193) -- 0:00:55
112000 -- [-387.589] (-388.997) (-387.188) (-391.770) * (-386.183) (-390.438) (-387.027) [-387.992] -- 0:00:55
112500 -- (-388.534) [-387.303] (-390.538) (-388.306) * (-388.269) (-387.206) [-387.665] (-389.965) -- 0:00:55
113000 -- (-390.204) (-386.998) (-390.149) [-386.539] * (-390.034) (-386.182) [-391.537] (-386.768) -- 0:00:54
113500 -- (-390.951) (-390.903) [-387.953] (-387.130) * (-387.131) (-389.889) (-391.927) [-386.612] -- 0:00:54
114000 -- [-387.818] (-391.810) (-389.619) (-391.652) * (-388.514) (-387.734) [-390.483] (-388.069) -- 0:00:54
114500 -- (-387.063) (-393.561) [-390.221] (-389.405) * [-389.438] (-389.790) (-394.700) (-389.411) -- 0:00:54
115000 -- [-386.623] (-393.043) (-389.239) (-387.850) * (-388.711) (-389.067) [-389.528] (-388.412) -- 0:00:53
Average standard deviation of split frequencies: 0.019678
115500 -- (-390.766) (-388.348) (-388.589) [-388.922] * (-388.803) (-387.778) (-388.618) [-387.502] -- 0:00:53
116000 -- (-391.281) (-388.555) (-387.374) [-391.909] * (-387.219) (-389.353) (-387.929) [-388.324] -- 0:00:53
116500 -- (-388.462) (-391.899) [-390.836] (-392.912) * (-386.482) (-391.455) [-391.282] (-389.372) -- 0:00:53
117000 -- [-388.261] (-392.220) (-388.522) (-387.616) * (-387.421) (-386.233) [-391.245] (-389.579) -- 0:00:52
117500 -- [-389.268] (-390.516) (-392.272) (-392.349) * (-389.322) [-387.026] (-387.625) (-387.714) -- 0:00:52
118000 -- [-388.849] (-390.622) (-389.684) (-400.187) * (-387.042) (-388.911) (-389.503) [-387.477] -- 0:00:52
118500 -- (-389.070) [-387.368] (-390.929) (-391.074) * (-391.532) (-386.878) (-389.523) [-386.692] -- 0:00:52
119000 -- (-387.063) (-387.145) (-389.391) [-386.418] * (-387.067) (-386.918) (-388.864) [-388.740] -- 0:00:51
119500 -- [-386.547] (-387.595) (-394.072) (-386.959) * (-387.097) (-387.479) (-394.015) [-388.042] -- 0:00:51
120000 -- [-387.596] (-389.881) (-394.528) (-391.889) * (-387.428) (-388.257) (-386.686) [-390.386] -- 0:00:51
Average standard deviation of split frequencies: 0.021682
120500 -- [-387.901] (-390.224) (-395.394) (-392.388) * (-386.687) [-388.805] (-389.007) (-389.484) -- 0:00:51
121000 -- (-388.227) [-387.452] (-388.553) (-390.240) * (-386.846) [-390.072] (-387.980) (-387.493) -- 0:00:50
121500 -- (-390.786) (-386.908) [-388.773] (-390.154) * [-387.391] (-389.954) (-387.582) (-388.900) -- 0:00:50
122000 -- (-387.810) (-391.382) [-390.263] (-387.827) * (-388.613) (-387.697) (-387.598) [-390.643] -- 0:00:50
122500 -- [-387.571] (-388.829) (-387.665) (-390.782) * (-388.171) (-390.013) (-392.550) [-389.299] -- 0:00:50
123000 -- [-387.107] (-390.106) (-389.216) (-394.828) * (-387.410) (-390.414) (-387.941) [-387.206] -- 0:00:49
123500 -- (-387.539) (-389.919) (-387.426) [-388.508] * [-386.377] (-391.277) (-387.543) (-389.250) -- 0:00:56
124000 -- [-387.806] (-391.454) (-390.715) (-387.718) * (-387.887) (-388.483) (-387.734) [-390.515] -- 0:00:56
124500 -- (-388.079) (-390.731) (-390.539) [-388.459] * (-388.492) (-386.866) [-392.820] (-388.620) -- 0:00:56
125000 -- (-386.081) (-389.375) (-389.062) [-390.638] * (-391.926) (-387.028) (-388.787) [-390.097] -- 0:00:56
Average standard deviation of split frequencies: 0.020951
125500 -- (-389.421) (-391.728) (-388.108) [-388.364] * (-387.045) (-388.757) [-387.963] (-387.036) -- 0:00:55
126000 -- [-387.752] (-390.819) (-387.518) (-390.381) * (-388.734) (-387.892) [-386.424] (-388.080) -- 0:00:55
126500 -- [-387.618] (-386.574) (-387.335) (-393.136) * [-388.921] (-387.859) (-389.811) (-389.792) -- 0:00:55
127000 -- (-386.939) (-386.858) (-387.208) [-387.663] * (-391.378) [-390.954] (-389.047) (-386.825) -- 0:00:54
127500 -- [-389.138] (-387.464) (-387.321) (-387.837) * (-390.168) (-394.469) (-387.332) [-390.104] -- 0:00:54
128000 -- (-390.017) [-388.796] (-387.207) (-388.839) * [-388.476] (-392.238) (-391.581) (-392.761) -- 0:00:54
128500 -- (-391.876) (-386.608) (-389.280) [-386.984] * [-389.223] (-390.288) (-391.539) (-386.878) -- 0:00:54
129000 -- (-390.378) [-387.763] (-392.859) (-387.117) * (-391.486) (-388.819) [-388.414] (-388.948) -- 0:00:54
129500 -- (-392.317) [-387.609] (-391.066) (-387.815) * [-387.948] (-388.146) (-388.418) (-390.057) -- 0:00:53
130000 -- (-390.073) [-386.171] (-389.210) (-387.892) * (-392.560) (-392.529) (-387.559) [-390.296] -- 0:00:53
Average standard deviation of split frequencies: 0.020023
130500 -- (-390.595) [-390.757] (-390.156) (-388.572) * (-391.033) [-388.321] (-392.193) (-387.942) -- 0:00:53
131000 -- (-387.516) (-388.263) [-388.494] (-389.324) * (-393.210) (-388.405) [-387.768] (-386.844) -- 0:00:53
131500 -- (-389.150) (-386.587) (-387.612) [-386.417] * (-389.820) (-393.507) [-390.319] (-389.148) -- 0:00:52
132000 -- [-388.845] (-390.027) (-388.118) (-390.127) * [-388.721] (-388.495) (-389.463) (-392.367) -- 0:00:52
132500 -- (-387.648) [-387.144] (-387.433) (-390.468) * (-393.719) (-389.566) (-387.929) [-387.981] -- 0:00:52
133000 -- [-388.469] (-386.406) (-387.543) (-389.458) * (-391.073) (-390.381) [-390.491] (-387.478) -- 0:00:52
133500 -- (-391.532) [-387.395] (-387.762) (-390.540) * (-390.684) [-386.926] (-395.195) (-389.042) -- 0:00:51
134000 -- [-388.338] (-390.902) (-389.085) (-390.038) * (-393.988) [-386.430] (-391.108) (-389.660) -- 0:00:51
134500 -- [-387.887] (-388.700) (-387.213) (-390.235) * (-390.569) [-393.127] (-391.542) (-387.136) -- 0:00:51
135000 -- (-386.829) (-387.808) (-391.300) [-388.849] * (-387.590) (-387.539) (-389.380) [-387.930] -- 0:00:51
Average standard deviation of split frequencies: 0.021345
135500 -- (-393.392) (-390.961) [-388.753] (-387.573) * [-387.880] (-386.269) (-392.366) (-391.855) -- 0:00:51
136000 -- [-386.226] (-387.741) (-391.453) (-388.646) * (-388.795) [-387.447] (-392.644) (-391.758) -- 0:00:50
136500 -- (-386.848) (-387.196) [-391.036] (-388.642) * [-388.212] (-388.084) (-396.856) (-386.916) -- 0:00:50
137000 -- (-387.325) (-391.258) (-391.175) [-391.248] * (-390.708) (-388.806) (-388.854) [-387.945] -- 0:00:50
137500 -- (-388.785) (-389.199) [-389.347] (-390.719) * (-388.987) [-387.690] (-388.377) (-387.080) -- 0:00:50
138000 -- (-390.392) (-393.547) (-386.340) [-391.310] * [-388.250] (-388.302) (-389.112) (-387.455) -- 0:00:49
138500 -- (-387.759) (-386.870) [-387.156] (-393.616) * (-393.622) (-386.734) (-390.835) [-388.021] -- 0:00:49
139000 -- (-387.264) (-390.991) (-387.282) [-390.093] * (-388.244) (-389.226) [-388.078] (-389.684) -- 0:00:49
139500 -- (-386.759) [-386.696] (-386.658) (-391.102) * (-388.813) (-386.850) [-388.857] (-386.973) -- 0:00:49
140000 -- (-387.847) (-388.914) (-388.209) [-390.778] * (-386.473) (-389.210) [-387.501] (-386.279) -- 0:00:55
Average standard deviation of split frequencies: 0.020636
140500 -- (-394.370) (-389.938) (-387.876) [-388.156] * (-388.661) (-394.048) [-388.905] (-387.223) -- 0:00:55
141000 -- [-388.993] (-387.571) (-386.603) (-390.834) * (-386.753) (-387.205) [-390.026] (-391.776) -- 0:00:54
141500 -- (-390.421) [-387.645] (-388.213) (-389.859) * [-387.557] (-387.374) (-386.775) (-386.702) -- 0:00:54
142000 -- (-388.381) (-386.799) [-388.875] (-393.844) * (-386.812) [-387.681] (-387.882) (-387.508) -- 0:00:54
142500 -- (-387.044) (-386.079) [-387.921] (-391.828) * (-388.058) [-388.517] (-387.059) (-388.740) -- 0:00:54
143000 -- (-386.414) [-387.585] (-388.353) (-387.137) * (-386.869) [-390.001] (-387.881) (-393.825) -- 0:00:53
143500 -- (-387.013) (-389.009) [-393.324] (-389.545) * (-389.978) [-386.382] (-388.525) (-389.932) -- 0:00:53
144000 -- (-387.185) (-388.790) [-389.100] (-389.914) * (-387.602) (-387.126) (-388.914) [-392.020] -- 0:00:53
144500 -- (-386.993) (-389.231) [-388.522] (-389.703) * (-389.446) (-387.976) (-388.232) [-386.469] -- 0:00:53
145000 -- [-388.377] (-390.396) (-387.253) (-387.664) * (-388.316) (-390.416) [-386.239] (-387.911) -- 0:00:53
Average standard deviation of split frequencies: 0.019203
145500 -- (-392.115) (-386.611) [-390.061] (-388.223) * (-387.131) (-388.263) [-387.819] (-389.573) -- 0:00:52
146000 -- (-386.291) (-387.704) [-388.996] (-386.133) * (-390.335) [-386.757] (-388.728) (-388.915) -- 0:00:52
146500 -- (-386.361) [-389.101] (-387.312) (-386.746) * (-389.365) [-387.673] (-386.237) (-386.823) -- 0:00:52
147000 -- (-387.010) (-387.622) [-386.846] (-390.435) * (-387.728) (-392.121) [-386.773] (-389.205) -- 0:00:52
147500 -- (-388.698) (-387.355) [-386.760] (-390.813) * (-391.900) (-389.948) (-386.853) [-388.302] -- 0:00:52
148000 -- [-388.215] (-391.373) (-387.298) (-389.095) * (-387.383) (-388.152) [-387.141] (-388.099) -- 0:00:51
148500 -- (-388.106) (-390.898) [-386.052] (-388.915) * (-387.000) (-391.159) [-387.334] (-386.552) -- 0:00:51
149000 -- [-386.733] (-388.894) (-386.943) (-394.002) * [-387.488] (-388.344) (-390.515) (-388.381) -- 0:00:51
149500 -- (-389.578) (-390.704) [-387.474] (-395.736) * (-396.886) (-387.647) [-390.853] (-390.126) -- 0:00:51
150000 -- (-389.629) (-386.897) (-387.841) [-389.553] * (-392.842) (-388.224) (-387.373) [-388.900] -- 0:00:51
Average standard deviation of split frequencies: 0.018773
150500 -- (-388.525) (-389.072) (-390.187) [-388.359] * (-389.906) [-386.964] (-388.902) (-387.955) -- 0:00:50
151000 -- (-387.435) (-387.547) (-387.536) [-387.288] * (-387.392) (-389.082) (-390.552) [-390.175] -- 0:00:50
151500 -- (-388.333) [-386.803] (-387.802) (-390.335) * (-389.649) (-389.187) [-389.352] (-386.353) -- 0:00:50
152000 -- (-389.212) (-395.623) [-389.919] (-388.039) * (-390.381) (-388.553) (-391.464) [-386.756] -- 0:00:50
152500 -- (-389.744) (-390.193) [-388.086] (-391.072) * [-386.458] (-391.901) (-387.552) (-389.253) -- 0:00:50
153000 -- (-388.189) (-388.739) [-387.067] (-388.265) * (-386.568) (-389.640) [-387.342] (-391.027) -- 0:00:49
153500 -- (-388.180) [-388.881] (-388.300) (-391.181) * [-386.366] (-390.112) (-390.187) (-387.567) -- 0:00:49
154000 -- (-388.732) [-389.865] (-392.364) (-390.188) * (-390.270) [-388.926] (-387.618) (-387.908) -- 0:00:49
154500 -- [-386.525] (-393.134) (-388.265) (-390.428) * (-387.068) [-386.368] (-387.520) (-387.269) -- 0:00:49
155000 -- [-387.578] (-389.630) (-387.984) (-390.114) * (-390.001) [-386.627] (-389.599) (-388.204) -- 0:00:49
Average standard deviation of split frequencies: 0.020313
155500 -- (-389.677) (-389.742) (-386.928) [-389.866] * (-387.855) (-394.405) [-388.260] (-387.797) -- 0:00:48
156000 -- [-386.627] (-389.505) (-387.265) (-387.024) * [-389.071] (-389.462) (-386.805) (-390.220) -- 0:00:48
156500 -- (-388.647) (-387.452) (-390.202) [-391.016] * (-387.151) (-387.547) [-387.865] (-387.629) -- 0:00:48
157000 -- (-387.938) [-387.052] (-389.861) (-392.149) * (-386.842) (-385.975) (-389.349) [-386.800] -- 0:00:53
157500 -- (-390.586) (-389.551) (-391.558) [-392.131] * (-389.852) (-387.840) [-387.279] (-387.726) -- 0:00:53
158000 -- (-388.235) [-386.184] (-387.874) (-389.232) * (-390.081) (-389.592) [-388.213] (-396.984) -- 0:00:53
158500 -- (-391.630) (-389.107) [-387.349] (-392.814) * [-388.969] (-389.109) (-386.967) (-392.998) -- 0:00:53
159000 -- (-387.292) (-389.017) [-387.017] (-386.913) * (-389.588) (-386.567) [-387.982] (-386.212) -- 0:00:52
159500 -- [-388.213] (-386.113) (-388.036) (-392.718) * (-389.907) (-386.773) (-386.822) [-388.103] -- 0:00:52
160000 -- (-392.285) [-390.003] (-387.593) (-388.543) * (-389.426) (-390.145) (-386.609) [-387.141] -- 0:00:52
Average standard deviation of split frequencies: 0.020538
160500 -- (-391.283) [-388.562] (-388.718) (-389.217) * [-388.902] (-387.389) (-388.492) (-386.962) -- 0:00:52
161000 -- (-388.763) (-387.576) [-387.429] (-392.218) * [-386.776] (-388.847) (-390.731) (-390.128) -- 0:00:52
161500 -- (-386.202) [-387.744] (-387.192) (-392.340) * [-388.807] (-387.769) (-391.728) (-386.369) -- 0:00:51
162000 -- [-386.872] (-388.779) (-389.065) (-387.781) * (-387.045) (-390.350) [-389.600] (-388.104) -- 0:00:51
162500 -- (-388.150) [-386.661] (-389.113) (-386.852) * [-389.133] (-388.140) (-389.045) (-388.063) -- 0:00:51
163000 -- (-389.111) [-386.870] (-387.356) (-391.304) * [-387.720] (-388.893) (-387.992) (-387.063) -- 0:00:51
163500 -- (-389.954) (-387.759) (-387.186) [-390.044] * (-386.351) (-388.325) [-387.512] (-388.830) -- 0:00:51
164000 -- (-386.936) [-387.879] (-388.410) (-388.563) * (-387.666) [-389.570] (-389.131) (-390.594) -- 0:00:50
164500 -- [-387.045] (-388.369) (-394.963) (-389.334) * (-386.700) [-386.439] (-391.567) (-388.060) -- 0:00:50
165000 -- (-388.995) (-388.538) [-394.205] (-388.544) * (-388.183) (-388.475) (-387.324) [-386.591] -- 0:00:50
Average standard deviation of split frequencies: 0.020327
165500 -- (-392.099) (-387.205) (-388.036) [-388.396] * (-389.871) (-390.833) [-387.081] (-386.645) -- 0:00:50
166000 -- (-387.410) [-386.308] (-391.762) (-388.059) * (-388.821) (-387.032) (-389.678) [-389.854] -- 0:00:50
166500 -- (-390.608) [-387.578] (-398.963) (-387.057) * [-388.927] (-386.167) (-389.358) (-387.299) -- 0:00:50
167000 -- [-390.350] (-392.390) (-388.462) (-387.601) * (-391.310) (-390.266) (-388.311) [-390.480] -- 0:00:49
167500 -- [-387.571] (-387.909) (-387.038) (-391.241) * [-388.999] (-389.908) (-390.752) (-389.419) -- 0:00:49
168000 -- (-388.425) (-386.639) (-387.655) [-390.380] * (-386.651) [-390.503] (-390.604) (-386.934) -- 0:00:49
168500 -- (-388.292) (-389.129) (-388.662) [-388.904] * (-387.108) [-388.105] (-389.031) (-387.005) -- 0:00:49
169000 -- [-388.142] (-387.432) (-388.658) (-391.993) * (-386.462) [-388.892] (-387.522) (-388.970) -- 0:00:49
169500 -- (-390.662) [-387.793] (-387.068) (-387.332) * (-388.201) [-387.213] (-387.348) (-389.236) -- 0:00:48
170000 -- [-388.624] (-388.818) (-386.566) (-387.420) * (-389.026) [-388.425] (-389.260) (-387.001) -- 0:00:48
Average standard deviation of split frequencies: 0.019488
170500 -- (-388.666) [-390.519] (-388.490) (-386.545) * (-389.103) (-389.631) [-390.665] (-386.967) -- 0:00:48
171000 -- (-389.808) (-387.445) (-386.850) [-387.570] * (-387.352) [-387.808] (-387.353) (-388.968) -- 0:00:48
171500 -- (-390.284) [-388.867] (-387.332) (-388.169) * (-389.430) [-391.054] (-388.582) (-387.173) -- 0:00:48
172000 -- [-391.941] (-388.101) (-390.920) (-389.388) * (-387.303) [-388.182] (-388.238) (-392.387) -- 0:00:48
172500 -- [-386.739] (-390.147) (-396.502) (-388.606) * (-389.710) (-387.571) [-387.242] (-390.593) -- 0:00:47
173000 -- (-388.779) (-388.031) (-390.717) [-389.533] * (-387.190) [-386.791] (-387.312) (-387.178) -- 0:00:47
173500 -- (-387.691) [-388.762] (-388.670) (-390.182) * (-387.680) [-388.717] (-390.159) (-388.589) -- 0:00:47
174000 -- (-388.853) (-386.750) (-390.374) [-386.833] * (-389.131) [-386.779] (-386.723) (-388.008) -- 0:00:52
174500 -- (-389.673) (-389.499) (-389.582) [-386.509] * (-389.741) [-389.170] (-387.833) (-393.837) -- 0:00:52
175000 -- (-386.829) (-386.845) (-389.344) [-390.620] * [-389.602] (-391.295) (-386.631) (-391.386) -- 0:00:51
Average standard deviation of split frequencies: 0.018044
175500 -- (-387.574) (-387.074) (-389.078) [-390.162] * [-388.927] (-393.584) (-387.494) (-390.381) -- 0:00:51
176000 -- (-387.813) [-389.631] (-386.076) (-389.742) * (-386.450) (-393.267) (-397.409) [-387.016] -- 0:00:51
176500 -- [-386.349] (-392.890) (-386.733) (-389.197) * (-391.798) [-388.428] (-389.863) (-389.810) -- 0:00:51
177000 -- (-389.298) [-387.044] (-387.140) (-392.939) * (-387.880) (-389.179) [-387.935] (-387.046) -- 0:00:51
177500 -- (-388.627) (-388.195) [-386.235] (-388.013) * (-388.147) (-390.940) [-387.507] (-388.794) -- 0:00:50
178000 -- (-388.456) [-386.659] (-390.088) (-387.714) * (-393.584) (-389.090) [-387.576] (-387.494) -- 0:00:50
178500 -- (-390.515) [-389.368] (-388.743) (-388.818) * [-387.283] (-389.615) (-387.864) (-390.836) -- 0:00:50
179000 -- (-387.310) (-387.383) [-390.912] (-387.781) * (-387.822) (-387.820) (-389.358) [-386.743] -- 0:00:50
179500 -- [-387.863] (-390.575) (-387.468) (-387.046) * (-386.140) (-390.303) [-387.612] (-387.948) -- 0:00:50
180000 -- (-387.949) (-390.497) (-388.713) [-386.096] * (-387.182) (-388.559) (-390.722) [-387.322] -- 0:00:50
Average standard deviation of split frequencies: 0.017344
180500 -- (-388.683) (-393.196) (-388.852) [-387.992] * (-393.422) (-388.701) [-387.270] (-389.647) -- 0:00:49
181000 -- (-387.713) (-394.543) (-389.314) [-391.480] * (-390.454) (-387.021) [-387.643] (-386.350) -- 0:00:49
181500 -- (-389.756) [-388.089] (-390.739) (-389.228) * [-386.893] (-387.288) (-386.610) (-387.209) -- 0:00:49
182000 -- [-387.281] (-388.810) (-388.111) (-391.277) * (-386.720) (-387.921) (-387.479) [-388.123] -- 0:00:49
182500 -- (-389.382) (-386.706) [-387.427] (-386.405) * (-387.175) (-387.148) [-388.157] (-386.572) -- 0:00:49
183000 -- (-393.920) (-387.874) (-388.269) [-386.908] * (-391.261) (-389.078) (-389.484) [-389.295] -- 0:00:49
183500 -- [-388.491] (-389.704) (-389.002) (-387.483) * (-390.672) (-392.836) (-387.293) [-390.653] -- 0:00:48
184000 -- (-386.835) [-391.519] (-389.997) (-388.808) * [-392.127] (-388.183) (-388.386) (-390.168) -- 0:00:48
184500 -- (-388.289) (-387.365) [-388.958] (-389.638) * (-387.592) (-387.894) [-386.135] (-390.792) -- 0:00:48
185000 -- [-386.644] (-387.578) (-389.689) (-391.648) * (-392.844) (-388.194) (-389.238) [-388.433] -- 0:00:48
Average standard deviation of split frequencies: 0.016407
185500 -- [-387.477] (-388.331) (-387.058) (-388.506) * (-392.514) [-386.248] (-389.073) (-390.296) -- 0:00:48
186000 -- (-386.735) (-387.900) [-387.319] (-391.540) * (-387.515) [-386.687] (-386.647) (-389.160) -- 0:00:48
186500 -- (-392.165) (-387.652) [-386.774] (-388.633) * (-387.525) (-389.459) [-387.560] (-387.095) -- 0:00:47
187000 -- (-391.853) (-390.053) (-388.277) [-388.196] * (-388.822) [-387.159] (-389.084) (-386.742) -- 0:00:47
187500 -- [-387.341] (-395.969) (-391.927) (-389.224) * (-391.913) (-387.862) [-387.740] (-386.807) -- 0:00:47
188000 -- (-387.424) (-386.912) [-388.026] (-389.731) * (-385.996) (-387.378) (-388.730) [-387.291] -- 0:00:47
188500 -- [-387.049] (-387.877) (-388.881) (-388.579) * (-385.996) [-387.484] (-386.240) (-387.486) -- 0:00:47
189000 -- (-393.862) (-387.716) (-389.569) [-388.277] * [-387.951] (-388.322) (-389.998) (-391.386) -- 0:00:47
189500 -- [-389.605] (-389.348) (-389.506) (-388.808) * (-393.592) [-388.734] (-389.032) (-390.144) -- 0:00:47
190000 -- [-388.101] (-389.283) (-390.805) (-388.129) * (-388.306) (-389.811) (-390.128) [-386.453] -- 0:00:46
Average standard deviation of split frequencies: 0.015933
190500 -- (-388.614) (-389.716) (-387.357) [-388.733] * (-387.660) (-388.590) [-387.525] (-388.206) -- 0:00:46
191000 -- [-387.041] (-393.375) (-389.103) (-387.955) * [-387.528] (-394.740) (-386.275) (-387.760) -- 0:00:50
191500 -- (-387.168) (-386.663) [-389.503] (-388.469) * (-389.622) [-388.974] (-388.164) (-388.735) -- 0:00:50
192000 -- [-388.533] (-387.888) (-386.584) (-388.264) * (-387.252) [-387.252] (-389.338) (-391.896) -- 0:00:50
192500 -- [-391.444] (-388.683) (-389.088) (-386.329) * [-387.626] (-389.164) (-388.402) (-389.841) -- 0:00:50
193000 -- (-390.081) (-388.331) [-392.256] (-387.845) * [-387.139] (-387.992) (-387.731) (-388.262) -- 0:00:50
193500 -- [-392.121] (-388.805) (-389.833) (-386.758) * [-388.378] (-390.534) (-389.774) (-389.093) -- 0:00:50
194000 -- (-391.244) (-390.132) (-390.956) [-389.279] * [-387.854] (-387.884) (-387.501) (-388.201) -- 0:00:49
194500 -- (-389.354) [-389.653] (-386.524) (-390.152) * (-389.652) (-386.579) [-386.620] (-389.151) -- 0:00:49
195000 -- (-386.315) (-386.828) (-389.295) [-387.801] * (-391.745) (-389.339) (-390.499) [-389.682] -- 0:00:49
Average standard deviation of split frequencies: 0.016034
195500 -- (-389.668) [-386.974] (-387.426) (-387.820) * (-389.666) (-387.621) (-392.919) [-387.282] -- 0:00:49
196000 -- (-389.189) (-388.269) (-387.883) [-389.419] * [-387.466] (-388.029) (-387.152) (-390.253) -- 0:00:49
196500 -- (-390.031) [-391.552] (-386.389) (-390.682) * (-390.512) (-388.527) (-392.167) [-387.491] -- 0:00:49
197000 -- (-389.476) (-388.030) [-387.775] (-393.509) * (-395.896) (-388.822) [-386.959] (-392.316) -- 0:00:48
197500 -- (-387.695) [-387.396] (-387.394) (-391.186) * [-388.743] (-388.961) (-386.517) (-388.385) -- 0:00:48
198000 -- (-387.555) [-388.227] (-387.509) (-387.255) * (-387.489) (-388.484) [-386.921] (-389.752) -- 0:00:48
198500 -- (-389.680) [-386.548] (-386.327) (-389.941) * (-391.453) (-390.273) (-387.750) [-389.826] -- 0:00:48
199000 -- (-389.977) (-389.675) [-387.062] (-388.528) * (-388.126) (-388.523) (-386.416) [-387.875] -- 0:00:48
199500 -- (-386.701) (-388.761) [-387.248] (-387.596) * (-386.827) (-389.554) [-387.776] (-392.003) -- 0:00:48
200000 -- (-387.590) (-393.780) [-389.137] (-388.385) * (-387.931) [-386.715] (-390.432) (-386.520) -- 0:00:48
Average standard deviation of split frequencies: 0.017227
200500 -- [-387.201] (-387.315) (-386.824) (-389.785) * [-390.241] (-391.066) (-388.067) (-397.584) -- 0:00:47
201000 -- (-386.980) (-387.409) [-387.643] (-387.095) * (-387.334) (-390.751) (-390.247) [-393.361] -- 0:00:47
201500 -- (-392.624) (-388.986) (-389.137) [-391.160] * (-389.691) (-389.604) [-387.487] (-391.767) -- 0:00:47
202000 -- [-388.126] (-388.712) (-391.306) (-386.964) * (-390.177) [-388.169] (-386.567) (-387.608) -- 0:00:47
202500 -- (-387.970) [-389.271] (-387.625) (-387.512) * [-388.504] (-388.579) (-389.762) (-386.809) -- 0:00:47
203000 -- (-389.129) (-387.927) (-388.302) [-389.836] * [-387.907] (-395.023) (-386.380) (-386.937) -- 0:00:47
203500 -- (-387.417) [-389.947] (-386.420) (-387.086) * [-386.796] (-390.209) (-387.707) (-387.756) -- 0:00:46
204000 -- (-389.187) [-388.852] (-392.106) (-388.528) * [-386.777] (-390.868) (-388.280) (-389.485) -- 0:00:46
204500 -- [-386.355] (-388.664) (-389.551) (-386.892) * [-387.496] (-387.552) (-388.583) (-387.063) -- 0:00:46
205000 -- [-386.761] (-390.685) (-386.881) (-387.412) * (-389.478) (-387.687) (-389.008) [-388.985] -- 0:00:46
Average standard deviation of split frequencies: 0.017163
205500 -- [-386.650] (-388.069) (-388.631) (-387.017) * (-392.294) (-387.846) [-386.720] (-387.444) -- 0:00:46
206000 -- (-395.586) (-392.507) (-387.674) [-387.502] * (-390.701) (-387.491) [-389.521] (-388.626) -- 0:00:46
206500 -- (-391.471) (-389.575) [-386.871] (-391.202) * (-387.457) (-387.473) (-391.264) [-387.605] -- 0:00:46
207000 -- (-392.420) [-387.916] (-386.623) (-388.788) * (-387.980) (-387.512) (-387.267) [-389.601] -- 0:00:45
207500 -- (-390.768) (-387.733) [-387.458] (-386.903) * (-393.041) (-390.332) [-387.922] (-388.290) -- 0:00:49
208000 -- (-390.058) (-390.729) [-392.715] (-389.044) * [-386.449] (-387.293) (-389.919) (-387.320) -- 0:00:49
208500 -- [-386.433] (-387.937) (-390.553) (-387.237) * (-387.276) (-387.001) [-387.429] (-391.614) -- 0:00:49
209000 -- (-387.649) [-387.970] (-391.233) (-389.259) * (-388.588) (-390.952) [-389.942] (-388.053) -- 0:00:49
209500 -- [-387.676] (-390.952) (-390.427) (-393.858) * (-389.032) (-387.947) (-388.585) [-388.727] -- 0:00:49
210000 -- (-388.640) [-389.572] (-389.573) (-388.422) * (-389.093) (-389.308) (-387.790) [-387.757] -- 0:00:48
Average standard deviation of split frequencies: 0.014604
210500 -- [-387.640] (-391.541) (-389.286) (-388.695) * (-388.906) (-388.698) (-391.811) [-386.730] -- 0:00:48
211000 -- (-387.781) [-392.639] (-392.825) (-387.355) * (-391.517) (-390.949) (-388.599) [-388.005] -- 0:00:48
211500 -- (-387.502) (-388.085) (-386.778) [-386.401] * (-388.425) [-386.515] (-388.382) (-386.213) -- 0:00:48
212000 -- (-387.012) (-387.832) (-388.045) [-389.773] * (-394.495) (-389.264) (-386.503) [-387.188] -- 0:00:48
212500 -- (-387.263) (-388.895) (-388.215) [-393.679] * (-391.831) (-386.186) [-389.353] (-390.458) -- 0:00:48
213000 -- (-388.789) (-389.148) (-389.702) [-386.902] * (-389.716) (-387.344) [-389.204] (-388.585) -- 0:00:48
213500 -- (-388.698) [-393.264] (-391.089) (-390.313) * (-388.499) (-387.321) [-386.735] (-391.036) -- 0:00:47
214000 -- (-387.682) (-387.754) (-388.745) [-386.906] * (-390.797) (-388.190) (-389.003) [-387.311] -- 0:00:47
214500 -- [-387.323] (-388.522) (-388.163) (-390.200) * (-388.546) (-387.755) (-390.290) [-387.839] -- 0:00:47
215000 -- (-387.984) (-386.881) (-387.066) [-387.848] * (-389.661) (-386.987) [-388.333] (-387.099) -- 0:00:47
Average standard deviation of split frequencies: 0.015035
215500 -- (-391.858) [-387.852] (-387.949) (-389.087) * (-388.049) (-387.094) [-389.516] (-386.471) -- 0:00:47
216000 -- (-389.423) (-389.381) (-386.250) [-387.513] * [-388.879] (-386.753) (-388.117) (-387.724) -- 0:00:47
216500 -- (-387.678) [-388.036] (-387.112) (-387.482) * [-389.983] (-393.466) (-389.967) (-388.024) -- 0:00:47
217000 -- (-387.427) (-389.453) [-390.071] (-387.128) * (-387.619) (-392.404) [-390.056] (-388.305) -- 0:00:46
217500 -- (-388.542) (-388.518) [-387.184] (-388.262) * [-390.001] (-386.538) (-387.133) (-387.196) -- 0:00:46
218000 -- (-391.682) (-389.053) (-390.689) [-386.407] * (-388.237) (-390.073) (-387.731) [-387.563] -- 0:00:46
218500 -- [-387.234] (-391.179) (-388.196) (-386.589) * (-387.423) [-392.100] (-389.940) (-388.480) -- 0:00:46
219000 -- (-388.917) (-390.933) [-387.435] (-388.175) * (-390.064) (-387.514) [-388.202] (-387.982) -- 0:00:46
219500 -- (-389.182) [-386.033] (-392.723) (-389.386) * (-389.301) (-391.250) (-387.954) [-388.238] -- 0:00:46
220000 -- [-388.409] (-386.121) (-391.797) (-388.091) * (-388.591) [-388.655] (-388.185) (-387.094) -- 0:00:46
Average standard deviation of split frequencies: 0.013886
220500 -- (-388.580) (-389.458) [-387.823] (-389.242) * (-389.022) (-388.100) (-388.480) [-388.446] -- 0:00:45
221000 -- [-387.539] (-391.162) (-387.266) (-386.671) * [-387.412] (-389.481) (-387.104) (-389.087) -- 0:00:45
221500 -- (-388.992) [-387.745] (-388.761) (-392.505) * (-387.291) (-390.472) [-387.713] (-387.321) -- 0:00:45
222000 -- [-386.513] (-387.279) (-390.534) (-390.728) * (-388.652) (-396.883) (-389.019) [-386.560] -- 0:00:45
222500 -- (-386.662) [-390.605] (-391.018) (-389.060) * (-388.178) (-390.311) [-387.871] (-389.779) -- 0:00:45
223000 -- (-386.767) (-392.301) [-388.827] (-389.177) * (-388.274) [-386.635] (-389.127) (-388.616) -- 0:00:45
223500 -- (-389.832) (-389.461) [-385.976] (-386.733) * (-388.702) (-387.091) [-390.141] (-386.510) -- 0:00:45
224000 -- [-387.439] (-387.910) (-388.882) (-389.468) * [-391.140] (-387.778) (-386.833) (-391.144) -- 0:00:45
224500 -- (-387.314) (-389.537) [-389.060] (-390.788) * (-387.788) (-386.446) [-390.499] (-390.933) -- 0:00:48
225000 -- (-387.819) (-393.119) [-387.271] (-388.635) * (-386.305) (-386.046) [-387.523] (-391.247) -- 0:00:48
Average standard deviation of split frequencies: 0.013833
225500 -- (-386.793) (-388.088) [-391.243] (-392.939) * (-387.257) (-387.555) (-386.556) [-386.870] -- 0:00:48
226000 -- [-388.151] (-387.394) (-389.058) (-390.571) * (-387.734) (-386.575) (-387.102) [-387.574] -- 0:00:47
226500 -- (-390.061) [-386.201] (-391.992) (-390.898) * [-389.318] (-386.788) (-388.042) (-390.010) -- 0:00:47
227000 -- (-386.691) [-388.726] (-389.489) (-388.279) * (-389.075) [-388.729] (-387.647) (-388.521) -- 0:00:47
227500 -- (-388.661) (-391.174) [-387.078] (-390.578) * (-391.101) (-389.831) [-386.613] (-388.600) -- 0:00:47
228000 -- (-388.926) (-388.365) (-387.560) [-387.953] * [-387.694] (-390.348) (-387.957) (-386.982) -- 0:00:47
228500 -- (-386.660) (-387.644) [-387.921] (-388.336) * (-388.554) (-387.869) [-389.466] (-388.189) -- 0:00:47
229000 -- [-387.432] (-390.650) (-388.200) (-386.831) * [-387.217] (-387.662) (-388.186) (-388.083) -- 0:00:47
229500 -- (-387.287) (-387.180) [-389.555] (-388.806) * (-388.575) [-387.609] (-387.689) (-389.810) -- 0:00:47
230000 -- (-387.739) (-388.143) [-388.553] (-388.699) * (-387.534) (-387.596) [-391.210] (-386.660) -- 0:00:46
Average standard deviation of split frequencies: 0.012035
230500 -- (-387.288) (-389.668) (-390.799) [-392.473] * (-386.653) [-386.426] (-389.632) (-386.314) -- 0:00:46
231000 -- (-386.017) (-388.201) [-388.127] (-388.551) * (-389.327) [-386.291] (-387.970) (-388.355) -- 0:00:46
231500 -- (-386.547) (-389.760) [-391.103] (-387.370) * (-387.997) (-387.513) (-391.910) [-387.529] -- 0:00:46
232000 -- [-386.800] (-387.511) (-387.110) (-387.523) * [-388.268] (-391.196) (-387.857) (-391.240) -- 0:00:46
232500 -- (-388.428) [-390.453] (-390.426) (-388.265) * (-393.762) [-388.112] (-387.485) (-389.138) -- 0:00:46
233000 -- (-388.105) (-389.386) [-387.915] (-389.637) * (-387.322) [-388.493] (-387.830) (-387.759) -- 0:00:46
233500 -- (-387.954) (-389.810) [-391.056] (-388.628) * (-390.714) (-388.576) (-389.047) [-389.530] -- 0:00:45
234000 -- [-386.862] (-390.141) (-388.084) (-388.927) * (-386.844) (-388.618) (-393.778) [-389.086] -- 0:00:45
234500 -- [-386.511] (-387.197) (-386.159) (-388.140) * [-387.096] (-387.510) (-389.253) (-388.302) -- 0:00:45
235000 -- (-388.469) [-389.854] (-386.197) (-387.031) * [-388.424] (-386.837) (-389.528) (-387.246) -- 0:00:45
Average standard deviation of split frequencies: 0.012511
235500 -- (-389.554) (-388.699) [-389.045] (-387.831) * (-388.996) [-389.229] (-392.395) (-387.184) -- 0:00:45
236000 -- (-388.976) (-387.513) (-390.688) [-387.002] * (-386.539) (-386.958) (-392.901) [-386.459] -- 0:00:45
236500 -- (-387.374) (-390.269) [-387.887] (-387.238) * [-387.279] (-387.302) (-393.981) (-387.586) -- 0:00:45
237000 -- (-389.056) (-390.418) [-386.600] (-388.624) * (-386.957) [-387.437] (-388.926) (-386.555) -- 0:00:45
237500 -- (-389.423) (-390.666) (-389.193) [-386.947] * (-392.805) (-389.111) (-390.057) [-386.915] -- 0:00:44
238000 -- [-387.286] (-388.745) (-386.270) (-391.388) * (-388.639) (-389.782) [-386.079] (-389.972) -- 0:00:44
238500 -- (-390.800) [-389.726] (-387.439) (-387.534) * [-386.413] (-393.080) (-388.771) (-392.277) -- 0:00:44
239000 -- [-388.334] (-387.758) (-389.043) (-388.770) * (-387.212) (-388.687) (-387.336) [-387.254] -- 0:00:44
239500 -- [-387.141] (-391.751) (-391.716) (-387.600) * (-387.555) (-386.319) (-393.149) [-387.753] -- 0:00:44
240000 -- (-389.420) (-388.949) (-387.539) [-388.352] * (-390.751) (-387.240) [-386.177] (-386.806) -- 0:00:44
Average standard deviation of split frequencies: 0.011208
240500 -- (-388.099) (-391.489) [-387.614] (-387.911) * (-389.901) [-387.013] (-387.248) (-387.988) -- 0:00:44
241000 -- (-390.430) (-393.007) [-389.096] (-386.713) * (-395.686) (-388.532) (-389.739) [-386.673] -- 0:00:44
241500 -- (-388.033) (-391.826) [-388.498] (-388.169) * (-389.720) (-389.435) (-388.791) [-388.362] -- 0:00:47
242000 -- (-387.326) (-387.369) (-389.586) [-392.988] * (-388.169) [-387.425] (-387.760) (-387.952) -- 0:00:46
242500 -- (-389.585) (-387.816) (-387.894) [-387.676] * [-389.532] (-389.482) (-389.456) (-387.866) -- 0:00:46
243000 -- (-392.360) (-391.410) (-387.404) [-386.801] * (-389.230) (-389.759) (-390.491) [-386.714] -- 0:00:46
243500 -- (-392.152) (-391.981) (-389.859) [-388.265] * [-387.277] (-389.797) (-388.709) (-386.547) -- 0:00:46
244000 -- (-394.065) (-399.934) (-387.272) [-386.048] * (-387.773) (-389.029) [-389.850] (-391.805) -- 0:00:46
244500 -- (-393.173) (-387.286) [-387.793] (-388.582) * (-388.276) (-388.265) (-388.709) [-388.335] -- 0:00:46
245000 -- (-387.529) [-389.717] (-387.017) (-388.718) * (-386.513) (-388.097) (-389.685) [-386.758] -- 0:00:46
Average standard deviation of split frequencies: 0.011711
245500 -- (-386.562) (-390.296) [-389.273] (-387.406) * [-387.082] (-395.153) (-389.473) (-389.421) -- 0:00:46
246000 -- (-386.833) (-389.058) (-389.544) [-389.348] * (-386.602) (-386.461) (-389.678) [-388.113] -- 0:00:45
246500 -- [-386.365] (-386.980) (-389.069) (-389.933) * [-386.374] (-388.866) (-389.548) (-388.112) -- 0:00:45
247000 -- (-388.512) (-387.952) [-386.296] (-396.483) * [-386.713] (-386.975) (-388.205) (-388.600) -- 0:00:45
247500 -- (-387.418) (-392.778) [-388.382] (-387.462) * (-387.945) (-392.174) [-388.570] (-389.384) -- 0:00:45
248000 -- (-388.842) [-388.296] (-387.454) (-387.261) * (-388.079) (-387.920) (-388.269) [-390.371] -- 0:00:45
248500 -- (-390.017) (-386.584) (-388.421) [-387.288] * (-386.979) [-391.443] (-387.687) (-396.173) -- 0:00:45
249000 -- [-387.913] (-389.233) (-387.078) (-388.394) * [-387.647] (-390.252) (-387.183) (-388.058) -- 0:00:45
249500 -- (-387.509) [-387.598] (-388.637) (-389.616) * [-387.733] (-390.370) (-388.306) (-390.075) -- 0:00:45
250000 -- [-386.813] (-388.333) (-389.183) (-387.885) * (-391.933) [-387.428] (-387.027) (-389.418) -- 0:00:45
Average standard deviation of split frequencies: 0.012328
250500 -- (-391.943) (-389.567) (-386.427) [-387.840] * [-386.766] (-389.434) (-387.695) (-388.658) -- 0:00:44
251000 -- (-387.432) (-388.097) (-386.583) [-387.383] * (-389.550) (-389.126) (-389.223) [-394.957] -- 0:00:44
251500 -- (-388.646) (-393.578) [-389.409] (-388.036) * (-392.587) [-393.271] (-387.888) (-387.482) -- 0:00:44
252000 -- [-387.439] (-389.457) (-388.035) (-389.753) * (-391.067) (-391.213) (-388.526) [-386.224] -- 0:00:44
252500 -- [-389.401] (-389.143) (-387.264) (-390.446) * [-386.760] (-390.363) (-389.315) (-386.937) -- 0:00:44
253000 -- [-387.745] (-389.440) (-387.887) (-391.415) * (-386.587) (-389.167) [-386.602] (-388.104) -- 0:00:44
253500 -- (-388.615) (-391.564) (-387.795) [-393.908] * (-388.597) [-389.386] (-389.906) (-391.596) -- 0:00:44
254000 -- (-391.560) (-390.285) (-390.055) [-387.364] * (-390.781) (-389.908) (-389.199) [-389.073] -- 0:00:44
254500 -- [-387.916] (-386.375) (-393.506) (-387.825) * [-386.436] (-389.109) (-390.252) (-388.364) -- 0:00:43
255000 -- [-388.273] (-388.636) (-392.948) (-388.645) * (-391.448) (-386.951) [-389.181] (-388.338) -- 0:00:43
Average standard deviation of split frequencies: 0.012685
255500 -- (-388.614) (-389.258) (-391.358) [-388.776] * (-389.346) (-386.270) [-387.698] (-388.314) -- 0:00:43
256000 -- (-389.865) (-391.513) (-390.242) [-387.866] * (-387.381) (-388.506) [-387.655] (-387.437) -- 0:00:43
256500 -- [-388.219] (-393.334) (-387.293) (-390.610) * [-388.040] (-387.526) (-394.148) (-388.011) -- 0:00:43
257000 -- (-389.926) (-388.740) (-387.999) [-388.735] * (-390.404) (-391.977) [-387.098] (-389.716) -- 0:00:43
257500 -- [-389.126] (-387.099) (-388.147) (-388.771) * (-388.602) [-387.003] (-387.738) (-391.796) -- 0:00:43
258000 -- (-388.736) (-387.737) (-389.281) [-388.926] * (-387.446) (-391.346) [-386.720] (-387.151) -- 0:00:43
258500 -- [-387.602] (-393.378) (-388.699) (-387.150) * (-389.023) (-386.817) [-388.536] (-390.027) -- 0:00:45
259000 -- (-388.278) (-386.209) [-387.836] (-387.125) * (-390.397) (-389.460) (-387.019) [-386.587] -- 0:00:45
259500 -- [-386.164] (-388.227) (-388.008) (-385.999) * (-391.318) [-387.235] (-386.838) (-388.539) -- 0:00:45
260000 -- [-386.131] (-388.063) (-389.333) (-392.093) * [-389.909] (-387.661) (-386.717) (-387.708) -- 0:00:45
Average standard deviation of split frequencies: 0.012760
260500 -- [-387.708] (-391.513) (-387.162) (-387.546) * [-387.998] (-389.059) (-389.854) (-391.481) -- 0:00:45
261000 -- [-387.912] (-390.398) (-388.766) (-386.528) * [-389.255] (-390.108) (-387.210) (-391.067) -- 0:00:45
261500 -- (-388.732) (-390.832) [-387.870] (-396.076) * (-386.949) [-388.023] (-388.007) (-386.200) -- 0:00:45
262000 -- (-388.273) [-386.556] (-387.986) (-387.498) * (-389.844) (-387.351) [-386.045] (-387.451) -- 0:00:45
262500 -- (-387.276) [-386.681] (-388.571) (-386.983) * (-390.826) [-388.537] (-389.400) (-388.590) -- 0:00:44
263000 -- (-389.021) (-386.630) (-388.979) [-393.292] * (-388.082) (-389.013) [-389.573] (-387.449) -- 0:00:44
263500 -- (-388.671) (-386.948) [-387.427] (-389.718) * (-387.953) [-390.353] (-388.963) (-388.446) -- 0:00:44
264000 -- (-387.120) (-388.887) [-387.827] (-389.009) * [-391.179] (-386.668) (-394.949) (-389.260) -- 0:00:44
264500 -- (-386.853) (-389.141) (-387.262) [-388.405] * (-390.657) (-389.137) (-388.387) [-390.532] -- 0:00:44
265000 -- (-388.321) (-391.478) [-387.400] (-387.944) * (-386.381) (-388.120) [-387.477] (-389.232) -- 0:00:44
Average standard deviation of split frequencies: 0.012012
265500 -- (-392.386) (-388.499) [-387.023] (-387.678) * (-390.107) [-386.419] (-390.807) (-387.069) -- 0:00:44
266000 -- (-393.939) [-387.006] (-386.746) (-392.657) * [-388.517] (-391.609) (-389.250) (-388.860) -- 0:00:44
266500 -- (-387.910) (-389.911) (-386.282) [-388.883] * [-388.991] (-392.745) (-393.508) (-386.772) -- 0:00:44
267000 -- (-387.078) (-389.200) (-390.978) [-387.319] * (-391.005) [-392.541] (-390.046) (-389.741) -- 0:00:43
267500 -- (-386.151) [-387.077] (-390.392) (-386.068) * [-388.860] (-390.993) (-389.427) (-388.877) -- 0:00:43
268000 -- (-388.241) [-389.129] (-386.939) (-387.247) * [-387.285] (-391.834) (-387.792) (-387.819) -- 0:00:43
268500 -- [-388.911] (-392.756) (-387.886) (-391.557) * (-387.680) (-392.216) (-393.206) [-388.043] -- 0:00:43
269000 -- [-387.271] (-389.238) (-389.583) (-392.289) * (-387.192) (-390.338) [-387.622] (-387.339) -- 0:00:43
269500 -- [-395.715] (-388.665) (-387.296) (-387.969) * (-388.109) (-391.557) (-388.970) [-391.534] -- 0:00:43
270000 -- (-391.491) (-389.873) [-389.128] (-388.177) * (-387.230) (-388.591) (-393.053) [-388.057] -- 0:00:43
Average standard deviation of split frequencies: 0.012482
270500 -- (-397.095) (-391.272) (-389.569) [-387.150] * [-391.032] (-388.051) (-387.975) (-390.127) -- 0:00:43
271000 -- (-391.944) [-390.788] (-391.109) (-387.980) * (-391.578) (-391.653) (-387.974) [-388.619] -- 0:00:43
271500 -- (-391.713) (-387.300) (-393.808) [-388.582] * (-392.342) (-387.685) (-387.718) [-386.280] -- 0:00:42
272000 -- [-392.599] (-388.722) (-387.303) (-387.725) * [-388.086] (-387.978) (-388.557) (-389.175) -- 0:00:42
272500 -- (-386.930) (-388.379) [-390.430] (-391.955) * (-391.467) (-388.467) [-388.292] (-389.565) -- 0:00:42
273000 -- (-388.600) (-390.022) (-390.021) [-387.827] * (-390.378) (-389.873) [-387.802] (-389.213) -- 0:00:42
273500 -- (-388.924) (-388.256) [-386.923] (-386.408) * (-393.292) (-389.380) [-387.249] (-388.970) -- 0:00:42
274000 -- (-390.253) (-390.177) (-388.032) [-388.549] * (-389.624) (-389.480) [-389.150] (-387.227) -- 0:00:42
274500 -- (-387.720) (-390.359) (-388.312) [-386.497] * [-386.626] (-389.871) (-393.865) (-388.467) -- 0:00:42
275000 -- (-388.481) (-392.297) [-388.263] (-392.668) * (-389.453) [-388.348] (-389.833) (-387.218) -- 0:00:44
Average standard deviation of split frequencies: 0.013208
275500 -- (-388.713) (-386.835) (-391.445) [-387.880] * [-387.276] (-389.651) (-390.218) (-387.054) -- 0:00:44
276000 -- [-388.942] (-392.037) (-390.824) (-390.451) * [-390.305] (-388.009) (-397.204) (-388.687) -- 0:00:44
276500 -- [-388.494] (-388.532) (-389.383) (-391.085) * (-393.456) (-393.961) (-386.123) [-390.001] -- 0:00:44
277000 -- (-387.681) (-386.452) (-390.580) [-388.151] * (-392.658) (-388.574) [-388.478] (-389.340) -- 0:00:44
277500 -- [-387.713] (-386.457) (-388.339) (-389.362) * (-390.686) (-387.368) (-388.919) [-388.139] -- 0:00:44
278000 -- (-387.318) [-390.035] (-386.818) (-389.487) * (-389.591) [-387.066] (-388.200) (-388.224) -- 0:00:44
278500 -- [-386.854] (-389.876) (-389.179) (-390.588) * (-389.633) (-387.355) (-388.481) [-388.279] -- 0:00:44
279000 -- (-388.558) [-389.304] (-388.896) (-388.725) * (-388.631) (-387.695) [-389.957] (-389.777) -- 0:00:43
279500 -- [-387.469] (-387.953) (-386.321) (-393.491) * (-389.588) (-386.946) (-389.254) [-392.455] -- 0:00:43
280000 -- (-387.386) (-389.686) [-387.977] (-390.546) * [-388.139] (-388.272) (-387.849) (-388.980) -- 0:00:43
Average standard deviation of split frequencies: 0.013542
280500 -- [-388.652] (-388.929) (-387.981) (-391.128) * [-386.624] (-388.629) (-391.032) (-388.002) -- 0:00:43
281000 -- (-389.824) [-386.910] (-389.502) (-392.529) * (-387.424) (-386.519) [-386.836] (-389.937) -- 0:00:43
281500 -- (-387.962) (-387.945) [-388.054] (-390.112) * (-388.332) (-387.988) [-388.762] (-390.528) -- 0:00:43
282000 -- (-387.387) [-386.704] (-389.184) (-388.418) * (-389.114) (-386.281) (-387.169) [-389.648] -- 0:00:43
282500 -- [-386.410] (-393.296) (-390.869) (-388.207) * (-386.795) [-386.124] (-391.027) (-388.583) -- 0:00:43
283000 -- (-389.183) (-388.564) [-389.085] (-387.351) * (-391.918) [-387.762] (-390.517) (-393.294) -- 0:00:43
283500 -- (-389.178) [-387.068] (-390.305) (-386.352) * (-387.909) [-388.051] (-391.880) (-387.236) -- 0:00:42
284000 -- (-388.551) (-387.908) (-386.500) [-386.645] * [-388.677] (-387.877) (-387.967) (-387.917) -- 0:00:42
284500 -- (-386.235) [-386.532] (-390.673) (-389.362) * (-386.392) (-389.322) [-391.740] (-387.564) -- 0:00:42
285000 -- (-388.395) [-387.620] (-391.171) (-389.965) * (-386.567) [-388.905] (-389.123) (-388.266) -- 0:00:42
Average standard deviation of split frequencies: 0.013283
285500 -- (-389.256) (-387.211) (-387.867) [-388.698] * (-394.165) (-387.881) (-387.899) [-388.076] -- 0:00:42
286000 -- [-389.069] (-387.503) (-389.070) (-387.494) * [-392.195] (-391.174) (-389.393) (-389.286) -- 0:00:42
286500 -- (-388.617) [-390.012] (-386.229) (-389.046) * (-394.748) (-387.092) (-391.976) [-388.229] -- 0:00:42
287000 -- (-389.391) [-386.782] (-388.958) (-392.805) * (-388.391) (-388.075) [-390.888] (-389.622) -- 0:00:42
287500 -- (-389.522) [-388.970] (-389.712) (-390.486) * (-391.493) [-392.075] (-390.701) (-388.808) -- 0:00:42
288000 -- [-388.285] (-386.359) (-388.311) (-389.654) * (-387.463) (-388.421) (-388.169) [-390.347] -- 0:00:42
288500 -- [-390.106] (-390.521) (-388.639) (-388.516) * (-386.789) [-386.651] (-390.309) (-389.425) -- 0:00:41
289000 -- (-387.577) [-387.445] (-388.760) (-388.101) * (-387.786) (-389.502) [-387.693] (-388.414) -- 0:00:41
289500 -- (-387.464) (-386.967) (-387.970) [-387.673] * [-387.374] (-387.012) (-392.441) (-386.527) -- 0:00:41
290000 -- [-389.651] (-387.602) (-388.138) (-390.273) * (-388.669) (-389.482) [-387.954] (-387.686) -- 0:00:41
Average standard deviation of split frequencies: 0.013165
290500 -- (-387.931) (-389.066) (-390.423) [-390.693] * (-393.489) (-389.426) [-386.762] (-388.824) -- 0:00:41
291000 -- (-386.672) (-389.569) (-390.700) [-390.525] * (-390.533) (-387.367) (-386.625) [-386.364] -- 0:00:41
291500 -- [-389.406] (-387.286) (-389.848) (-387.170) * (-388.804) (-387.188) [-389.298] (-386.139) -- 0:00:41
292000 -- (-386.902) (-390.223) [-389.710] (-390.784) * (-388.594) (-387.912) [-388.412] (-392.668) -- 0:00:43
292500 -- (-389.192) (-387.218) (-389.333) [-388.656] * (-389.950) [-387.375] (-387.723) (-389.539) -- 0:00:43
293000 -- (-388.514) [-389.840] (-387.455) (-386.768) * [-387.307] (-390.774) (-388.348) (-386.315) -- 0:00:43
293500 -- (-390.970) (-391.632) [-387.474] (-388.608) * [-387.728] (-388.986) (-387.175) (-387.240) -- 0:00:43
294000 -- (-391.100) (-386.298) (-390.625) [-386.604] * (-388.509) [-391.418] (-386.498) (-387.916) -- 0:00:43
294500 -- (-387.387) [-387.187] (-389.002) (-386.284) * [-388.251] (-387.116) (-389.304) (-386.431) -- 0:00:43
295000 -- [-392.158] (-390.715) (-388.922) (-387.537) * (-387.857) (-387.311) (-393.284) [-387.301] -- 0:00:43
Average standard deviation of split frequencies: 0.012641
295500 -- [-389.626] (-387.640) (-387.370) (-394.738) * (-387.453) (-391.621) (-390.023) [-386.668] -- 0:00:42
296000 -- (-389.773) (-390.251) [-389.474] (-390.169) * (-386.514) (-391.312) (-388.013) [-389.969] -- 0:00:42
296500 -- [-388.266] (-386.417) (-391.827) (-388.360) * (-388.832) (-391.732) [-387.137] (-390.094) -- 0:00:42
297000 -- (-389.137) (-390.943) (-390.387) [-388.013] * (-390.794) (-386.484) (-388.184) [-389.589] -- 0:00:42
297500 -- [-386.542] (-389.859) (-387.930) (-393.939) * [-389.886] (-389.720) (-387.607) (-389.890) -- 0:00:42
298000 -- (-389.713) [-387.781] (-387.845) (-393.580) * (-390.868) [-388.723] (-386.556) (-388.432) -- 0:00:42
298500 -- [-388.124] (-387.705) (-387.862) (-388.959) * (-386.567) [-388.413] (-387.962) (-388.130) -- 0:00:42
299000 -- (-387.348) (-387.939) (-387.517) [-389.130] * (-389.370) (-388.440) (-388.041) [-386.448] -- 0:00:42
299500 -- (-388.701) [-388.428] (-387.493) (-386.520) * (-389.607) (-387.690) (-395.072) [-387.859] -- 0:00:42
300000 -- (-386.906) (-389.056) [-392.280] (-389.287) * (-390.782) [-390.044] (-388.998) (-388.803) -- 0:00:42
Average standard deviation of split frequencies: 0.011713
300500 -- (-390.637) (-387.143) (-389.708) [-391.324] * (-387.788) (-386.809) [-387.006] (-388.928) -- 0:00:41
301000 -- (-386.933) [-387.880] (-391.734) (-389.487) * [-389.108] (-386.512) (-387.868) (-388.875) -- 0:00:41
301500 -- (-390.199) (-387.324) [-389.096] (-389.913) * (-391.727) [-387.099] (-387.115) (-388.798) -- 0:00:41
302000 -- (-387.855) [-387.539] (-387.949) (-387.921) * (-390.530) [-389.674] (-387.001) (-389.509) -- 0:00:41
302500 -- [-387.887] (-392.642) (-387.156) (-387.179) * (-387.414) [-388.625] (-388.227) (-389.408) -- 0:00:41
303000 -- (-387.496) (-393.066) (-389.023) [-387.861] * (-391.504) (-389.806) [-388.317] (-389.276) -- 0:00:41
303500 -- (-392.653) [-388.706] (-388.922) (-391.123) * (-389.564) [-388.115] (-388.619) (-388.201) -- 0:00:41
304000 -- (-388.789) [-394.002] (-387.983) (-388.276) * (-386.383) (-387.661) [-388.473] (-387.898) -- 0:00:41
304500 -- (-390.620) (-389.620) (-388.960) [-386.845] * (-388.599) [-387.105] (-390.952) (-389.920) -- 0:00:41
305000 -- (-389.375) [-388.367] (-387.577) (-388.605) * [-387.193] (-388.907) (-390.637) (-388.029) -- 0:00:41
Average standard deviation of split frequencies: 0.011383
305500 -- [-388.659] (-386.408) (-390.112) (-387.548) * (-388.705) [-389.508] (-388.624) (-388.257) -- 0:00:40
306000 -- [-390.795] (-388.190) (-389.568) (-386.760) * (-388.504) (-389.436) [-386.182] (-387.867) -- 0:00:40
306500 -- (-388.883) (-390.371) (-389.075) [-387.422] * (-390.884) [-389.597] (-387.699) (-390.938) -- 0:00:40
307000 -- (-389.118) (-387.960) [-391.077] (-388.405) * [-388.318] (-387.191) (-387.228) (-387.023) -- 0:00:40
307500 -- [-387.178] (-390.093) (-392.139) (-387.331) * (-389.269) [-386.852] (-387.392) (-389.265) -- 0:00:40
308000 -- [-387.459] (-387.043) (-388.379) (-388.039) * (-387.024) (-390.642) (-388.213) [-389.358] -- 0:00:40
308500 -- (-386.966) (-391.251) [-389.403] (-387.192) * (-386.631) (-390.456) (-392.826) [-389.481] -- 0:00:40
309000 -- (-387.214) [-390.837] (-388.166) (-388.056) * (-389.692) [-388.333] (-388.537) (-389.127) -- 0:00:42
309500 -- (-388.216) [-388.066] (-387.353) (-389.671) * (-389.264) [-393.934] (-392.616) (-386.592) -- 0:00:42
310000 -- [-387.170] (-386.689) (-388.163) (-388.078) * [-387.297] (-389.954) (-391.759) (-386.284) -- 0:00:42
Average standard deviation of split frequencies: 0.010875
310500 -- [-387.797] (-387.420) (-390.707) (-388.964) * [-389.258] (-389.337) (-388.662) (-386.501) -- 0:00:42
311000 -- [-389.258] (-386.697) (-389.642) (-386.740) * (-390.828) (-391.099) [-387.036] (-395.473) -- 0:00:42
311500 -- [-386.233] (-387.355) (-388.653) (-388.741) * (-393.061) (-394.208) [-387.897] (-388.863) -- 0:00:41
312000 -- (-387.820) [-388.472] (-388.962) (-387.379) * [-391.548] (-386.448) (-387.197) (-387.951) -- 0:00:41
312500 -- (-387.243) (-391.482) (-389.639) [-392.598] * (-387.239) [-391.108] (-390.113) (-387.721) -- 0:00:41
313000 -- (-387.002) [-386.227] (-388.310) (-389.595) * (-388.989) (-386.550) (-387.228) [-391.536] -- 0:00:41
313500 -- (-390.001) [-387.505] (-386.604) (-386.886) * [-386.647] (-387.418) (-388.145) (-389.638) -- 0:00:41
314000 -- (-388.393) (-387.513) [-387.549] (-387.550) * [-387.670] (-387.500) (-391.809) (-388.386) -- 0:00:41
314500 -- (-386.956) (-386.815) (-390.421) [-387.046] * [-391.898] (-388.162) (-388.862) (-386.953) -- 0:00:41
315000 -- (-388.106) (-390.391) [-388.864] (-388.822) * (-388.005) [-391.252] (-389.706) (-387.783) -- 0:00:41
Average standard deviation of split frequencies: 0.009653
315500 -- [-388.007] (-388.985) (-388.727) (-387.135) * (-389.826) (-387.437) (-387.050) [-387.874] -- 0:00:41
316000 -- [-386.576] (-390.524) (-389.044) (-393.011) * (-387.933) (-389.880) (-387.069) [-386.520] -- 0:00:41
316500 -- [-386.815] (-389.647) (-386.351) (-395.406) * (-392.932) (-388.821) (-391.531) [-388.529] -- 0:00:41
317000 -- (-386.271) (-388.685) (-386.344) [-391.307] * (-394.214) (-390.366) (-391.326) [-393.948] -- 0:00:40
317500 -- (-388.018) (-386.825) [-389.101] (-390.395) * (-391.259) (-387.593) [-387.849] (-388.578) -- 0:00:40
318000 -- (-388.269) (-387.766) (-387.060) [-388.100] * (-390.500) (-391.077) [-387.824] (-389.589) -- 0:00:40
318500 -- (-388.471) (-393.034) [-387.798] (-387.130) * (-387.493) (-390.804) [-389.009] (-387.232) -- 0:00:40
319000 -- [-390.941] (-393.514) (-387.301) (-387.972) * (-392.839) (-386.315) [-387.899] (-386.992) -- 0:00:40
319500 -- [-390.786] (-388.864) (-389.005) (-388.082) * [-389.914] (-388.783) (-388.806) (-387.496) -- 0:00:40
320000 -- (-389.800) (-386.461) [-390.225] (-386.430) * (-390.016) [-387.179] (-386.692) (-388.742) -- 0:00:40
Average standard deviation of split frequencies: 0.010683
320500 -- (-389.543) [-386.734] (-389.536) (-388.335) * (-390.619) [-386.443] (-386.581) (-390.167) -- 0:00:40
321000 -- [-390.020] (-390.521) (-387.910) (-389.728) * (-387.016) (-386.472) (-389.369) [-390.380] -- 0:00:40
321500 -- (-386.348) (-387.758) (-387.233) [-386.262] * [-388.198] (-387.981) (-390.511) (-387.355) -- 0:00:40
322000 -- (-389.446) (-388.464) (-390.590) [-390.509] * [-389.451] (-387.729) (-387.400) (-389.097) -- 0:00:40
322500 -- (-388.369) (-387.563) (-388.002) [-386.639] * (-387.759) (-389.166) (-386.726) [-388.206] -- 0:00:39
323000 -- (-388.064) (-388.991) (-386.416) [-388.284] * (-388.382) [-393.410] (-387.037) (-386.469) -- 0:00:39
323500 -- (-388.653) (-389.003) [-388.364] (-390.839) * (-388.225) (-388.850) [-390.313] (-388.896) -- 0:00:39
324000 -- [-387.712] (-388.792) (-388.140) (-390.746) * (-388.849) [-386.299] (-388.210) (-386.416) -- 0:00:39
324500 -- (-391.243) (-386.346) (-393.615) [-390.244] * (-388.898) [-387.104] (-388.041) (-387.277) -- 0:00:39
325000 -- (-387.084) (-387.317) [-386.344] (-388.953) * (-388.163) (-386.536) [-387.549] (-387.205) -- 0:00:39
Average standard deviation of split frequencies: 0.012334
325500 -- [-387.958] (-388.133) (-390.748) (-387.067) * (-389.039) (-387.563) (-389.887) [-388.271] -- 0:00:39
326000 -- (-389.177) [-388.386] (-388.779) (-390.102) * (-390.340) [-387.881] (-389.202) (-388.366) -- 0:00:41
326500 -- (-394.494) [-387.085] (-387.327) (-387.828) * (-387.756) (-394.278) [-388.378] (-390.149) -- 0:00:41
327000 -- (-391.796) [-386.833] (-387.633) (-386.864) * (-388.071) (-388.171) (-388.895) [-387.110] -- 0:00:41
327500 -- [-394.431] (-386.279) (-391.068) (-389.692) * [-387.059] (-388.816) (-388.795) (-387.317) -- 0:00:41
328000 -- (-386.144) (-389.680) [-388.340] (-386.680) * (-386.626) [-387.827] (-386.998) (-393.613) -- 0:00:40
328500 -- (-387.080) [-387.171] (-386.551) (-392.867) * (-387.096) [-386.683] (-386.748) (-394.083) -- 0:00:40
329000 -- [-387.733] (-391.495) (-388.436) (-387.167) * (-389.374) [-386.978] (-388.213) (-388.632) -- 0:00:40
329500 -- (-388.281) (-389.688) (-388.711) [-387.912] * [-392.596] (-391.989) (-388.553) (-390.732) -- 0:00:40
330000 -- (-388.941) (-386.820) (-389.452) [-392.274] * (-387.394) (-386.869) (-388.117) [-390.062] -- 0:00:40
Average standard deviation of split frequencies: 0.011405
330500 -- (-389.403) [-386.788] (-389.784) (-389.644) * (-386.490) (-390.725) (-389.168) [-387.130] -- 0:00:40
331000 -- [-391.036] (-389.613) (-389.026) (-386.792) * (-386.129) [-386.919] (-388.910) (-391.285) -- 0:00:40
331500 -- [-387.291] (-389.874) (-388.004) (-388.414) * (-390.530) (-390.496) [-387.985] (-386.873) -- 0:00:40
332000 -- (-389.061) [-390.419] (-393.789) (-388.270) * (-389.235) (-388.123) (-388.307) [-387.176] -- 0:00:40
332500 -- (-386.957) [-389.249] (-388.663) (-386.650) * (-388.018) [-391.434] (-389.705) (-388.095) -- 0:00:40
333000 -- (-390.565) (-388.594) (-389.095) [-388.248] * (-387.286) (-387.067) [-391.206] (-388.353) -- 0:00:40
333500 -- [-386.930] (-388.192) (-390.214) (-387.681) * (-387.531) (-386.717) (-388.396) [-387.720] -- 0:00:39
334000 -- [-393.302] (-391.376) (-386.349) (-388.248) * (-390.482) (-386.801) [-389.347] (-389.279) -- 0:00:39
334500 -- (-389.802) [-389.414] (-390.351) (-388.141) * (-387.194) (-389.822) (-387.128) [-386.623] -- 0:00:39
335000 -- (-388.746) (-389.198) (-391.575) [-386.577] * (-391.049) [-387.153] (-387.181) (-388.715) -- 0:00:39
Average standard deviation of split frequencies: 0.012013
335500 -- [-389.064] (-389.310) (-387.251) (-390.971) * (-387.004) (-389.394) [-388.628] (-387.747) -- 0:00:39
336000 -- (-388.498) (-391.530) [-387.137] (-386.864) * (-390.168) (-388.351) (-387.872) [-388.144] -- 0:00:39
336500 -- (-387.760) (-391.378) [-388.267] (-388.584) * (-389.652) (-389.497) (-386.887) [-388.018] -- 0:00:39
337000 -- [-387.048] (-387.783) (-389.630) (-389.056) * (-388.100) [-387.807] (-388.645) (-392.399) -- 0:00:39
337500 -- (-386.889) [-387.738] (-390.997) (-388.000) * (-387.655) (-389.218) (-388.162) [-387.759] -- 0:00:39
338000 -- (-389.760) (-391.446) [-390.014] (-386.759) * (-388.323) (-390.499) [-387.309] (-388.504) -- 0:00:39
338500 -- [-388.159] (-386.433) (-389.115) (-389.328) * [-388.416] (-389.321) (-387.994) (-390.131) -- 0:00:39
339000 -- (-388.712) [-388.049] (-392.913) (-390.634) * [-386.882] (-388.672) (-387.762) (-390.775) -- 0:00:38
339500 -- (-390.790) (-388.430) [-387.457] (-388.537) * [-388.018] (-391.914) (-389.261) (-395.757) -- 0:00:38
340000 -- (-386.876) [-389.211] (-387.945) (-394.605) * [-387.657] (-387.051) (-386.387) (-390.207) -- 0:00:38
Average standard deviation of split frequencies: 0.011157
340500 -- [-390.455] (-390.538) (-387.648) (-388.007) * (-388.923) (-389.641) [-386.787] (-390.890) -- 0:00:38
341000 -- (-388.893) (-390.364) [-388.507] (-388.561) * (-387.860) (-389.597) [-386.638] (-387.642) -- 0:00:38
341500 -- [-391.243] (-386.356) (-391.167) (-388.397) * (-389.172) (-390.994) (-388.836) [-387.463] -- 0:00:38
342000 -- (-387.417) (-390.216) (-387.333) [-387.005] * (-388.627) (-388.846) (-389.003) [-388.716] -- 0:00:38
342500 -- [-386.993] (-390.274) (-388.503) (-386.829) * (-389.221) (-391.210) (-387.262) [-387.663] -- 0:00:38
343000 -- [-388.411] (-389.257) (-393.686) (-387.617) * (-393.830) (-389.933) (-387.327) [-387.027] -- 0:00:40
343500 -- (-389.674) (-387.928) (-387.403) [-388.161] * [-389.741] (-389.722) (-390.699) (-388.307) -- 0:00:40
344000 -- (-389.472) (-388.603) (-389.817) [-387.395] * (-391.853) (-391.174) [-388.024] (-393.222) -- 0:00:40
344500 -- (-387.579) (-389.304) [-389.102] (-388.400) * (-391.891) [-388.001] (-389.343) (-389.371) -- 0:00:39
345000 -- (-388.355) (-388.018) [-387.588] (-387.673) * (-388.101) (-387.726) (-390.804) [-390.648] -- 0:00:39
Average standard deviation of split frequencies: 0.011581
345500 -- (-388.783) [-386.872] (-388.771) (-386.922) * [-386.100] (-386.301) (-387.283) (-388.480) -- 0:00:39
346000 -- (-389.451) (-386.989) (-391.280) [-386.979] * [-387.074] (-389.286) (-387.193) (-387.568) -- 0:00:39
346500 -- (-392.851) [-387.442] (-388.656) (-386.220) * (-389.487) [-389.713] (-386.483) (-389.759) -- 0:00:39
347000 -- (-388.609) [-387.454] (-388.953) (-387.202) * (-388.246) (-390.444) [-388.456] (-388.267) -- 0:00:39
347500 -- (-388.220) (-386.228) (-389.817) [-391.032] * (-387.593) [-386.353] (-388.774) (-389.854) -- 0:00:39
348000 -- (-388.285) [-388.029] (-394.949) (-392.031) * (-388.463) (-390.234) [-393.281] (-391.545) -- 0:00:39
348500 -- (-387.996) (-390.201) (-389.056) [-387.920] * [-390.838] (-388.540) (-387.212) (-393.143) -- 0:00:39
349000 -- (-387.445) [-388.316] (-389.592) (-386.444) * (-387.481) [-393.119] (-386.912) (-388.407) -- 0:00:39
349500 -- (-388.082) (-391.351) [-388.411] (-386.787) * (-388.692) (-391.697) [-386.991] (-390.796) -- 0:00:39
350000 -- (-388.536) (-389.346) [-387.750] (-386.852) * [-391.168] (-390.468) (-387.691) (-387.831) -- 0:00:39
Average standard deviation of split frequencies: 0.011561
350500 -- (-387.632) [-388.326] (-388.404) (-386.763) * [-388.093] (-390.868) (-387.337) (-386.963) -- 0:00:38
351000 -- (-387.842) [-389.761] (-388.754) (-386.821) * (-387.048) (-388.178) (-388.808) [-389.234] -- 0:00:38
351500 -- [-388.284] (-388.218) (-386.726) (-389.194) * (-389.080) [-388.405] (-388.275) (-389.371) -- 0:00:38
352000 -- (-388.990) (-390.049) (-387.333) [-387.817] * (-388.367) (-386.892) [-396.327] (-386.352) -- 0:00:38
352500 -- (-388.955) [-388.885] (-387.098) (-387.646) * [-390.564] (-388.688) (-387.897) (-387.176) -- 0:00:38
353000 -- (-389.095) (-387.864) (-390.620) [-390.796] * [-389.417] (-386.694) (-388.547) (-387.609) -- 0:00:38
353500 -- (-390.128) [-387.617] (-391.081) (-393.487) * [-386.684] (-390.247) (-387.570) (-386.831) -- 0:00:38
354000 -- (-386.710) (-388.250) [-388.615] (-388.962) * (-388.779) [-388.315] (-388.236) (-389.752) -- 0:00:38
354500 -- [-386.939] (-391.447) (-387.741) (-388.167) * (-389.557) (-387.683) (-388.863) [-392.485] -- 0:00:38
355000 -- [-389.003] (-389.665) (-388.397) (-386.774) * [-387.858] (-387.545) (-392.887) (-394.225) -- 0:00:38
Average standard deviation of split frequencies: 0.010858
355500 -- [-387.413] (-388.744) (-387.062) (-386.724) * (-393.034) (-389.791) [-387.294] (-391.963) -- 0:00:38
356000 -- [-387.479] (-388.871) (-387.872) (-387.013) * (-393.637) (-391.053) [-387.150] (-391.382) -- 0:00:37
356500 -- (-392.918) (-388.844) (-388.707) [-387.189] * [-387.195] (-389.242) (-390.030) (-386.473) -- 0:00:37
357000 -- (-391.496) (-391.932) (-386.726) [-387.971] * (-387.279) (-386.307) [-387.445] (-390.870) -- 0:00:37
357500 -- (-389.147) (-388.134) (-389.138) [-387.634] * (-389.634) (-387.283) (-386.415) [-390.047] -- 0:00:37
358000 -- (-388.875) (-386.879) [-387.503] (-391.374) * (-389.042) (-389.055) (-387.647) [-386.110] -- 0:00:37
358500 -- (-388.631) (-388.078) (-389.449) [-386.791] * [-386.684] (-391.229) (-386.303) (-388.052) -- 0:00:37
359000 -- (-388.680) (-389.799) (-389.265) [-389.831] * (-388.629) [-389.514] (-386.077) (-387.587) -- 0:00:37
359500 -- [-387.371] (-388.618) (-388.486) (-389.613) * (-388.331) (-390.110) (-386.439) [-388.138] -- 0:00:37
360000 -- (-387.893) (-386.980) [-388.191] (-388.483) * (-390.188) [-386.681] (-387.011) (-387.697) -- 0:00:39
Average standard deviation of split frequencies: 0.010456
360500 -- (-388.907) (-387.644) (-390.560) [-387.666] * (-387.963) [-387.886] (-391.209) (-389.179) -- 0:00:39
361000 -- [-388.679] (-387.446) (-387.642) (-390.644) * [-389.250] (-387.021) (-387.878) (-388.465) -- 0:00:38
361500 -- (-389.790) (-387.897) [-386.709] (-390.488) * (-390.318) [-388.330] (-389.052) (-386.250) -- 0:00:38
362000 -- (-395.712) (-387.402) (-387.959) [-388.999] * (-392.049) (-389.997) (-388.357) [-387.955] -- 0:00:38
362500 -- (-388.729) (-388.899) (-392.758) [-390.212] * (-390.022) (-389.760) [-388.293] (-387.406) -- 0:00:38
363000 -- [-387.656] (-388.268) (-386.784) (-387.482) * [-388.793] (-388.237) (-392.273) (-389.145) -- 0:00:38
363500 -- (-388.003) (-386.683) (-387.795) [-388.764] * (-386.700) [-388.631] (-387.975) (-387.840) -- 0:00:38
364000 -- (-389.613) (-388.361) (-389.195) [-387.384] * (-390.225) (-389.491) [-387.477] (-387.706) -- 0:00:38
364500 -- (-387.456) (-389.783) [-386.788] (-391.042) * [-387.500] (-390.120) (-388.324) (-386.363) -- 0:00:38
365000 -- [-390.784] (-390.070) (-390.748) (-389.221) * (-386.963) (-391.439) [-389.395] (-389.278) -- 0:00:38
Average standard deviation of split frequencies: 0.010046
365500 -- (-393.082) [-389.231] (-387.124) (-389.039) * (-387.582) [-389.299] (-387.558) (-393.118) -- 0:00:38
366000 -- (-386.976) [-390.755] (-386.687) (-390.767) * (-390.319) [-387.655] (-387.477) (-386.673) -- 0:00:38
366500 -- (-390.705) [-390.620] (-386.818) (-389.573) * (-389.208) (-388.299) (-389.532) [-389.396] -- 0:00:38
367000 -- [-390.222] (-390.134) (-389.826) (-386.908) * (-388.496) [-388.833] (-386.847) (-387.769) -- 0:00:37
367500 -- [-390.776] (-387.164) (-387.782) (-387.979) * (-388.275) [-387.118] (-386.729) (-387.654) -- 0:00:37
368000 -- [-390.190] (-387.904) (-392.331) (-388.596) * (-392.617) [-390.277] (-389.972) (-388.199) -- 0:00:37
368500 -- (-387.493) [-390.809] (-394.211) (-390.828) * [-390.465] (-387.592) (-386.819) (-390.124) -- 0:00:37
369000 -- (-386.239) [-388.940] (-388.386) (-388.533) * (-386.232) [-388.983] (-388.613) (-388.766) -- 0:00:37
369500 -- [-390.215] (-389.139) (-390.236) (-390.186) * (-387.389) (-389.628) [-388.199] (-387.202) -- 0:00:37
370000 -- (-391.833) [-387.854] (-387.620) (-387.961) * (-389.896) (-396.808) (-391.607) [-388.443] -- 0:00:37
Average standard deviation of split frequencies: 0.009750
370500 -- [-391.271] (-390.831) (-391.893) (-387.584) * (-388.180) (-395.744) (-386.640) [-387.851] -- 0:00:37
371000 -- (-391.092) (-389.432) (-390.658) [-387.429] * (-387.228) (-387.406) (-390.476) [-387.039] -- 0:00:37
371500 -- (-388.232) (-389.521) [-388.562] (-386.450) * [-388.416] (-388.207) (-391.979) (-387.401) -- 0:00:37
372000 -- (-388.955) (-389.203) [-387.859] (-389.549) * (-389.989) [-387.674] (-389.847) (-388.777) -- 0:00:37
372500 -- (-386.476) (-387.858) [-389.297] (-396.712) * (-386.830) [-387.282] (-390.891) (-389.825) -- 0:00:37
373000 -- [-391.349] (-389.447) (-392.308) (-389.900) * [-387.569] (-392.973) (-388.839) (-387.955) -- 0:00:36
373500 -- (-388.661) [-388.741] (-388.791) (-390.306) * [-389.095] (-387.780) (-391.255) (-392.647) -- 0:00:36
374000 -- (-388.637) [-387.401] (-390.085) (-392.440) * (-390.001) (-388.011) [-387.611] (-389.183) -- 0:00:36
374500 -- (-387.873) (-388.240) [-386.747] (-387.144) * (-389.685) (-387.585) [-389.081] (-387.699) -- 0:00:36
375000 -- [-387.428] (-388.871) (-386.630) (-393.249) * (-389.440) (-386.597) [-392.857] (-391.566) -- 0:00:36
Average standard deviation of split frequencies: 0.009361
375500 -- (-386.399) (-386.729) [-387.968] (-390.905) * (-389.095) (-389.959) [-392.719] (-391.249) -- 0:00:36
376000 -- [-387.148] (-388.330) (-392.588) (-392.243) * [-390.320] (-391.939) (-391.975) (-390.455) -- 0:00:36
376500 -- [-387.680] (-387.117) (-390.606) (-386.780) * (-390.050) (-393.753) [-387.632] (-392.269) -- 0:00:36
377000 -- [-387.424] (-388.545) (-391.400) (-389.108) * (-389.872) [-391.034] (-387.447) (-387.990) -- 0:00:38
377500 -- [-390.213] (-389.009) (-387.671) (-391.770) * (-387.754) (-391.515) [-388.274] (-389.890) -- 0:00:37
378000 -- (-388.837) (-387.129) [-386.517] (-386.968) * (-386.883) (-388.003) (-386.643) [-389.802] -- 0:00:37
378500 -- (-391.812) (-388.052) [-388.808] (-387.629) * [-388.058] (-389.242) (-388.765) (-387.025) -- 0:00:37
379000 -- (-388.893) (-386.294) (-390.216) [-386.986] * (-389.436) [-386.193] (-387.712) (-389.230) -- 0:00:37
379500 -- (-386.274) (-393.407) [-386.705] (-389.641) * (-388.511) (-386.695) (-386.843) [-389.678] -- 0:00:37
380000 -- (-391.830) (-390.964) [-390.264] (-388.646) * (-387.751) (-389.108) (-388.783) [-387.721] -- 0:00:37
Average standard deviation of split frequencies: 0.008999
380500 -- [-387.854] (-387.529) (-388.222) (-389.605) * (-386.851) (-390.156) (-386.832) [-388.829] -- 0:00:37
381000 -- [-390.568] (-386.249) (-386.858) (-387.525) * (-388.624) [-386.715] (-387.702) (-394.438) -- 0:00:37
381500 -- (-387.590) (-387.826) [-388.304] (-387.890) * (-390.337) (-389.006) (-386.463) [-392.490] -- 0:00:37
382000 -- [-392.333] (-391.250) (-392.349) (-388.815) * (-390.548) [-392.293] (-387.530) (-386.336) -- 0:00:37
382500 -- (-389.759) [-386.282] (-386.794) (-388.496) * (-386.197) (-387.780) (-387.391) [-387.078] -- 0:00:37
383000 -- (-394.824) (-388.374) (-393.041) [-387.485] * (-387.155) (-387.409) [-390.263] (-387.792) -- 0:00:37
383500 -- (-389.133) [-389.331] (-389.197) (-386.955) * (-390.767) (-390.859) (-392.237) [-389.452] -- 0:00:36
384000 -- (-394.626) [-390.792] (-389.571) (-387.552) * (-388.310) (-388.486) [-387.500] (-388.739) -- 0:00:36
384500 -- (-387.869) (-391.699) (-389.126) [-390.796] * (-388.929) (-387.204) [-390.011] (-389.747) -- 0:00:36
385000 -- [-389.099] (-388.637) (-394.255) (-388.348) * [-389.940] (-390.143) (-388.319) (-391.587) -- 0:00:36
Average standard deviation of split frequencies: 0.008793
385500 -- [-389.069] (-386.939) (-388.209) (-387.919) * [-387.194] (-387.552) (-387.821) (-390.560) -- 0:00:36
386000 -- (-388.645) [-387.852] (-390.240) (-386.644) * [-387.943] (-386.616) (-387.843) (-390.326) -- 0:00:36
386500 -- (-387.467) (-387.983) (-389.833) [-386.426] * (-386.415) (-388.153) [-388.554] (-389.578) -- 0:00:36
387000 -- (-389.303) (-392.078) (-388.164) [-388.931] * (-387.350) [-386.622] (-388.869) (-389.238) -- 0:00:36
387500 -- (-389.336) [-393.113] (-389.868) (-387.036) * (-386.910) (-387.343) (-390.828) [-390.226] -- 0:00:36
388000 -- [-386.984] (-389.682) (-391.654) (-388.562) * (-388.164) [-387.355] (-389.685) (-388.584) -- 0:00:36
388500 -- (-389.227) (-388.036) (-392.104) [-388.699] * (-387.786) (-388.648) (-386.205) [-386.880] -- 0:00:36
389000 -- [-387.656] (-388.033) (-390.091) (-386.079) * (-388.629) (-387.531) [-388.305] (-386.833) -- 0:00:36
389500 -- (-388.235) [-388.099] (-387.306) (-387.073) * (-392.623) (-387.943) (-390.512) [-387.215] -- 0:00:36
390000 -- [-390.165] (-391.569) (-386.239) (-390.187) * (-392.503) (-389.605) [-387.462] (-386.692) -- 0:00:35
Average standard deviation of split frequencies: 0.008929
390500 -- (-387.576) (-390.023) (-387.806) [-394.896] * (-394.190) [-389.555] (-386.755) (-387.666) -- 0:00:35
391000 -- (-387.337) (-390.772) [-387.827] (-389.312) * [-389.773] (-386.949) (-389.460) (-388.668) -- 0:00:35
391500 -- [-388.002] (-388.689) (-388.367) (-389.220) * [-390.861] (-388.213) (-392.455) (-386.411) -- 0:00:35
392000 -- (-390.463) (-388.661) (-387.284) [-389.079] * (-388.240) [-386.838] (-396.152) (-385.991) -- 0:00:35
392500 -- (-388.692) [-387.478] (-386.721) (-389.282) * (-387.872) [-387.078] (-387.842) (-387.140) -- 0:00:35
393000 -- (-389.733) (-392.460) [-388.642] (-390.509) * (-389.674) (-385.994) (-386.307) [-389.973] -- 0:00:35
393500 -- (-386.836) (-389.239) [-386.999] (-388.930) * (-388.015) (-387.450) (-388.378) [-389.719] -- 0:00:35
394000 -- (-388.060) (-386.991) [-386.764] (-389.915) * (-388.884) (-388.223) [-387.436] (-388.101) -- 0:00:36
394500 -- [-389.161] (-387.434) (-390.171) (-392.995) * (-398.600) (-387.283) (-391.200) [-389.185] -- 0:00:36
395000 -- (-389.257) (-388.527) [-390.293] (-392.507) * (-388.656) [-389.124] (-392.129) (-391.328) -- 0:00:36
Average standard deviation of split frequencies: 0.008968
395500 -- (-386.955) (-387.352) (-391.196) [-387.420] * (-388.068) [-387.974] (-389.067) (-388.058) -- 0:00:36
396000 -- (-388.153) (-387.614) (-389.609) [-387.778] * (-389.326) (-388.309) (-389.565) [-387.417] -- 0:00:36
396500 -- (-386.852) [-388.426] (-386.826) (-392.240) * (-388.816) [-388.527] (-393.319) (-387.411) -- 0:00:36
397000 -- (-387.755) (-387.188) (-387.735) [-390.778] * [-389.524] (-389.693) (-390.001) (-388.759) -- 0:00:36
397500 -- [-390.718] (-389.282) (-387.521) (-388.196) * (-389.306) [-386.144] (-388.669) (-388.107) -- 0:00:36
398000 -- [-387.311] (-388.454) (-388.131) (-389.431) * [-389.258] (-388.466) (-385.983) (-390.858) -- 0:00:36
398500 -- (-389.297) (-388.643) [-391.047] (-389.527) * [-387.204] (-389.398) (-387.514) (-386.221) -- 0:00:36
399000 -- (-391.218) [-387.322] (-388.661) (-388.025) * (-388.807) [-386.828] (-386.195) (-386.869) -- 0:00:36
399500 -- (-387.593) (-389.640) [-387.100] (-386.893) * [-388.887] (-387.544) (-386.456) (-390.103) -- 0:00:36
400000 -- (-388.754) [-389.868] (-390.464) (-389.161) * (-388.648) (-387.248) (-386.942) [-392.535] -- 0:00:36
Average standard deviation of split frequencies: 0.008824
400500 -- (-388.153) [-389.899] (-389.125) (-390.444) * [-389.670] (-389.451) (-392.176) (-389.217) -- 0:00:35
401000 -- (-387.455) (-388.761) [-389.532] (-389.308) * (-386.250) (-391.121) (-395.011) [-387.051] -- 0:00:35
401500 -- [-393.591] (-391.126) (-389.764) (-389.587) * (-393.451) (-390.990) (-388.098) [-387.471] -- 0:00:35
402000 -- (-388.830) [-389.835] (-388.322) (-390.378) * (-393.139) [-387.763] (-390.183) (-386.499) -- 0:00:35
402500 -- (-389.652) (-387.631) (-388.033) [-386.322] * (-387.818) [-390.125] (-387.847) (-387.238) -- 0:00:35
403000 -- (-388.020) [-389.617] (-393.287) (-387.123) * (-387.761) (-388.776) (-388.207) [-388.578] -- 0:00:35
403500 -- (-388.608) (-386.823) [-386.737] (-391.898) * (-386.386) (-388.500) [-388.465] (-388.720) -- 0:00:35
404000 -- (-388.922) (-388.729) (-389.051) [-389.608] * (-390.207) [-387.292] (-391.111) (-390.497) -- 0:00:35
404500 -- (-389.795) (-389.376) [-388.451] (-392.073) * (-387.059) [-387.030] (-387.251) (-391.676) -- 0:00:35
405000 -- (-389.982) (-388.209) [-386.666] (-390.559) * [-386.841] (-386.735) (-395.724) (-387.293) -- 0:00:35
Average standard deviation of split frequencies: 0.008264
405500 -- (-386.353) [-388.837] (-389.455) (-388.341) * [-388.114] (-389.039) (-390.596) (-388.194) -- 0:00:35
406000 -- (-388.923) (-387.999) (-387.360) [-388.047] * (-392.523) (-388.992) (-388.174) [-389.309] -- 0:00:35
406500 -- (-388.103) [-386.593] (-387.544) (-387.110) * [-386.713] (-392.080) (-387.871) (-389.421) -- 0:00:35
407000 -- (-388.609) (-386.026) (-387.862) [-388.818] * (-387.008) [-389.681] (-390.428) (-387.166) -- 0:00:34
407500 -- (-386.704) [-387.048] (-390.656) (-386.989) * (-388.447) (-389.942) (-388.966) [-387.579] -- 0:00:34
408000 -- (-386.496) [-398.657] (-395.004) (-388.307) * (-387.838) (-387.233) [-388.391] (-387.516) -- 0:00:34
408500 -- [-386.722] (-400.153) (-386.424) (-389.150) * [-388.653] (-388.062) (-394.817) (-388.111) -- 0:00:34
409000 -- (-388.480) (-390.842) [-387.488] (-386.653) * (-389.120) (-392.652) [-386.745] (-389.444) -- 0:00:34
409500 -- (-388.958) (-388.996) [-386.386] (-390.059) * [-386.327] (-391.061) (-387.248) (-386.993) -- 0:00:34
410000 -- (-395.978) (-389.526) (-387.235) [-388.389] * (-389.041) (-389.255) (-387.260) [-387.021] -- 0:00:34
Average standard deviation of split frequencies: 0.008440
410500 -- (-386.435) [-388.238] (-387.644) (-389.985) * [-389.439] (-389.470) (-387.799) (-387.210) -- 0:00:34
411000 -- (-390.323) (-387.944) [-387.300] (-387.375) * [-389.816] (-389.726) (-387.575) (-394.071) -- 0:00:35
411500 -- (-388.733) [-386.527] (-387.470) (-387.518) * [-388.493] (-388.062) (-387.913) (-389.460) -- 0:00:35
412000 -- [-386.829] (-386.359) (-391.745) (-387.755) * [-387.639] (-386.827) (-386.820) (-386.248) -- 0:00:35
412500 -- (-387.754) [-386.833] (-387.965) (-390.039) * [-388.660] (-389.760) (-386.644) (-390.169) -- 0:00:35
413000 -- (-388.490) (-389.038) (-392.117) [-388.847] * (-386.407) (-387.853) [-388.703] (-390.278) -- 0:00:35
413500 -- (-389.575) (-396.637) [-388.279] (-388.810) * (-393.031) (-387.978) [-388.310] (-389.454) -- 0:00:35
414000 -- [-387.392] (-387.649) (-387.150) (-387.890) * [-389.333] (-386.675) (-388.844) (-390.675) -- 0:00:35
414500 -- (-387.497) (-388.334) (-388.164) [-388.895] * (-391.934) (-388.294) [-387.083] (-386.635) -- 0:00:35
415000 -- (-388.008) (-386.745) (-389.611) [-388.957] * (-386.357) (-386.727) (-391.495) [-387.828] -- 0:00:35
Average standard deviation of split frequencies: 0.008711
415500 -- [-388.089] (-389.698) (-390.113) (-392.902) * (-386.898) (-386.718) (-388.569) [-387.914] -- 0:00:35
416000 -- (-387.082) [-389.162] (-387.316) (-387.147) * (-387.699) (-391.945) [-392.729] (-390.711) -- 0:00:35
416500 -- (-389.238) (-386.443) (-386.944) [-387.884] * [-389.136] (-391.792) (-390.793) (-390.514) -- 0:00:35
417000 -- (-388.129) (-391.849) [-389.814] (-388.920) * [-386.910] (-389.034) (-387.187) (-386.429) -- 0:00:34
417500 -- (-387.658) [-386.249] (-388.938) (-388.224) * [-386.979] (-389.960) (-388.701) (-386.434) -- 0:00:34
418000 -- (-390.420) [-387.097] (-388.041) (-388.777) * [-389.350] (-387.573) (-391.026) (-386.156) -- 0:00:34
418500 -- [-388.167] (-386.851) (-390.011) (-390.387) * (-393.588) [-390.521] (-389.079) (-394.723) -- 0:00:34
419000 -- [-389.077] (-389.437) (-392.111) (-387.615) * [-391.001] (-386.917) (-388.553) (-386.258) -- 0:00:34
419500 -- (-388.316) (-388.855) [-389.241] (-387.979) * (-388.836) (-390.866) (-390.208) [-388.459] -- 0:00:34
420000 -- (-386.937) [-397.301] (-387.536) (-387.777) * (-387.299) (-390.650) [-387.820] (-387.028) -- 0:00:34
Average standard deviation of split frequencies: 0.008405
420500 -- [-388.090] (-393.142) (-388.796) (-389.614) * (-388.192) (-390.639) [-387.919] (-386.847) -- 0:00:34
421000 -- (-393.193) (-388.184) (-388.369) [-390.586] * (-389.452) (-389.963) [-390.207] (-387.965) -- 0:00:34
421500 -- (-389.928) (-388.676) [-388.273] (-390.401) * (-387.913) (-388.785) [-387.737] (-387.470) -- 0:00:34
422000 -- (-386.914) (-390.022) (-389.917) [-387.812] * (-387.293) (-387.980) [-387.062] (-389.188) -- 0:00:34
422500 -- (-386.347) (-388.155) (-387.538) [-392.853] * (-390.120) (-386.973) (-389.659) [-386.042] -- 0:00:34
423000 -- (-387.005) [-387.362] (-387.096) (-391.260) * (-388.952) (-391.124) (-389.165) [-389.282] -- 0:00:34
423500 -- (-387.331) (-387.208) (-390.210) [-389.016] * [-388.377] (-387.961) (-387.650) (-389.371) -- 0:00:34
424000 -- (-387.386) (-391.332) [-388.164] (-388.226) * (-388.257) [-387.544] (-388.597) (-390.537) -- 0:00:33
424500 -- [-386.713] (-387.673) (-389.298) (-387.325) * (-390.070) (-392.640) [-388.017] (-387.343) -- 0:00:33
425000 -- [-391.185] (-390.247) (-389.523) (-387.273) * (-386.932) (-393.670) (-388.598) [-387.845] -- 0:00:33
Average standard deviation of split frequencies: 0.008507
425500 -- (-388.442) (-388.988) [-388.839] (-390.090) * (-387.523) [-389.146] (-387.538) (-388.042) -- 0:00:33
426000 -- (-390.365) (-392.105) [-387.320] (-386.917) * (-386.688) (-390.337) [-387.695] (-387.551) -- 0:00:33
426500 -- (-391.679) (-392.735) [-387.974] (-395.920) * [-389.310] (-391.130) (-390.168) (-388.748) -- 0:00:33
427000 -- (-393.822) [-388.344] (-389.226) (-394.078) * (-392.057) (-390.211) (-389.505) [-387.325] -- 0:00:33
427500 -- (-386.229) [-388.119] (-389.900) (-386.722) * (-387.106) (-389.545) [-389.139] (-389.876) -- 0:00:34
428000 -- (-386.052) (-386.767) [-387.951] (-387.967) * (-386.108) (-386.854) (-387.484) [-387.591] -- 0:00:34
428500 -- [-386.090] (-390.342) (-386.711) (-389.109) * (-386.375) (-387.677) (-387.234) [-387.654] -- 0:00:34
429000 -- [-386.289] (-387.410) (-388.029) (-387.154) * (-393.371) [-388.975] (-394.167) (-390.368) -- 0:00:34
429500 -- (-387.016) (-389.300) (-389.037) [-389.396] * (-387.632) (-394.558) (-389.193) [-388.241] -- 0:00:34
430000 -- (-388.410) [-392.401] (-390.483) (-389.625) * (-386.725) [-387.600] (-390.590) (-386.041) -- 0:00:34
Average standard deviation of split frequencies: 0.008141
430500 -- (-386.978) [-388.459] (-388.886) (-387.789) * (-386.347) (-391.252) (-387.666) [-387.206] -- 0:00:34
431000 -- (-386.452) (-387.987) (-388.247) [-387.152] * (-386.519) [-387.010] (-390.671) (-388.468) -- 0:00:34
431500 -- (-387.498) (-388.649) (-388.866) [-387.767] * (-389.329) [-388.666] (-389.433) (-388.523) -- 0:00:34
432000 -- [-387.505] (-389.517) (-388.471) (-388.260) * (-387.223) (-390.293) (-389.081) [-389.818] -- 0:00:34
432500 -- (-387.340) (-387.949) [-388.587] (-387.908) * (-387.158) (-391.587) (-387.311) [-387.120] -- 0:00:34
433000 -- (-386.996) [-388.586] (-388.615) (-388.772) * (-387.209) (-388.020) [-389.444] (-389.456) -- 0:00:34
433500 -- (-389.413) (-389.941) (-390.060) [-386.220] * (-387.841) [-389.015] (-390.883) (-389.822) -- 0:00:33
434000 -- [-389.069] (-387.867) (-390.176) (-387.947) * (-388.205) (-389.271) [-391.106] (-389.471) -- 0:00:33
434500 -- (-395.176) (-386.848) (-393.641) [-387.202] * (-389.385) (-386.869) [-388.372] (-387.787) -- 0:00:33
435000 -- (-389.402) (-386.936) (-389.652) [-388.700] * [-389.619] (-388.391) (-387.149) (-389.854) -- 0:00:33
Average standard deviation of split frequencies: 0.008204
435500 -- (-389.862) (-386.841) [-390.579] (-387.625) * (-392.036) [-388.824] (-386.324) (-387.193) -- 0:00:33
436000 -- (-387.052) (-387.712) [-387.146] (-388.580) * [-390.185] (-387.716) (-390.457) (-389.833) -- 0:00:33
436500 -- (-388.381) [-387.324] (-388.177) (-389.958) * (-386.817) (-386.758) [-392.457] (-389.959) -- 0:00:33
437000 -- (-386.441) [-388.104] (-388.940) (-389.211) * (-387.906) (-388.788) [-390.290] (-394.490) -- 0:00:33
437500 -- (-386.366) (-386.345) (-389.632) [-389.131] * (-387.891) (-386.843) (-389.175) [-388.117] -- 0:00:33
438000 -- (-387.314) (-387.696) [-387.224] (-391.647) * (-386.403) (-388.423) (-391.410) [-387.758] -- 0:00:33
438500 -- (-388.283) (-387.214) [-388.142] (-391.829) * [-386.713] (-388.159) (-389.043) (-388.263) -- 0:00:33
439000 -- [-394.254] (-387.886) (-389.628) (-392.165) * (-386.399) (-390.134) [-387.495] (-390.732) -- 0:00:33
439500 -- (-387.150) [-387.121] (-388.714) (-387.332) * (-387.694) [-388.845] (-390.695) (-388.955) -- 0:00:33
440000 -- (-386.831) (-390.263) [-386.407] (-389.260) * (-387.794) (-387.699) (-390.589) [-390.148] -- 0:00:33
Average standard deviation of split frequencies: 0.008059
440500 -- (-389.741) (-389.929) [-388.407] (-389.189) * (-389.144) [-387.890] (-391.780) (-394.477) -- 0:00:33
441000 -- (-387.044) [-388.504] (-390.780) (-391.009) * (-392.041) [-387.047] (-389.475) (-389.511) -- 0:00:32
441500 -- [-387.539] (-387.674) (-388.103) (-390.360) * (-386.597) (-390.920) [-390.223] (-389.004) -- 0:00:32
442000 -- (-386.950) (-389.104) [-391.523] (-387.425) * (-387.010) (-392.606) [-389.337] (-391.522) -- 0:00:32
442500 -- (-386.647) (-388.616) [-389.133] (-391.411) * (-388.234) (-390.761) [-390.173] (-388.308) -- 0:00:32
443000 -- [-390.903] (-391.067) (-387.655) (-393.621) * (-387.221) (-390.980) [-389.942] (-389.808) -- 0:00:32
443500 -- (-393.117) (-387.158) [-386.822] (-390.403) * (-386.910) [-387.121] (-387.594) (-391.167) -- 0:00:32
444000 -- (-389.637) (-387.345) [-388.966] (-389.999) * (-393.321) (-388.492) [-387.567] (-388.539) -- 0:00:32
444500 -- (-387.516) (-386.951) (-401.371) [-386.610] * (-389.362) (-387.790) (-391.064) [-386.753] -- 0:00:33
445000 -- (-391.949) (-388.201) (-391.984) [-389.007] * (-389.330) (-387.146) [-387.851] (-387.898) -- 0:00:33
Average standard deviation of split frequencies: 0.007993
445500 -- (-387.517) [-392.076] (-388.939) (-387.058) * [-392.500] (-386.909) (-389.003) (-394.201) -- 0:00:33
446000 -- (-391.274) (-393.336) (-387.978) [-386.645] * [-388.264] (-386.893) (-388.278) (-391.439) -- 0:00:33
446500 -- (-387.099) (-387.779) (-392.231) [-388.245] * [-386.515] (-386.357) (-390.508) (-387.971) -- 0:00:33
447000 -- (-388.784) [-386.344] (-387.731) (-390.801) * (-390.177) (-387.215) (-390.238) [-388.440] -- 0:00:33
447500 -- (-387.330) (-388.687) [-387.944] (-388.130) * (-388.814) [-390.517] (-388.890) (-392.319) -- 0:00:33
448000 -- (-389.661) (-387.565) [-387.306] (-389.765) * (-393.397) (-391.425) (-391.451) [-388.542] -- 0:00:33
448500 -- (-394.663) (-388.712) (-389.000) [-387.692] * [-388.209] (-389.686) (-388.924) (-389.155) -- 0:00:33
449000 -- (-399.367) (-387.239) (-386.565) [-387.928] * (-386.579) (-388.858) [-389.233] (-392.779) -- 0:00:33
449500 -- (-389.071) (-388.686) [-386.939] (-391.391) * [-388.110] (-390.163) (-392.331) (-389.401) -- 0:00:33
450000 -- (-386.836) (-392.250) [-386.562] (-390.921) * (-388.174) (-387.393) (-387.049) [-391.835] -- 0:00:33
Average standard deviation of split frequencies: 0.008237
450500 -- (-386.390) [-390.402] (-387.971) (-387.750) * [-388.365] (-388.431) (-387.151) (-386.253) -- 0:00:32
451000 -- [-387.756] (-386.734) (-386.268) (-387.553) * (-389.776) (-393.365) (-390.448) [-388.480] -- 0:00:32
451500 -- (-387.606) (-386.956) [-388.333] (-386.759) * [-393.032] (-389.608) (-389.271) (-387.625) -- 0:00:32
452000 -- [-386.304] (-387.234) (-392.275) (-387.326) * (-389.598) (-389.120) [-387.409] (-387.317) -- 0:00:32
452500 -- [-389.246] (-388.539) (-388.125) (-388.920) * [-387.986] (-390.063) (-389.588) (-390.061) -- 0:00:32
453000 -- (-391.668) (-393.695) [-389.410] (-389.110) * (-386.336) (-390.987) (-390.083) [-388.417] -- 0:00:32
453500 -- [-389.086] (-389.074) (-389.779) (-387.731) * (-388.369) (-391.096) (-386.633) [-392.018] -- 0:00:32
454000 -- (-392.887) [-386.702] (-388.769) (-389.947) * (-387.727) (-389.783) (-389.946) [-386.561] -- 0:00:32
454500 -- (-392.123) (-387.074) [-389.071] (-388.300) * (-386.708) (-390.522) [-387.269] (-386.411) -- 0:00:32
455000 -- (-388.817) (-386.683) (-388.564) [-387.544] * [-387.584] (-388.075) (-389.079) (-387.218) -- 0:00:32
Average standard deviation of split frequencies: 0.007947
455500 -- (-389.472) (-387.503) [-388.652] (-387.253) * (-387.607) (-386.911) (-386.586) [-387.299] -- 0:00:32
456000 -- (-387.912) (-387.442) (-386.712) [-389.483] * (-389.406) (-387.021) [-387.308] (-391.227) -- 0:00:32
456500 -- (-386.961) (-389.689) (-387.893) [-388.832] * [-394.924] (-390.486) (-388.871) (-387.221) -- 0:00:32
457000 -- (-387.680) [-386.272] (-387.741) (-388.596) * (-387.787) [-389.238] (-386.462) (-388.943) -- 0:00:32
457500 -- (-388.332) (-388.630) [-390.213] (-389.269) * (-389.045) (-387.991) (-388.431) [-387.929] -- 0:00:32
458000 -- (-387.420) [-389.536] (-387.780) (-389.227) * [-387.213] (-390.486) (-387.704) (-387.283) -- 0:00:31
458500 -- (-389.742) (-389.279) [-387.603] (-387.405) * (-390.978) (-389.816) [-387.152] (-389.887) -- 0:00:31
459000 -- (-387.695) (-393.854) (-388.258) [-387.549] * (-390.297) (-389.116) [-389.046] (-386.697) -- 0:00:31
459500 -- [-386.546] (-387.191) (-388.203) (-386.284) * (-389.552) [-386.643] (-387.468) (-388.033) -- 0:00:31
460000 -- (-389.983) (-388.175) [-389.130] (-386.493) * [-387.412] (-386.588) (-389.705) (-388.670) -- 0:00:31
Average standard deviation of split frequencies: 0.007914
460500 -- (-389.317) (-386.940) (-388.157) [-386.459] * [-387.725] (-387.532) (-388.553) (-390.684) -- 0:00:31
461000 -- (-387.057) (-389.087) [-387.718] (-391.951) * (-389.671) (-388.360) [-390.248] (-386.856) -- 0:00:32
461500 -- (-389.788) (-388.483) (-388.272) [-390.650] * (-387.739) [-390.754] (-387.599) (-387.626) -- 0:00:32
462000 -- [-388.094] (-393.659) (-386.786) (-386.344) * (-387.135) (-389.249) [-387.390] (-387.810) -- 0:00:32
462500 -- (-392.887) (-387.010) [-388.317] (-392.453) * [-387.507] (-389.481) (-387.464) (-386.674) -- 0:00:32
463000 -- (-388.939) (-387.719) [-386.819] (-388.399) * (-387.406) [-388.499] (-386.757) (-387.838) -- 0:00:32
463500 -- [-386.724] (-390.482) (-388.316) (-389.669) * (-387.553) [-387.136] (-386.601) (-389.258) -- 0:00:32
464000 -- (-386.661) (-386.114) (-387.531) [-386.988] * (-389.212) [-386.605] (-386.524) (-388.274) -- 0:00:32
464500 -- (-388.774) (-386.387) (-389.628) [-389.363] * (-388.786) (-388.223) [-386.505] (-387.672) -- 0:00:32
465000 -- (-386.949) [-386.733] (-389.400) (-387.732) * (-388.306) (-389.262) (-388.589) [-387.681] -- 0:00:32
Average standard deviation of split frequencies: 0.008156
465500 -- (-387.643) (-390.465) (-388.064) [-391.507] * [-389.475] (-388.285) (-387.765) (-387.144) -- 0:00:32
466000 -- (-386.398) (-386.616) [-388.883] (-388.510) * [-389.478] (-387.321) (-387.422) (-388.746) -- 0:00:32
466500 -- (-386.773) (-391.994) (-388.812) [-386.758] * (-388.865) (-387.937) (-386.785) [-387.024] -- 0:00:32
467000 -- (-391.240) [-389.880] (-388.860) (-389.647) * [-387.840] (-387.701) (-388.326) (-389.235) -- 0:00:31
467500 -- (-388.503) (-388.732) (-387.879) [-389.182] * [-388.708] (-387.407) (-386.997) (-388.695) -- 0:00:31
468000 -- (-391.082) [-386.636] (-388.196) (-389.393) * [-393.039] (-391.457) (-389.744) (-394.226) -- 0:00:31
468500 -- (-391.472) (-388.166) (-387.433) [-386.517] * (-391.742) (-390.327) (-389.379) [-387.089] -- 0:00:31
469000 -- (-388.861) (-388.435) (-388.795) [-386.909] * (-388.649) (-387.941) [-387.378] (-388.446) -- 0:00:31
469500 -- (-390.105) (-387.253) (-390.424) [-389.204] * (-388.466) (-390.710) (-387.112) [-386.433] -- 0:00:31
470000 -- [-392.193] (-386.876) (-393.799) (-388.137) * (-390.180) (-393.163) (-393.094) [-390.781] -- 0:00:31
Average standard deviation of split frequencies: 0.008955
470500 -- [-388.054] (-387.620) (-386.695) (-387.351) * (-388.717) (-387.579) (-386.656) [-387.131] -- 0:00:31
471000 -- (-393.793) (-387.630) [-388.780] (-390.577) * (-388.227) (-389.388) [-388.119] (-387.276) -- 0:00:31
471500 -- [-390.046] (-391.281) (-388.906) (-388.590) * (-390.823) (-388.421) [-388.048] (-386.276) -- 0:00:31
472000 -- (-390.405) [-389.292] (-388.331) (-388.027) * (-388.195) (-393.413) (-386.575) [-388.672] -- 0:00:31
472500 -- (-387.420) [-392.270] (-389.192) (-390.891) * (-390.144) (-389.001) (-386.309) [-386.378] -- 0:00:31
473000 -- (-390.299) (-388.977) [-386.254] (-391.907) * [-388.576] (-388.861) (-389.708) (-391.531) -- 0:00:31
473500 -- (-390.853) (-391.986) (-391.477) [-389.433] * [-388.128] (-388.330) (-388.425) (-388.006) -- 0:00:31
474000 -- (-388.823) (-392.304) (-388.804) [-389.236] * (-390.020) [-386.629] (-388.445) (-387.099) -- 0:00:31
474500 -- (-389.211) (-389.167) [-387.278] (-388.365) * [-388.770] (-387.437) (-391.667) (-391.182) -- 0:00:31
475000 -- (-387.355) [-390.761] (-387.852) (-388.899) * (-389.032) (-388.195) [-391.353] (-389.962) -- 0:00:30
Average standard deviation of split frequencies: 0.008789
475500 -- (-389.329) (-388.715) [-393.754] (-386.834) * (-388.898) (-392.668) (-389.526) [-387.166] -- 0:00:30
476000 -- (-389.300) (-387.401) (-390.957) [-390.825] * (-387.719) (-389.359) [-386.808] (-388.379) -- 0:00:30
476500 -- (-387.999) [-388.727] (-389.203) (-391.235) * (-390.485) (-390.875) [-387.812] (-390.622) -- 0:00:30
477000 -- (-386.921) (-392.082) [-387.865] (-389.286) * (-389.000) (-392.881) (-391.362) [-390.561] -- 0:00:30
477500 -- (-388.453) (-390.969) (-389.048) [-391.612] * (-386.989) (-387.716) (-389.844) [-391.843] -- 0:00:30
478000 -- (-390.043) (-389.063) [-393.320] (-387.316) * (-386.631) [-386.885] (-389.204) (-386.554) -- 0:00:31
478500 -- (-388.902) [-389.671] (-392.868) (-391.044) * (-387.396) [-387.985] (-387.940) (-388.572) -- 0:00:31
479000 -- (-388.694) (-386.245) [-387.024] (-389.445) * (-388.689) (-387.379) (-391.339) [-388.938] -- 0:00:31
479500 -- (-389.458) [-386.679] (-386.905) (-387.432) * (-387.602) (-388.558) [-387.356] (-387.345) -- 0:00:31
480000 -- (-389.413) (-389.475) [-387.486] (-387.403) * [-388.064] (-394.109) (-389.584) (-388.454) -- 0:00:31
Average standard deviation of split frequencies: 0.008643
480500 -- (-389.023) (-389.268) (-386.447) [-387.667] * (-388.603) [-389.565] (-388.616) (-386.214) -- 0:00:31
481000 -- (-386.340) [-387.118] (-386.804) (-388.176) * (-388.830) [-386.656] (-388.634) (-386.074) -- 0:00:31
481500 -- [-388.191] (-388.774) (-392.630) (-386.908) * (-389.622) (-387.703) (-388.904) [-391.477] -- 0:00:31
482000 -- (-387.362) (-388.372) [-387.503] (-388.535) * (-392.086) [-387.467] (-388.908) (-387.498) -- 0:00:31
482500 -- (-390.810) (-389.334) [-387.122] (-388.080) * [-387.371] (-387.403) (-391.495) (-388.014) -- 0:00:31
483000 -- [-391.730] (-389.854) (-387.455) (-388.593) * [-390.188] (-386.475) (-386.971) (-387.548) -- 0:00:31
483500 -- (-387.368) (-391.921) (-389.235) [-389.481] * (-391.663) (-388.519) [-390.398] (-389.995) -- 0:00:30
484000 -- (-387.180) (-387.724) (-388.913) [-391.111] * (-386.404) (-387.534) [-387.528] (-388.844) -- 0:00:30
484500 -- (-390.179) [-389.060] (-387.204) (-389.925) * [-387.707] (-388.276) (-391.728) (-387.727) -- 0:00:30
485000 -- (-387.478) (-389.449) [-386.282] (-392.113) * (-394.845) [-388.520] (-392.425) (-387.963) -- 0:00:30
Average standard deviation of split frequencies: 0.009015
485500 -- [-387.418] (-386.834) (-387.459) (-390.542) * [-391.309] (-388.279) (-392.769) (-388.025) -- 0:00:30
486000 -- (-387.980) (-387.389) (-389.231) [-388.821] * (-387.526) [-390.265] (-390.329) (-389.701) -- 0:00:30
486500 -- [-389.530] (-388.592) (-387.976) (-391.263) * [-386.201] (-388.403) (-386.833) (-391.855) -- 0:00:30
487000 -- (-388.186) (-387.108) [-388.688] (-386.339) * (-386.382) (-392.140) (-387.701) [-388.006] -- 0:00:30
487500 -- (-388.648) (-388.317) (-392.752) [-391.637] * (-388.118) (-395.227) (-387.073) [-387.272] -- 0:00:30
488000 -- (-386.508) (-387.281) (-391.024) [-386.244] * (-387.451) [-389.456] (-387.962) (-393.632) -- 0:00:30
488500 -- (-391.336) (-391.614) [-388.104] (-387.330) * (-390.365) (-389.412) [-387.528] (-387.738) -- 0:00:30
489000 -- (-388.526) (-387.006) (-391.930) [-389.555] * (-386.491) [-389.775] (-390.571) (-387.895) -- 0:00:30
489500 -- [-387.743] (-388.818) (-388.359) (-388.278) * (-389.790) [-389.024] (-390.061) (-389.567) -- 0:00:30
490000 -- (-388.291) (-390.094) [-388.689] (-390.086) * (-393.808) (-389.371) (-390.520) [-387.284] -- 0:00:30
Average standard deviation of split frequencies: 0.008707
490500 -- [-388.104] (-386.355) (-387.408) (-390.165) * [-389.093] (-395.593) (-391.205) (-387.548) -- 0:00:30
491000 -- (-391.541) [-386.963] (-387.563) (-388.630) * [-388.972] (-388.640) (-390.014) (-387.872) -- 0:00:30
491500 -- (-387.477) (-387.545) [-389.652] (-387.784) * (-388.564) (-386.678) (-388.299) [-389.361] -- 0:00:30
492000 -- (-388.252) (-386.006) [-390.048] (-387.025) * (-389.700) (-389.684) [-387.022] (-389.280) -- 0:00:29
492500 -- [-387.895] (-386.186) (-389.542) (-386.465) * [-388.659] (-387.516) (-388.295) (-389.772) -- 0:00:29
493000 -- (-388.621) (-387.041) (-388.720) [-386.854] * (-388.996) (-389.729) [-388.610] (-390.394) -- 0:00:29
493500 -- (-391.806) (-391.457) (-389.111) [-387.967] * [-390.614] (-390.784) (-388.834) (-388.911) -- 0:00:29
494000 -- (-393.015) (-392.164) (-389.784) [-389.017] * (-388.551) [-388.940] (-388.740) (-389.568) -- 0:00:29
494500 -- (-393.212) (-388.947) [-388.513] (-386.652) * (-389.068) [-389.773] (-387.136) (-388.688) -- 0:00:30
495000 -- (-389.512) [-389.561] (-387.699) (-386.999) * (-388.188) (-388.653) (-386.363) [-387.009] -- 0:00:30
Average standard deviation of split frequencies: 0.009385
495500 -- [-388.338] (-386.114) (-393.148) (-387.182) * (-389.257) (-387.863) (-389.896) [-386.374] -- 0:00:30
496000 -- (-388.696) (-387.071) (-391.630) [-387.457] * (-388.504) (-390.037) [-395.424] (-386.558) -- 0:00:30
496500 -- (-386.844) (-389.008) (-389.118) [-388.267] * (-388.267) [-388.250] (-394.222) (-388.321) -- 0:00:30
497000 -- (-388.822) (-389.725) (-389.495) [-389.007] * [-389.576] (-387.669) (-392.470) (-387.335) -- 0:00:30
497500 -- (-387.875) (-389.497) (-387.418) [-389.758] * (-389.674) (-386.895) [-390.543] (-388.099) -- 0:00:30
498000 -- (-387.557) [-392.365] (-388.283) (-387.486) * (-387.077) (-389.675) (-388.310) [-386.539] -- 0:00:30
498500 -- [-388.623] (-389.465) (-390.125) (-386.911) * (-386.865) (-389.807) [-386.408] (-387.911) -- 0:00:30
499000 -- [-389.146] (-390.387) (-387.938) (-388.170) * [-388.032] (-386.789) (-386.448) (-388.153) -- 0:00:30
499500 -- (-386.900) (-387.406) [-387.515] (-391.524) * (-390.745) [-386.897] (-387.628) (-389.111) -- 0:00:30
500000 -- (-386.556) [-387.806] (-389.257) (-388.535) * [-388.447] (-386.456) (-387.944) (-388.569) -- 0:00:30
Average standard deviation of split frequencies: 0.009474
500500 -- (-389.879) (-387.121) [-387.539] (-388.735) * [-387.429] (-388.171) (-386.497) (-392.318) -- 0:00:29
501000 -- (-388.934) (-387.059) (-389.714) [-386.843] * (-387.377) [-388.755] (-387.893) (-390.697) -- 0:00:29
501500 -- (-391.577) (-386.739) (-388.912) [-387.618] * (-388.760) (-388.449) [-387.551] (-388.523) -- 0:00:29
502000 -- (-387.702) (-391.097) [-387.007] (-387.944) * (-389.101) (-391.363) (-391.120) [-387.181] -- 0:00:29
502500 -- [-388.378] (-391.279) (-386.364) (-386.384) * [-387.760] (-386.793) (-392.504) (-387.875) -- 0:00:29
503000 -- (-386.900) (-389.323) (-387.518) [-388.025] * (-387.356) (-386.930) [-389.018] (-388.638) -- 0:00:29
503500 -- [-387.007] (-388.471) (-387.130) (-389.150) * (-387.443) (-386.403) (-390.842) [-387.029] -- 0:00:29
504000 -- (-388.281) (-390.655) [-386.321] (-387.186) * [-389.868] (-388.119) (-391.751) (-389.330) -- 0:00:29
504500 -- (-390.933) [-387.379] (-388.462) (-386.875) * [-390.589] (-386.370) (-388.129) (-387.390) -- 0:00:29
505000 -- (-389.673) (-387.964) (-389.567) [-390.976] * (-388.149) [-387.151] (-393.687) (-388.136) -- 0:00:29
Average standard deviation of split frequencies: 0.008792
505500 -- (-391.280) (-387.722) (-387.473) [-387.187] * (-390.222) (-389.229) (-390.075) [-386.122] -- 0:00:29
506000 -- (-389.722) (-389.164) [-388.600] (-386.845) * (-389.409) (-389.454) [-387.591] (-386.952) -- 0:00:29
506500 -- [-387.197] (-386.521) (-388.232) (-387.501) * [-389.108] (-390.346) (-386.141) (-399.663) -- 0:00:29
507000 -- (-387.470) (-386.708) (-388.179) [-387.098] * (-386.732) (-387.690) [-386.772] (-386.843) -- 0:00:29
507500 -- (-388.109) [-387.660] (-391.289) (-386.493) * [-386.954] (-388.899) (-389.228) (-387.230) -- 0:00:29
508000 -- (-391.658) (-391.255) (-390.855) [-391.403] * (-388.514) (-387.507) (-389.486) [-389.981] -- 0:00:29
508500 -- (-386.256) [-387.198] (-386.809) (-392.804) * (-387.983) [-388.529] (-389.889) (-392.781) -- 0:00:28
509000 -- (-388.943) (-387.343) [-393.808] (-391.021) * (-390.999) (-387.566) [-387.464] (-389.052) -- 0:00:28
509500 -- [-386.781] (-388.234) (-390.140) (-392.568) * (-389.349) (-389.421) [-389.120] (-389.715) -- 0:00:28
510000 -- [-387.094] (-386.471) (-389.834) (-387.791) * (-388.022) (-389.470) (-386.903) [-387.351] -- 0:00:28
Average standard deviation of split frequencies: 0.009347
510500 -- (-388.854) [-386.336] (-391.039) (-391.726) * [-388.046] (-390.005) (-387.147) (-387.896) -- 0:00:28
511000 -- [-390.292] (-387.384) (-386.784) (-389.976) * (-388.337) [-388.923] (-388.919) (-389.323) -- 0:00:28
511500 -- (-391.283) [-387.129] (-387.724) (-392.097) * (-388.419) (-390.050) (-389.094) [-388.228] -- 0:00:29
512000 -- (-389.159) [-386.660] (-387.032) (-389.742) * (-387.904) (-388.959) [-388.416] (-387.209) -- 0:00:29
512500 -- (-387.907) (-389.570) (-388.433) [-390.320] * (-389.579) [-386.591] (-388.515) (-387.718) -- 0:00:29
513000 -- [-391.571] (-388.857) (-387.774) (-390.574) * [-386.894] (-386.317) (-386.397) (-387.126) -- 0:00:29
513500 -- (-387.553) (-388.108) (-387.937) [-387.669] * (-389.065) (-386.660) [-389.741] (-390.624) -- 0:00:29
514000 -- (-389.019) (-388.412) [-386.728] (-388.822) * [-387.413] (-387.025) (-391.629) (-388.795) -- 0:00:29
514500 -- (-388.188) [-388.329] (-389.465) (-386.554) * (-388.988) [-387.025] (-390.425) (-390.289) -- 0:00:29
515000 -- [-389.486] (-394.126) (-389.792) (-388.680) * [-389.264] (-386.896) (-389.950) (-389.120) -- 0:00:29
Average standard deviation of split frequencies: 0.008964
515500 -- (-388.307) [-387.294] (-387.704) (-390.552) * [-389.628] (-386.278) (-387.343) (-386.221) -- 0:00:29
516000 -- (-387.068) (-388.778) [-387.209] (-387.696) * (-391.022) (-386.825) [-387.398] (-387.949) -- 0:00:29
516500 -- (-387.421) (-390.929) [-386.978] (-386.501) * (-392.733) [-386.340] (-387.815) (-388.736) -- 0:00:29
517000 -- (-387.369) (-390.903) [-388.875] (-387.352) * (-391.175) [-388.041] (-389.868) (-389.702) -- 0:00:28
517500 -- (-387.803) (-388.170) [-389.552] (-387.361) * [-388.521] (-390.273) (-388.660) (-388.889) -- 0:00:28
518000 -- [-387.869] (-387.991) (-390.130) (-389.502) * (-386.792) [-389.948] (-390.867) (-390.319) -- 0:00:28
518500 -- (-389.535) [-387.805] (-389.583) (-390.848) * [-387.845] (-388.378) (-386.883) (-387.249) -- 0:00:28
519000 -- (-389.543) (-389.666) [-391.263] (-387.262) * [-386.661] (-388.022) (-387.496) (-386.997) -- 0:00:28
519500 -- (-386.213) (-390.093) (-392.585) [-387.423] * (-387.548) [-391.366] (-388.904) (-390.392) -- 0:00:28
520000 -- [-386.294] (-389.702) (-387.815) (-390.110) * (-388.794) [-391.198] (-390.505) (-390.147) -- 0:00:28
Average standard deviation of split frequencies: 0.008658
520500 -- (-390.760) (-388.837) [-388.224] (-388.494) * (-389.908) (-395.454) (-392.157) [-391.429] -- 0:00:28
521000 -- (-387.034) (-388.497) [-387.856] (-386.398) * (-390.083) (-388.805) (-388.584) [-391.268] -- 0:00:28
521500 -- (-388.314) [-390.189] (-387.943) (-388.083) * (-388.373) [-387.560] (-390.567) (-391.677) -- 0:00:28
522000 -- (-388.825) (-389.715) (-388.696) [-387.782] * [-386.928] (-387.233) (-389.750) (-391.405) -- 0:00:28
522500 -- (-388.433) (-387.033) [-389.118] (-387.421) * (-386.431) (-389.012) [-388.635] (-388.328) -- 0:00:28
523000 -- [-388.353] (-388.233) (-388.997) (-387.815) * [-387.120] (-387.276) (-388.968) (-387.835) -- 0:00:28
523500 -- (-386.912) (-388.510) [-386.191] (-388.162) * (-387.242) (-387.266) (-389.619) [-387.155] -- 0:00:28
524000 -- (-386.961) (-386.463) (-387.215) [-387.984] * (-387.968) (-388.243) [-388.336] (-388.154) -- 0:00:28
524500 -- (-391.020) (-387.379) (-390.817) [-386.076] * (-391.901) (-388.317) [-393.484] (-388.384) -- 0:00:28
525000 -- (-390.951) (-387.204) [-388.865] (-389.815) * (-388.500) (-389.435) (-390.877) [-387.275] -- 0:00:28
Average standard deviation of split frequencies: 0.009141
525500 -- (-387.047) (-386.406) (-389.042) [-390.413] * (-386.777) [-387.642] (-387.265) (-388.744) -- 0:00:27
526000 -- (-386.512) (-388.047) (-393.828) [-387.571] * (-391.386) (-389.863) (-389.083) [-387.138] -- 0:00:27
526500 -- (-388.289) (-389.986) (-391.225) [-388.984] * (-387.224) (-386.647) [-389.615] (-390.119) -- 0:00:27
527000 -- [-386.593] (-387.091) (-387.553) (-388.843) * (-387.196) (-389.007) [-387.539] (-389.904) -- 0:00:27
527500 -- (-391.644) (-387.025) (-388.426) [-388.555] * (-387.604) (-390.741) [-386.909] (-391.952) -- 0:00:27
528000 -- (-387.614) (-388.761) (-389.761) [-387.614] * [-388.086] (-390.340) (-389.404) (-389.051) -- 0:00:27
528500 -- [-392.291] (-387.948) (-389.397) (-387.805) * (-389.614) (-390.610) (-388.477) [-386.611] -- 0:00:28
529000 -- (-389.504) (-388.986) [-387.576] (-386.437) * [-387.643] (-391.197) (-387.442) (-389.864) -- 0:00:28
529500 -- (-390.827) (-386.281) (-387.119) [-387.302] * (-387.984) (-390.632) [-386.387] (-392.430) -- 0:00:28
530000 -- (-389.826) (-389.284) [-388.295] (-395.613) * (-389.118) (-390.412) [-388.254] (-389.478) -- 0:00:28
Average standard deviation of split frequencies: 0.008350
530500 -- (-389.963) [-387.445] (-387.193) (-387.587) * (-388.136) [-387.534] (-391.387) (-388.010) -- 0:00:28
531000 -- (-395.593) [-387.639] (-391.655) (-387.059) * [-387.765] (-388.370) (-389.250) (-388.458) -- 0:00:28
531500 -- [-390.682] (-390.477) (-386.816) (-388.304) * (-392.249) [-388.154] (-389.196) (-387.328) -- 0:00:28
532000 -- (-389.641) (-396.393) [-387.876] (-387.658) * (-390.190) (-387.093) [-388.638] (-387.740) -- 0:00:28
532500 -- (-388.698) [-389.414] (-392.360) (-386.323) * (-387.762) [-386.498] (-387.149) (-386.659) -- 0:00:28
533000 -- (-387.326) (-388.668) [-386.606] (-386.748) * (-387.823) (-386.416) [-387.148] (-388.705) -- 0:00:28
533500 -- (-387.705) (-390.355) [-389.564] (-388.569) * [-389.712] (-386.104) (-387.995) (-388.199) -- 0:00:27
534000 -- (-386.778) (-390.029) [-390.867] (-388.607) * (-390.902) (-389.654) (-387.355) [-389.192] -- 0:00:27
534500 -- (-388.282) (-387.500) (-387.345) [-387.943] * (-391.430) (-388.276) (-388.343) [-386.612] -- 0:00:27
535000 -- (-388.597) [-387.117] (-387.908) (-388.134) * (-388.321) (-392.474) (-387.980) [-387.678] -- 0:00:27
Average standard deviation of split frequencies: 0.008209
535500 -- (-389.604) (-388.910) [-389.894] (-388.010) * (-387.822) [-388.842] (-387.434) (-387.630) -- 0:00:27
536000 -- (-390.042) [-390.726] (-392.245) (-387.518) * (-389.369) (-390.405) (-388.162) [-388.011] -- 0:00:27
536500 -- [-387.314] (-387.760) (-387.572) (-387.492) * (-389.665) [-387.919] (-389.963) (-390.903) -- 0:00:27
537000 -- (-389.151) (-389.965) [-387.898] (-387.040) * (-388.293) (-387.176) (-388.397) [-386.927] -- 0:00:27
537500 -- (-388.579) (-387.666) (-386.210) [-387.943] * [-386.835] (-388.187) (-388.620) (-386.690) -- 0:00:27
538000 -- (-387.791) (-387.447) (-390.958) [-389.414] * [-387.533] (-388.315) (-386.704) (-391.263) -- 0:00:27
538500 -- [-386.635] (-387.381) (-389.480) (-386.116) * (-387.788) (-391.253) (-387.163) [-389.444] -- 0:00:27
539000 -- [-388.275] (-392.678) (-394.173) (-386.965) * (-387.022) (-387.727) (-390.861) [-388.389] -- 0:00:27
539500 -- [-392.781] (-387.630) (-392.248) (-389.681) * (-387.984) [-389.460] (-389.412) (-386.414) -- 0:00:27
540000 -- (-389.101) (-390.080) [-386.702] (-389.102) * (-387.391) (-388.573) (-389.686) [-388.115] -- 0:00:27
Average standard deviation of split frequencies: 0.008428
540500 -- (-392.292) [-387.210] (-391.802) (-396.638) * (-391.711) (-389.181) [-387.675] (-389.101) -- 0:00:27
541000 -- [-387.877] (-390.598) (-386.619) (-390.920) * (-388.231) (-387.711) [-387.705] (-388.630) -- 0:00:27
541500 -- (-392.048) [-393.355] (-392.260) (-398.372) * [-388.530] (-390.731) (-387.441) (-386.431) -- 0:00:27
542000 -- (-388.064) (-392.243) [-387.237] (-392.359) * (-388.963) (-394.656) (-388.347) [-386.796] -- 0:00:27
542500 -- (-392.291) [-386.633] (-387.890) (-386.019) * (-386.765) (-395.293) (-392.387) [-387.213] -- 0:00:26
543000 -- [-392.425] (-391.391) (-387.610) (-386.384) * (-387.143) (-389.707) [-389.115] (-387.315) -- 0:00:26
543500 -- [-389.026] (-389.935) (-387.788) (-386.796) * [-387.342] (-388.390) (-388.431) (-386.994) -- 0:00:26
544000 -- (-386.627) [-388.803] (-388.756) (-387.329) * (-386.674) [-387.990] (-389.711) (-388.264) -- 0:00:26
544500 -- (-390.038) (-386.378) [-386.314] (-386.734) * [-387.967] (-389.940) (-388.109) (-386.617) -- 0:00:27
545000 -- (-388.114) [-387.117] (-388.026) (-387.470) * [-386.091] (-387.246) (-386.657) (-388.393) -- 0:00:27
Average standard deviation of split frequencies: 0.008404
545500 -- (-389.489) [-388.065] (-387.871) (-391.896) * (-387.401) [-387.053] (-388.021) (-395.204) -- 0:00:27
546000 -- [-387.798] (-392.050) (-387.040) (-391.963) * (-387.034) (-389.720) (-387.469) [-394.870] -- 0:00:27
546500 -- (-388.162) (-387.559) (-387.017) [-389.008] * [-386.485] (-386.807) (-387.070) (-390.684) -- 0:00:27
547000 -- [-387.235] (-387.825) (-391.917) (-388.832) * (-387.228) [-388.092] (-387.256) (-388.495) -- 0:00:27
547500 -- (-388.928) (-396.395) (-388.541) [-386.910] * (-386.627) (-387.937) (-392.338) [-386.602] -- 0:00:27
548000 -- (-387.645) (-388.495) (-387.018) [-387.393] * (-388.528) (-390.395) (-386.525) [-388.140] -- 0:00:27
548500 -- (-386.972) [-388.439] (-386.485) (-389.125) * (-387.802) (-389.289) (-392.792) [-387.408] -- 0:00:27
549000 -- (-388.375) (-389.436) (-389.766) [-390.600] * (-386.953) [-388.341] (-388.708) (-386.697) -- 0:00:27
549500 -- (-388.605) (-391.210) (-389.417) [-390.559] * (-390.646) (-389.190) [-388.133] (-386.913) -- 0:00:27
550000 -- (-388.777) (-388.550) (-387.767) [-387.935] * (-391.975) [-386.794] (-390.457) (-388.911) -- 0:00:27
Average standard deviation of split frequencies: 0.008079
550500 -- [-391.125] (-387.238) (-390.867) (-388.613) * [-389.855] (-387.806) (-391.344) (-388.259) -- 0:00:26
551000 -- (-388.540) [-390.632] (-386.476) (-392.615) * (-389.058) (-386.311) (-389.230) [-387.333] -- 0:00:26
551500 -- (-387.961) (-386.256) (-386.052) [-388.728] * (-393.407) (-388.278) [-387.598] (-386.797) -- 0:00:26
552000 -- (-386.999) (-387.442) [-387.615] (-388.645) * (-386.863) (-391.603) (-387.229) [-386.400] -- 0:00:26
552500 -- (-388.501) (-386.808) (-386.681) [-386.735] * (-389.804) (-388.323) [-388.936] (-388.658) -- 0:00:26
553000 -- (-388.131) (-389.193) (-386.601) [-387.869] * (-387.765) [-388.015] (-390.195) (-390.098) -- 0:00:26
553500 -- (-388.220) [-389.391] (-394.139) (-387.519) * (-387.603) [-389.061] (-391.784) (-389.137) -- 0:00:26
554000 -- (-387.142) [-387.005] (-390.320) (-387.796) * (-388.248) [-389.037] (-386.575) (-389.633) -- 0:00:26
554500 -- (-389.430) [-388.319] (-386.791) (-387.432) * (-386.866) [-388.645] (-387.640) (-389.665) -- 0:00:26
555000 -- (-392.020) (-389.502) [-392.509] (-390.779) * [-387.204] (-391.362) (-388.995) (-388.823) -- 0:00:26
Average standard deviation of split frequencies: 0.008648
555500 -- (-389.256) [-387.163] (-387.315) (-388.055) * (-388.331) (-390.300) (-391.789) [-388.291] -- 0:00:26
556000 -- (-389.554) (-387.260) (-387.348) [-392.102] * (-387.360) (-394.437) (-387.245) [-388.373] -- 0:00:26
556500 -- (-389.653) (-388.604) [-386.792] (-391.803) * [-386.435] (-391.079) (-389.794) (-388.548) -- 0:00:26
557000 -- (-390.151) [-388.037] (-388.708) (-387.913) * (-386.612) (-389.280) (-392.537) [-387.874] -- 0:00:26
557500 -- (-389.108) (-386.974) (-387.424) [-388.850] * (-389.139) (-394.184) [-388.590] (-388.295) -- 0:00:26
558000 -- (-387.087) [-389.855] (-387.805) (-387.039) * [-389.399] (-394.072) (-386.893) (-391.899) -- 0:00:26
558500 -- [-390.057] (-392.068) (-389.033) (-389.135) * (-388.793) [-387.356] (-388.658) (-389.514) -- 0:00:26
559000 -- [-389.744] (-390.083) (-389.055) (-390.454) * (-389.919) (-389.292) [-392.987] (-388.609) -- 0:00:26
559500 -- [-387.204] (-391.226) (-390.756) (-388.595) * (-388.597) [-387.067] (-389.631) (-387.329) -- 0:00:25
560000 -- (-387.680) (-387.281) (-388.142) [-390.099] * (-388.605) [-390.590] (-388.722) (-386.959) -- 0:00:25
Average standard deviation of split frequencies: 0.008198
560500 -- [-387.385] (-387.134) (-391.369) (-390.171) * (-389.020) [-387.413] (-388.530) (-388.564) -- 0:00:26
561000 -- (-388.576) (-387.196) (-390.522) [-391.548] * (-386.343) (-387.497) [-391.249] (-387.372) -- 0:00:26
561500 -- (-386.728) [-388.081] (-388.864) (-389.926) * (-389.097) [-389.078] (-386.887) (-388.779) -- 0:00:26
562000 -- [-386.993] (-387.016) (-388.049) (-387.365) * [-386.705] (-387.690) (-386.636) (-388.580) -- 0:00:26
562500 -- [-387.650] (-386.698) (-389.597) (-389.244) * [-387.736] (-386.655) (-386.780) (-390.409) -- 0:00:26
563000 -- [-386.729] (-387.689) (-388.816) (-387.285) * [-387.756] (-386.558) (-390.477) (-391.142) -- 0:00:26
563500 -- (-386.995) (-391.585) (-389.275) [-391.199] * (-387.199) (-389.503) [-387.521] (-387.578) -- 0:00:26
564000 -- (-388.885) (-390.040) [-388.352] (-389.897) * (-387.296) [-389.029] (-388.221) (-388.991) -- 0:00:26
564500 -- (-386.584) (-394.177) [-388.080] (-386.572) * (-388.004) (-386.561) (-390.078) [-390.049] -- 0:00:26
565000 -- (-387.795) (-387.230) (-386.785) [-391.220] * [-389.475] (-387.470) (-387.312) (-391.848) -- 0:00:26
Average standard deviation of split frequencies: 0.008225
565500 -- [-391.890] (-387.893) (-388.920) (-387.848) * (-391.018) (-387.163) (-389.063) [-393.186] -- 0:00:26
566000 -- (-392.341) (-387.595) (-389.912) [-389.441] * (-389.553) (-386.894) (-390.743) [-389.593] -- 0:00:26
566500 -- [-390.004] (-392.244) (-388.961) (-387.506) * (-386.333) (-389.085) (-393.931) [-391.794] -- 0:00:26
567000 -- (-389.834) (-391.459) [-393.940] (-389.136) * (-387.036) [-387.438] (-387.917) (-388.270) -- 0:00:25
567500 -- (-388.932) [-387.187] (-394.417) (-386.365) * (-388.784) [-390.984] (-387.148) (-389.030) -- 0:00:25
568000 -- (-387.482) (-387.812) [-390.230] (-388.459) * (-388.449) [-386.928] (-389.533) (-389.267) -- 0:00:25
568500 -- (-390.258) [-388.671] (-389.266) (-387.553) * [-389.558] (-386.983) (-391.333) (-389.843) -- 0:00:25
569000 -- (-389.604) (-391.115) (-388.431) [-389.849] * (-390.726) (-386.441) (-389.541) [-390.449] -- 0:00:25
569500 -- [-388.454] (-387.074) (-388.907) (-390.011) * (-387.766) [-387.263] (-388.721) (-393.091) -- 0:00:25
570000 -- [-387.895] (-391.267) (-391.074) (-386.802) * [-390.246] (-387.321) (-386.662) (-391.026) -- 0:00:25
Average standard deviation of split frequencies: 0.008054
570500 -- (-390.225) (-386.635) [-387.936] (-386.612) * (-386.309) [-386.697] (-387.243) (-389.902) -- 0:00:25
571000 -- (-393.968) (-394.741) (-390.490) [-387.991] * (-387.076) (-389.058) (-388.077) [-389.236] -- 0:00:25
571500 -- [-389.950] (-386.886) (-390.764) (-386.353) * (-389.555) (-388.619) (-386.868) [-387.244] -- 0:00:25
572000 -- [-387.481] (-386.601) (-386.902) (-390.682) * [-389.853] (-390.872) (-387.614) (-386.685) -- 0:00:25
572500 -- (-387.682) [-387.747] (-387.975) (-387.609) * (-390.969) (-387.677) (-388.228) [-388.333] -- 0:00:25
573000 -- (-386.997) (-390.251) (-388.962) [-389.489] * (-389.925) (-388.522) [-387.309] (-387.233) -- 0:00:25
573500 -- (-388.359) (-387.757) (-395.692) [-386.159] * (-388.970) (-389.341) [-388.707] (-387.933) -- 0:00:25
574000 -- (-387.165) [-387.203] (-389.339) (-388.180) * (-391.183) [-386.264] (-389.905) (-391.781) -- 0:00:25
574500 -- (-387.011) [-386.888] (-393.859) (-386.388) * (-387.012) (-386.169) [-389.615] (-388.315) -- 0:00:25
575000 -- (-387.810) (-388.002) (-390.662) [-390.552] * (-387.008) (-391.628) [-389.661] (-388.619) -- 0:00:25
Average standard deviation of split frequencies: 0.008075
575500 -- [-388.408] (-390.791) (-388.629) (-389.286) * (-389.961) (-402.738) [-388.614] (-387.140) -- 0:00:25
576000 -- (-389.420) (-393.896) (-387.743) [-391.724] * (-386.693) (-394.234) [-387.935] (-388.562) -- 0:00:25
576500 -- (-387.369) [-392.721] (-390.111) (-391.686) * (-389.807) (-390.049) [-388.595] (-387.968) -- 0:00:25
577000 -- [-388.175] (-391.743) (-388.744) (-397.012) * [-386.902] (-391.296) (-389.002) (-392.047) -- 0:00:25
577500 -- (-387.464) (-392.319) [-389.830] (-388.159) * (-391.295) (-390.001) (-387.467) [-386.811] -- 0:00:25
578000 -- (-390.198) [-388.573] (-386.598) (-389.825) * (-387.012) [-388.778] (-389.088) (-386.375) -- 0:00:25
578500 -- (-387.814) [-389.079] (-388.675) (-388.797) * [-386.802] (-387.070) (-389.688) (-386.972) -- 0:00:25
579000 -- [-387.362] (-387.369) (-388.941) (-388.448) * (-387.445) (-388.065) [-386.791] (-388.889) -- 0:00:25
579500 -- [-387.903] (-388.848) (-386.156) (-389.542) * (-387.582) [-386.878] (-386.358) (-389.490) -- 0:00:25
580000 -- (-390.454) (-391.526) [-389.594] (-390.380) * (-387.164) (-389.524) [-386.405] (-387.792) -- 0:00:25
Average standard deviation of split frequencies: 0.008497
580500 -- (-390.827) (-393.727) (-387.214) [-386.911] * [-387.375] (-389.716) (-388.443) (-386.964) -- 0:00:25
581000 -- (-387.247) (-392.756) (-388.210) [-386.801] * (-389.597) (-394.177) [-387.912] (-393.993) -- 0:00:25
581500 -- (-388.959) (-390.754) (-387.800) [-387.153] * (-388.513) (-386.980) (-388.674) [-390.330] -- 0:00:25
582000 -- (-387.170) (-393.967) (-391.982) [-389.291] * (-390.922) (-387.479) [-386.528] (-389.855) -- 0:00:25
582500 -- (-390.500) (-388.331) (-387.938) [-386.124] * (-386.843) (-386.575) [-386.971] (-386.731) -- 0:00:25
583000 -- (-387.265) (-386.674) [-392.614] (-390.390) * (-389.201) [-390.273] (-387.145) (-387.248) -- 0:00:25
583500 -- (-390.763) [-386.783] (-388.809) (-387.625) * (-388.765) (-388.644) [-388.732] (-388.693) -- 0:00:24
584000 -- [-386.683] (-388.879) (-387.009) (-386.734) * [-386.944] (-389.964) (-386.970) (-389.093) -- 0:00:24
584500 -- (-389.384) (-390.168) [-387.515] (-388.763) * [-388.939] (-386.962) (-391.389) (-388.554) -- 0:00:24
585000 -- [-388.959] (-388.661) (-386.743) (-393.737) * (-390.687) (-386.446) [-394.596] (-388.112) -- 0:00:24
Average standard deviation of split frequencies: 0.008195
585500 -- (-387.377) (-389.210) (-387.506) [-387.573] * [-392.184] (-387.844) (-391.919) (-390.763) -- 0:00:24
586000 -- (-386.230) (-392.773) [-387.419] (-389.870) * (-389.323) [-389.310] (-390.780) (-388.635) -- 0:00:24
586500 -- (-386.292) (-389.766) [-389.412] (-388.825) * [-390.122] (-386.902) (-386.629) (-391.627) -- 0:00:24
587000 -- (-386.377) (-387.021) (-388.401) [-388.177] * (-387.384) (-390.455) (-391.539) [-389.789] -- 0:00:24
587500 -- [-385.930] (-386.588) (-392.609) (-388.726) * (-388.732) [-390.811] (-388.265) (-388.634) -- 0:00:24
588000 -- [-389.010] (-387.497) (-387.344) (-387.864) * [-388.759] (-390.063) (-388.214) (-388.919) -- 0:00:24
588500 -- (-392.637) (-387.784) (-391.584) [-386.482] * (-390.291) (-387.246) (-386.712) [-387.498] -- 0:00:24
589000 -- (-390.194) (-387.629) [-389.722] (-386.687) * (-390.342) (-388.011) [-387.149] (-386.368) -- 0:00:24
589500 -- (-386.289) [-390.635] (-388.422) (-388.946) * (-388.213) (-386.925) (-386.762) [-386.663] -- 0:00:24
590000 -- (-386.843) [-390.049] (-388.319) (-388.943) * (-391.624) (-386.606) [-388.318] (-391.304) -- 0:00:24
Average standard deviation of split frequencies: 0.008230
590500 -- (-387.143) [-388.729] (-388.897) (-387.255) * (-391.797) (-387.113) (-388.096) [-389.699] -- 0:00:24
591000 -- (-389.740) (-392.428) [-387.959] (-386.523) * [-392.447] (-390.872) (-389.526) (-389.615) -- 0:00:24
591500 -- (-391.988) (-392.115) [-387.757] (-390.032) * (-393.092) (-390.828) (-386.064) [-388.697] -- 0:00:24
592000 -- [-386.910] (-391.338) (-389.663) (-387.441) * (-389.811) (-391.902) (-390.491) [-386.534] -- 0:00:24
592500 -- [-390.085] (-388.165) (-392.243) (-388.193) * [-387.428] (-387.696) (-390.192) (-388.636) -- 0:00:24
593000 -- (-387.148) (-386.642) [-387.421] (-386.671) * [-387.022] (-388.781) (-387.514) (-390.266) -- 0:00:24
593500 -- [-386.864] (-387.416) (-386.660) (-389.565) * (-390.754) (-389.335) (-388.375) [-387.796] -- 0:00:24
594000 -- (-386.878) (-392.201) (-388.578) [-389.078] * (-387.566) (-388.939) [-387.489] (-388.382) -- 0:00:24
594500 -- (-386.890) (-391.955) (-389.143) [-396.339] * [-388.924] (-386.460) (-388.672) (-389.225) -- 0:00:24
595000 -- (-387.198) [-389.467] (-387.040) (-387.902) * (-390.384) (-387.967) [-389.131] (-389.162) -- 0:00:24
Average standard deviation of split frequencies: 0.008849
595500 -- (-387.964) (-388.950) (-390.269) [-387.373] * [-387.752] (-388.214) (-388.542) (-389.643) -- 0:00:24
596000 -- (-386.521) [-389.073] (-390.527) (-389.800) * (-387.837) (-387.219) [-390.104] (-388.133) -- 0:00:24
596500 -- (-387.551) (-386.580) [-387.659] (-390.243) * (-388.700) (-387.980) (-391.402) [-387.128] -- 0:00:24
597000 -- (-388.681) [-386.733] (-394.812) (-389.500) * (-388.062) [-389.482] (-389.324) (-390.465) -- 0:00:24
597500 -- (-388.268) [-388.864] (-388.997) (-387.646) * (-388.083) (-389.906) (-389.796) [-388.410] -- 0:00:24
598000 -- (-386.354) (-387.486) [-389.555] (-387.603) * (-389.437) (-390.856) [-388.137] (-389.472) -- 0:00:24
598500 -- (-386.984) [-388.128] (-387.071) (-387.632) * [-388.035] (-388.473) (-387.363) (-387.817) -- 0:00:24
599000 -- (-387.510) (-388.826) [-388.292] (-387.076) * [-390.756] (-387.737) (-389.019) (-387.444) -- 0:00:24
599500 -- [-388.845] (-387.057) (-388.249) (-387.935) * (-388.551) [-390.180] (-387.064) (-388.317) -- 0:00:24
600000 -- (-388.570) [-388.682] (-387.691) (-389.146) * (-387.055) (-388.651) (-387.064) [-387.659] -- 0:00:24
Average standard deviation of split frequencies: 0.009123
600500 -- (-387.361) (-390.006) (-388.146) [-388.656] * (-389.838) (-389.421) (-390.645) [-390.443] -- 0:00:23
601000 -- (-388.398) (-388.651) [-387.055] (-389.758) * (-387.599) (-390.957) [-389.052] (-388.021) -- 0:00:23
601500 -- [-386.815] (-386.655) (-390.519) (-390.816) * [-386.889] (-395.214) (-386.953) (-387.192) -- 0:00:23
602000 -- (-391.499) [-390.533] (-393.445) (-392.047) * (-387.539) (-391.755) [-395.762] (-388.947) -- 0:00:23
602500 -- [-388.386] (-389.173) (-391.435) (-388.332) * (-388.033) (-393.437) [-389.892] (-390.240) -- 0:00:23
603000 -- (-389.396) (-387.282) [-389.376] (-386.900) * [-387.889] (-394.137) (-387.712) (-387.388) -- 0:00:23
603500 -- [-386.321] (-387.920) (-386.806) (-387.695) * (-387.340) (-387.968) [-389.142] (-387.116) -- 0:00:23
604000 -- (-387.826) (-390.169) [-387.487] (-387.335) * (-387.789) (-387.890) [-387.775] (-388.539) -- 0:00:23
604500 -- (-390.010) (-389.102) [-387.870] (-386.938) * [-389.965] (-389.423) (-391.746) (-389.453) -- 0:00:23
605000 -- (-387.015) (-389.774) [-387.171] (-389.214) * [-388.291] (-396.314) (-387.643) (-386.579) -- 0:00:23
Average standard deviation of split frequencies: 0.009238
605500 -- (-387.756) (-389.296) [-387.068] (-389.293) * (-387.611) [-390.539] (-389.309) (-386.423) -- 0:00:24
606000 -- (-386.296) (-387.521) (-386.931) [-387.082] * (-387.433) (-387.088) (-390.009) [-387.898] -- 0:00:24
606500 -- (-386.446) [-387.401] (-386.986) (-391.164) * (-387.008) (-387.123) [-389.402] (-386.768) -- 0:00:24
607000 -- (-386.064) (-389.484) (-386.575) [-389.316] * (-386.360) (-390.082) (-391.007) [-387.707] -- 0:00:23
607500 -- [-389.565] (-387.822) (-389.267) (-388.694) * (-389.552) (-387.591) (-388.688) [-390.810] -- 0:00:23
608000 -- [-389.162] (-387.242) (-393.006) (-391.911) * [-387.679] (-389.171) (-388.910) (-388.631) -- 0:00:23
608500 -- (-390.619) (-388.428) (-389.253) [-391.256] * (-390.188) (-387.647) (-387.446) [-388.918] -- 0:00:23
609000 -- (-386.910) (-394.115) [-388.112] (-387.871) * [-389.482] (-388.928) (-387.741) (-387.302) -- 0:00:23
609500 -- (-388.133) (-389.587) [-388.158] (-386.624) * (-387.642) (-389.215) (-390.217) [-387.267] -- 0:00:23
610000 -- (-388.515) (-388.896) (-387.742) [-386.672] * [-387.942] (-386.509) (-388.598) (-388.176) -- 0:00:23
Average standard deviation of split frequencies: 0.008900
610500 -- [-386.546] (-389.405) (-386.438) (-389.189) * (-386.935) (-391.390) [-390.226] (-388.184) -- 0:00:23
611000 -- (-386.644) [-390.561] (-388.087) (-389.297) * (-386.633) (-386.971) [-391.112] (-387.583) -- 0:00:23
611500 -- (-389.304) [-388.159] (-391.202) (-387.583) * (-388.623) [-388.660] (-389.283) (-388.115) -- 0:00:23
612000 -- (-387.767) (-386.083) (-386.610) [-388.523] * (-391.247) (-391.337) [-387.984] (-389.346) -- 0:00:23
612500 -- [-388.442] (-387.790) (-389.166) (-387.283) * (-388.130) (-387.874) [-388.879] (-386.969) -- 0:00:23
613000 -- (-387.843) [-388.552] (-391.765) (-389.073) * (-387.757) (-389.126) (-386.311) [-389.377] -- 0:00:23
613500 -- (-388.635) [-388.264] (-387.200) (-386.817) * (-389.620) [-386.792] (-386.390) (-389.439) -- 0:00:23
614000 -- (-389.227) (-387.297) (-386.852) [-388.501] * (-388.279) (-387.936) [-389.378] (-386.391) -- 0:00:23
614500 -- [-388.493] (-387.022) (-389.148) (-387.483) * (-389.593) (-386.880) (-386.928) [-386.667] -- 0:00:23
615000 -- (-388.139) (-386.829) [-387.783] (-388.766) * (-387.300) (-387.268) [-387.164] (-389.449) -- 0:00:23
Average standard deviation of split frequencies: 0.008609
615500 -- (-389.272) (-387.062) [-391.384] (-388.398) * (-388.618) (-389.263) [-391.152] (-391.754) -- 0:00:23
616000 -- (-387.158) (-388.211) (-387.501) [-389.199] * (-387.440) (-387.048) (-389.859) [-390.478] -- 0:00:23
616500 -- (-389.099) (-386.934) [-386.349] (-390.056) * (-390.908) [-388.841] (-388.579) (-394.396) -- 0:00:23
617000 -- (-389.846) [-387.397] (-389.650) (-388.834) * (-388.223) (-389.910) (-387.512) [-391.387] -- 0:00:22
617500 -- [-386.983] (-388.327) (-389.078) (-388.100) * (-387.822) [-386.338] (-387.835) (-389.195) -- 0:00:22
618000 -- (-387.303) (-388.001) [-389.530] (-391.846) * (-386.434) (-388.200) (-388.417) [-386.229] -- 0:00:22
618500 -- (-387.667) (-387.178) [-389.147] (-391.521) * (-386.336) (-389.737) [-387.992] (-386.634) -- 0:00:22
619000 -- (-390.319) [-387.846] (-388.898) (-389.633) * (-392.127) (-388.506) (-390.773) [-386.408] -- 0:00:22
619500 -- (-390.511) (-388.977) (-390.470) [-387.547] * [-388.391] (-389.459) (-387.122) (-388.641) -- 0:00:22
620000 -- (-390.481) (-394.181) [-386.462] (-386.965) * [-389.503] (-389.830) (-388.768) (-388.779) -- 0:00:22
Average standard deviation of split frequencies: 0.007595
620500 -- (-388.884) (-389.331) (-389.272) [-387.803] * (-387.015) (-390.645) [-389.896] (-387.368) -- 0:00:22
621000 -- (-389.150) (-389.076) [-388.524] (-389.769) * (-388.280) [-388.391] (-388.825) (-387.287) -- 0:00:23
621500 -- (-388.194) (-388.046) [-389.386] (-395.750) * (-389.225) (-388.064) [-388.671] (-387.830) -- 0:00:23
622000 -- (-391.740) [-387.664] (-387.745) (-389.224) * (-388.291) (-391.014) (-390.835) [-387.083] -- 0:00:23
622500 -- (-389.869) (-387.385) [-388.811] (-388.998) * (-386.544) [-390.700] (-386.091) (-387.664) -- 0:00:23
623000 -- (-390.190) [-389.435] (-391.338) (-387.183) * (-390.118) [-392.405] (-387.431) (-388.467) -- 0:00:22
623500 -- [-389.598] (-388.776) (-390.044) (-390.499) * (-388.915) (-389.152) (-387.874) [-388.862] -- 0:00:22
624000 -- (-387.288) [-386.977] (-393.045) (-390.021) * (-393.546) [-388.757] (-389.361) (-388.531) -- 0:00:22
624500 -- (-387.256) (-390.301) [-392.660] (-386.520) * (-386.432) (-387.386) [-387.578] (-394.499) -- 0:00:22
625000 -- (-386.931) [-389.554] (-389.082) (-389.500) * (-386.978) (-389.542) [-387.352] (-386.501) -- 0:00:22
Average standard deviation of split frequencies: 0.007973
625500 -- (-387.484) [-389.145] (-387.787) (-388.843) * (-392.269) (-387.742) (-388.243) [-387.164] -- 0:00:22
626000 -- (-392.383) (-390.662) [-386.507] (-386.869) * (-388.060) (-391.918) [-388.787] (-387.898) -- 0:00:22
626500 -- [-388.773] (-390.187) (-391.297) (-388.330) * (-387.273) (-388.298) [-386.508] (-388.435) -- 0:00:22
627000 -- (-391.112) (-388.765) (-391.815) [-387.717] * (-388.460) (-389.653) (-386.348) [-389.459] -- 0:00:22
627500 -- (-388.640) [-389.014] (-392.627) (-387.585) * (-389.225) (-387.500) (-387.785) [-388.361] -- 0:00:22
628000 -- [-387.485] (-390.416) (-390.096) (-387.517) * (-388.123) (-390.418) [-388.883] (-387.062) -- 0:00:22
628500 -- (-390.375) (-388.891) [-388.442] (-387.263) * (-387.048) [-387.537] (-390.669) (-392.582) -- 0:00:22
629000 -- (-392.289) [-395.256] (-387.857) (-387.203) * [-388.033] (-391.206) (-394.126) (-389.860) -- 0:00:22
629500 -- (-389.412) (-390.029) [-388.484] (-388.921) * (-388.095) (-391.719) [-390.717] (-387.677) -- 0:00:22
630000 -- (-386.773) (-387.698) (-387.094) [-389.159] * (-387.853) [-388.548] (-391.453) (-386.390) -- 0:00:22
Average standard deviation of split frequencies: 0.008316
630500 -- (-388.019) (-386.827) [-389.264] (-387.655) * (-388.485) [-386.139] (-387.701) (-389.012) -- 0:00:22
631000 -- (-387.606) [-387.087] (-389.201) (-387.393) * (-388.826) (-386.082) (-390.690) [-388.335] -- 0:00:22
631500 -- [-387.411] (-388.928) (-388.542) (-388.556) * (-390.808) (-386.567) [-387.267] (-389.311) -- 0:00:22
632000 -- (-393.370) [-389.894] (-387.415) (-390.426) * [-386.550] (-387.849) (-389.768) (-387.047) -- 0:00:22
632500 -- (-390.281) (-389.362) (-387.322) [-391.243] * (-387.809) (-390.104) [-390.434] (-386.560) -- 0:00:22
633000 -- (-392.694) (-388.727) [-390.696] (-392.968) * (-387.770) [-386.374] (-388.480) (-387.468) -- 0:00:22
633500 -- [-387.368] (-389.177) (-393.868) (-389.101) * (-387.948) [-387.478] (-388.652) (-389.592) -- 0:00:21
634000 -- (-386.442) (-390.333) (-388.304) [-387.122] * (-391.162) (-387.496) [-390.138] (-388.149) -- 0:00:21
634500 -- (-386.944) (-387.255) [-391.679] (-388.687) * (-387.568) (-387.224) [-393.115] (-386.629) -- 0:00:21
635000 -- (-386.600) (-388.178) (-388.705) [-389.278] * [-387.253] (-389.674) (-389.258) (-386.666) -- 0:00:21
Average standard deviation of split frequencies: 0.008385
635500 -- [-389.381] (-388.978) (-389.747) (-388.303) * (-388.269) (-391.482) (-387.515) [-389.047] -- 0:00:21
636000 -- (-389.870) [-392.429] (-392.407) (-387.787) * [-388.256] (-389.142) (-389.107) (-390.781) -- 0:00:21
636500 -- (-387.922) (-390.078) [-393.166] (-388.961) * (-386.439) (-391.982) (-386.995) [-387.529] -- 0:00:21
637000 -- (-388.111) (-387.775) (-387.569) [-389.103] * (-388.593) (-390.998) [-389.957] (-388.905) -- 0:00:21
637500 -- [-386.324] (-387.950) (-389.108) (-389.640) * (-390.390) (-388.525) [-389.110] (-389.236) -- 0:00:22
638000 -- (-389.626) (-390.083) [-387.704] (-390.028) * (-393.732) [-389.157] (-387.749) (-387.313) -- 0:00:22
638500 -- (-389.989) (-389.716) [-390.206] (-388.075) * (-388.899) (-388.370) (-396.099) [-386.263] -- 0:00:22
639000 -- (-395.345) (-387.216) [-387.979] (-387.541) * [-389.576] (-386.948) (-390.438) (-387.388) -- 0:00:22
639500 -- (-389.558) (-388.393) [-388.788] (-388.298) * (-387.430) (-388.074) (-392.323) [-386.494] -- 0:00:21
640000 -- (-392.105) [-387.620] (-389.165) (-386.466) * (-386.616) (-388.360) [-391.447] (-387.791) -- 0:00:21
Average standard deviation of split frequencies: 0.008738
640500 -- (-387.107) (-388.682) [-388.451] (-386.501) * (-388.006) [-386.600] (-387.128) (-389.860) -- 0:00:21
641000 -- (-388.126) (-386.629) [-387.582] (-387.062) * (-389.760) [-388.107] (-386.792) (-388.164) -- 0:00:21
641500 -- (-388.100) [-388.349] (-388.359) (-387.045) * (-387.098) (-386.199) (-388.334) [-391.360] -- 0:00:21
642000 -- (-388.747) (-388.684) (-387.034) [-387.664] * (-388.338) [-387.726] (-388.824) (-387.095) -- 0:00:21
642500 -- [-386.913] (-388.730) (-387.318) (-388.926) * (-389.553) (-389.191) (-389.976) [-387.823] -- 0:00:21
643000 -- (-388.860) (-386.369) (-388.138) [-388.337] * (-387.773) (-388.856) (-390.259) [-388.886] -- 0:00:21
643500 -- [-391.122] (-389.405) (-390.704) (-387.354) * (-388.440) (-391.431) (-390.334) [-387.628] -- 0:00:21
644000 -- [-387.863] (-390.451) (-388.822) (-389.391) * [-388.582] (-389.717) (-387.071) (-390.127) -- 0:00:21
644500 -- [-388.596] (-387.289) (-388.982) (-388.899) * (-389.814) (-387.591) (-390.532) [-388.753] -- 0:00:21
645000 -- (-388.214) (-391.734) (-388.066) [-388.985] * (-389.812) [-386.975] (-388.338) (-388.510) -- 0:00:21
Average standard deviation of split frequencies: 0.008585
645500 -- (-389.484) [-387.730] (-387.602) (-389.460) * (-390.008) (-392.879) [-389.399] (-391.192) -- 0:00:21
646000 -- (-388.458) (-389.923) [-388.506] (-386.978) * (-387.409) [-388.132] (-387.733) (-387.851) -- 0:00:21
646500 -- (-388.322) (-387.801) [-389.488] (-387.593) * [-387.935] (-388.468) (-387.410) (-391.699) -- 0:00:21
647000 -- (-390.584) (-390.055) (-392.986) [-386.398] * [-387.483] (-389.428) (-390.760) (-387.752) -- 0:00:21
647500 -- (-389.163) [-386.687] (-389.118) (-387.859) * (-387.189) [-388.974] (-387.830) (-387.064) -- 0:00:21
648000 -- (-389.370) (-386.946) [-388.449] (-388.137) * (-386.974) (-387.408) (-390.620) [-387.374] -- 0:00:21
648500 -- (-388.647) [-388.243] (-387.059) (-386.687) * [-387.827] (-388.014) (-387.750) (-386.203) -- 0:00:21
649000 -- [-387.388] (-390.722) (-393.929) (-387.307) * (-386.847) (-389.337) (-387.418) [-387.073] -- 0:00:21
649500 -- (-387.725) [-388.580] (-390.625) (-386.866) * (-392.391) (-390.163) (-387.922) [-386.742] -- 0:00:21
650000 -- [-387.895] (-389.048) (-389.026) (-388.106) * (-389.279) (-389.454) (-387.577) [-388.362] -- 0:00:21
Average standard deviation of split frequencies: 0.008268
650500 -- (-392.962) (-387.924) [-387.275] (-388.537) * (-387.783) (-389.235) [-387.876] (-390.516) -- 0:00:20
651000 -- [-386.529] (-387.652) (-388.128) (-389.673) * (-389.059) (-386.696) (-387.483) [-387.935] -- 0:00:20
651500 -- [-386.928] (-393.222) (-386.760) (-388.698) * (-389.435) (-388.009) (-390.537) [-388.440] -- 0:00:20
652000 -- (-389.072) (-388.940) [-389.915] (-388.547) * [-389.301] (-388.340) (-388.315) (-386.878) -- 0:00:20
652500 -- (-389.284) (-386.439) [-386.578] (-387.777) * (-387.310) (-386.748) [-388.615] (-387.097) -- 0:00:20
653000 -- (-390.933) [-388.823] (-388.269) (-389.054) * (-386.476) [-386.419] (-391.397) (-386.982) -- 0:00:20
653500 -- [-388.957] (-388.292) (-386.891) (-390.104) * (-389.221) (-387.781) [-387.261] (-392.164) -- 0:00:21
654000 -- (-386.361) (-388.356) (-389.808) [-389.983] * (-387.110) [-387.386] (-389.418) (-387.840) -- 0:00:21
654500 -- [-390.728] (-387.575) (-392.680) (-387.240) * (-387.168) [-390.047] (-387.464) (-387.193) -- 0:00:21
655000 -- [-387.564] (-388.020) (-387.593) (-387.877) * (-386.560) (-387.197) [-387.678] (-388.594) -- 0:00:21
Average standard deviation of split frequencies: 0.008158
655500 -- [-387.135] (-387.062) (-389.277) (-390.102) * (-389.795) [-391.739] (-386.673) (-389.368) -- 0:00:21
656000 -- (-387.340) (-387.500) [-389.814] (-386.290) * (-390.464) (-387.818) (-388.941) [-386.897] -- 0:00:20
656500 -- [-387.245] (-386.616) (-388.399) (-390.960) * (-388.892) (-388.269) (-389.036) [-386.583] -- 0:00:20
657000 -- (-388.080) (-387.359) [-386.960] (-386.193) * (-387.418) (-388.168) (-388.516) [-386.756] -- 0:00:20
657500 -- (-389.187) (-389.961) [-387.358] (-389.199) * (-392.059) (-388.044) (-387.592) [-389.266] -- 0:00:20
658000 -- (-387.831) [-387.167] (-390.122) (-387.507) * (-388.055) [-386.848] (-388.919) (-389.415) -- 0:00:20
658500 -- [-388.480] (-388.785) (-389.899) (-387.664) * (-388.979) [-387.880] (-388.037) (-390.213) -- 0:00:20
659000 -- (-389.181) (-392.448) (-388.460) [-387.534] * [-386.830] (-390.443) (-389.055) (-388.898) -- 0:00:20
659500 -- (-389.437) (-386.957) [-387.774] (-387.972) * [-388.404] (-390.365) (-388.129) (-387.025) -- 0:00:20
660000 -- [-386.421] (-387.366) (-390.884) (-389.536) * (-391.031) (-387.822) (-387.064) [-387.479] -- 0:00:20
Average standard deviation of split frequencies: 0.008101
660500 -- (-388.610) (-386.162) [-387.997] (-386.076) * [-387.135] (-390.998) (-389.763) (-386.688) -- 0:00:20
661000 -- (-388.298) (-386.025) (-389.973) [-386.863] * [-388.685] (-386.154) (-392.071) (-388.474) -- 0:00:20
661500 -- (-387.065) (-390.832) [-387.139] (-390.800) * (-386.241) (-387.973) [-387.626] (-387.338) -- 0:00:20
662000 -- (-388.485) [-390.066] (-387.514) (-387.185) * [-389.522] (-387.034) (-386.592) (-390.126) -- 0:00:20
662500 -- [-387.717] (-388.432) (-386.881) (-391.362) * (-393.211) (-391.120) [-390.723] (-393.328) -- 0:00:20
663000 -- (-388.789) (-387.288) (-387.911) [-388.879] * (-386.476) (-391.730) (-390.393) [-388.256] -- 0:00:20
663500 -- (-388.666) [-392.787] (-386.921) (-391.037) * (-386.784) [-388.651] (-388.738) (-387.751) -- 0:00:20
664000 -- [-387.369] (-391.687) (-388.188) (-390.603) * (-387.799) (-389.336) [-393.672] (-387.402) -- 0:00:20
664500 -- (-387.650) [-387.875] (-389.177) (-389.798) * (-386.894) [-386.858] (-387.758) (-387.334) -- 0:00:20
665000 -- [-386.669] (-390.060) (-389.065) (-389.039) * [-387.946] (-387.704) (-387.399) (-386.613) -- 0:00:20
Average standard deviation of split frequencies: 0.008369
665500 -- (-387.688) (-387.022) [-386.998] (-387.777) * (-389.271) (-391.702) (-388.548) [-388.815] -- 0:00:20
666000 -- (-390.258) [-387.422] (-387.139) (-387.717) * [-387.317] (-389.379) (-388.856) (-389.574) -- 0:00:20
666500 -- (-388.470) (-386.959) [-388.544] (-390.169) * [-389.698] (-391.577) (-389.650) (-388.606) -- 0:00:20
667000 -- (-388.381) (-388.904) [-387.738] (-388.523) * (-386.616) [-390.279] (-387.718) (-393.240) -- 0:00:19
667500 -- [-389.841] (-389.036) (-386.103) (-391.529) * (-392.017) (-388.183) [-386.228] (-390.957) -- 0:00:19
668000 -- [-390.096] (-390.881) (-391.284) (-387.207) * (-387.755) (-390.451) (-395.926) [-387.575] -- 0:00:19
668500 -- (-388.490) (-392.665) [-389.270] (-387.423) * (-387.664) (-391.086) (-387.473) [-388.515] -- 0:00:19
669000 -- (-387.351) [-390.460] (-390.164) (-390.239) * [-392.692] (-389.682) (-387.530) (-387.639) -- 0:00:19
669500 -- (-387.347) [-390.752] (-392.384) (-387.678) * (-389.265) [-390.307] (-388.457) (-390.431) -- 0:00:19
670000 -- (-386.366) [-389.243] (-394.375) (-387.193) * [-386.950] (-387.174) (-388.079) (-391.459) -- 0:00:19
Average standard deviation of split frequencies: 0.008311
670500 -- (-389.403) [-386.905] (-389.136) (-388.009) * [-387.006] (-389.187) (-389.507) (-389.241) -- 0:00:20
671000 -- (-389.329) (-386.904) [-387.458] (-388.686) * (-387.664) [-390.827] (-390.383) (-390.717) -- 0:00:20
671500 -- [-389.436] (-387.185) (-390.273) (-388.264) * (-388.561) (-390.219) [-387.670] (-387.555) -- 0:00:20
672000 -- (-388.931) (-386.897) (-398.634) [-386.716] * (-387.328) [-388.909] (-387.218) (-389.401) -- 0:00:20
672500 -- (-386.910) [-388.635] (-389.561) (-389.927) * (-387.193) (-387.447) (-386.679) [-387.778] -- 0:00:19
673000 -- (-388.836) (-388.127) [-391.654] (-387.826) * (-387.040) [-388.418] (-387.329) (-386.966) -- 0:00:19
673500 -- (-390.412) (-387.124) [-391.585] (-386.278) * (-388.135) [-387.653] (-389.058) (-394.143) -- 0:00:19
674000 -- (-388.802) (-387.151) [-389.237] (-387.094) * (-387.919) (-390.388) (-390.340) [-387.187] -- 0:00:19
674500 -- [-389.596] (-388.474) (-387.814) (-390.244) * (-387.354) [-386.759] (-385.950) (-387.102) -- 0:00:19
675000 -- (-394.777) [-389.154] (-388.117) (-390.021) * (-389.718) [-386.842] (-388.075) (-386.703) -- 0:00:19
Average standard deviation of split frequencies: 0.008655
675500 -- (-388.061) (-387.826) [-387.184] (-389.642) * [-390.290] (-386.623) (-388.764) (-388.978) -- 0:00:19
676000 -- (-389.877) (-390.115) [-387.261] (-393.836) * [-389.504] (-387.296) (-391.314) (-388.904) -- 0:00:19
676500 -- (-387.949) [-387.077] (-393.184) (-388.076) * (-389.370) [-393.782] (-392.339) (-388.026) -- 0:00:19
677000 -- (-386.702) (-387.723) (-386.880) [-387.295] * [-390.507] (-387.603) (-387.303) (-386.946) -- 0:00:19
677500 -- (-391.735) (-386.537) [-389.458] (-387.777) * (-386.895) [-389.289] (-386.832) (-391.752) -- 0:00:19
678000 -- [-387.812] (-386.456) (-386.972) (-389.554) * (-390.499) [-388.745] (-389.767) (-391.274) -- 0:00:19
678500 -- (-391.208) (-387.225) (-387.165) [-388.785] * (-388.116) [-388.561] (-387.174) (-388.250) -- 0:00:19
679000 -- [-386.320] (-386.665) (-389.488) (-389.317) * (-388.989) (-388.412) [-388.362] (-386.397) -- 0:00:19
679500 -- [-387.104] (-386.534) (-389.708) (-388.067) * (-388.362) (-387.501) [-388.024] (-386.584) -- 0:00:19
680000 -- (-389.355) [-387.813] (-389.362) (-392.210) * [-389.112] (-387.567) (-388.739) (-387.690) -- 0:00:19
Average standard deviation of split frequencies: 0.008787
680500 -- [-389.208] (-390.020) (-390.312) (-389.181) * [-389.299] (-391.180) (-388.902) (-387.158) -- 0:00:19
681000 -- [-390.019] (-387.939) (-390.763) (-388.579) * (-389.478) (-391.474) [-389.105] (-388.596) -- 0:00:19
681500 -- [-389.800] (-391.151) (-389.821) (-389.178) * (-388.437) [-390.666] (-387.955) (-391.339) -- 0:00:19
682000 -- (-388.501) [-389.167] (-393.268) (-388.504) * (-387.202) [-390.523] (-387.355) (-388.062) -- 0:00:19
682500 -- (-386.839) [-389.827] (-386.960) (-387.263) * [-387.522] (-388.120) (-392.500) (-387.166) -- 0:00:19
683000 -- (-387.146) (-390.348) [-387.225] (-386.688) * (-388.776) (-387.619) [-388.950] (-387.201) -- 0:00:19
683500 -- [-386.371] (-389.335) (-386.993) (-388.774) * (-390.406) (-386.695) (-387.390) [-388.962] -- 0:00:18
684000 -- (-386.339) [-387.573] (-388.195) (-393.774) * (-389.031) [-386.958] (-392.659) (-388.872) -- 0:00:18
684500 -- (-391.480) (-388.402) [-386.986] (-388.752) * [-388.359] (-387.364) (-390.545) (-390.040) -- 0:00:18
685000 -- [-386.761] (-392.568) (-386.584) (-388.757) * (-397.921) (-390.324) [-386.779] (-391.450) -- 0:00:18
Average standard deviation of split frequencies: 0.008976
685500 -- (-386.124) [-386.477] (-387.403) (-387.312) * (-387.295) (-387.304) [-386.928] (-388.240) -- 0:00:18
686000 -- (-388.179) (-389.499) (-386.522) [-387.111] * (-392.033) (-389.494) (-389.346) [-388.429] -- 0:00:18
686500 -- (-390.704) (-389.376) [-387.300] (-387.237) * [-387.352] (-391.866) (-388.647) (-387.829) -- 0:00:18
687000 -- [-387.995] (-387.927) (-387.169) (-386.931) * (-387.174) (-387.462) [-390.196] (-390.820) -- 0:00:19
687500 -- (-386.534) (-389.443) (-387.742) [-389.261] * (-387.373) (-388.863) (-386.735) [-389.253] -- 0:00:19
688000 -- [-392.440] (-388.891) (-387.178) (-390.204) * [-387.416] (-386.576) (-391.477) (-386.764) -- 0:00:19
688500 -- [-390.565] (-387.175) (-387.858) (-388.715) * (-391.029) (-386.414) (-386.425) [-391.105] -- 0:00:19
689000 -- [-387.388] (-390.162) (-386.399) (-386.558) * (-388.463) (-390.517) [-388.174] (-389.300) -- 0:00:18
689500 -- (-387.287) [-389.881] (-387.881) (-386.111) * [-390.552] (-388.191) (-387.391) (-388.487) -- 0:00:18
690000 -- (-391.708) (-387.330) [-386.829] (-386.592) * (-390.547) [-386.102] (-389.199) (-387.023) -- 0:00:18
Average standard deviation of split frequencies: 0.008471
690500 -- (-390.514) (-387.007) [-392.895] (-387.223) * [-388.140] (-386.457) (-389.493) (-386.886) -- 0:00:18
691000 -- [-389.887] (-387.761) (-390.294) (-388.450) * (-386.490) (-392.693) (-388.830) [-387.451] -- 0:00:18
691500 -- [-390.340] (-388.902) (-387.016) (-387.584) * (-386.232) [-389.654] (-393.432) (-388.409) -- 0:00:18
692000 -- [-389.670] (-386.215) (-388.590) (-387.072) * (-388.381) (-387.947) [-395.865] (-387.298) -- 0:00:18
692500 -- [-387.606] (-388.056) (-386.451) (-387.276) * [-387.338] (-389.166) (-393.275) (-386.847) -- 0:00:18
693000 -- (-387.654) (-388.431) [-386.742] (-387.937) * (-388.304) [-390.256] (-390.780) (-388.172) -- 0:00:18
693500 -- (-387.024) [-389.859] (-390.092) (-386.339) * (-387.843) (-387.484) [-390.519] (-388.804) -- 0:00:18
694000 -- (-387.116) (-390.244) [-386.211] (-387.564) * (-387.914) (-389.748) (-389.850) [-386.145] -- 0:00:18
694500 -- [-387.635] (-392.208) (-387.635) (-387.461) * (-390.885) (-390.628) (-388.698) [-387.145] -- 0:00:18
695000 -- (-387.662) (-392.921) (-387.236) [-387.023] * (-386.937) (-391.669) (-388.642) [-388.740] -- 0:00:18
Average standard deviation of split frequencies: 0.008247
695500 -- (-390.790) [-387.964] (-389.448) (-387.914) * (-388.528) [-390.314] (-390.708) (-386.863) -- 0:00:18
696000 -- (-388.898) (-386.367) (-387.691) [-388.867] * [-387.241] (-387.295) (-393.186) (-386.707) -- 0:00:18
696500 -- (-389.462) (-387.739) (-388.814) [-388.637] * [-390.103] (-388.333) (-388.389) (-388.110) -- 0:00:18
697000 -- (-389.959) (-387.097) [-387.223] (-389.268) * [-388.861] (-387.938) (-386.919) (-386.431) -- 0:00:18
697500 -- (-390.287) (-388.989) [-387.086] (-387.501) * (-387.789) (-386.461) [-386.685] (-387.685) -- 0:00:18
698000 -- (-387.243) (-387.590) [-388.891] (-391.885) * (-387.380) (-389.264) (-386.518) [-388.456] -- 0:00:18
698500 -- (-389.609) (-389.221) (-387.305) [-387.435] * (-388.374) (-389.726) [-385.970] (-386.578) -- 0:00:18
699000 -- (-387.340) [-390.190] (-387.174) (-387.071) * [-389.496] (-386.128) (-386.029) (-388.858) -- 0:00:18
699500 -- [-387.947] (-391.252) (-390.888) (-388.994) * (-388.310) (-387.841) [-386.638] (-390.526) -- 0:00:18
700000 -- (-389.110) (-388.093) (-390.507) [-388.768] * (-387.212) (-389.923) (-388.897) [-390.298] -- 0:00:18
Average standard deviation of split frequencies: 0.007955
700500 -- (-397.235) (-387.205) (-389.962) [-386.694] * (-387.900) [-392.592] (-390.213) (-388.647) -- 0:00:17
701000 -- (-389.564) [-389.038] (-388.277) (-387.000) * (-386.814) (-388.315) (-389.721) [-387.749] -- 0:00:17
701500 -- (-391.716) (-386.632) [-387.179] (-389.877) * (-391.228) (-388.329) (-386.802) [-388.687] -- 0:00:17
702000 -- [-388.682] (-392.770) (-388.300) (-391.047) * (-389.114) (-389.473) (-386.748) [-388.674] -- 0:00:17
702500 -- [-388.275] (-387.668) (-386.942) (-394.193) * (-387.539) [-386.708] (-390.619) (-389.096) -- 0:00:17
703000 -- (-387.172) (-387.810) [-388.222] (-389.784) * [-387.638] (-388.520) (-391.425) (-394.108) -- 0:00:17
703500 -- (-388.837) (-388.339) [-388.999] (-391.065) * (-387.605) [-386.526] (-387.918) (-389.351) -- 0:00:17
704000 -- [-386.030] (-388.408) (-390.160) (-389.479) * (-388.473) [-388.688] (-387.289) (-390.447) -- 0:00:18
704500 -- (-393.553) (-386.606) (-388.422) [-388.466] * [-389.855] (-390.313) (-386.638) (-390.857) -- 0:00:18
705000 -- (-387.511) (-388.543) [-389.201] (-387.054) * (-387.816) [-388.091] (-389.527) (-386.377) -- 0:00:17
Average standard deviation of split frequencies: 0.008327
705500 -- (-388.469) [-391.336] (-388.765) (-389.370) * (-388.767) (-388.321) [-386.468] (-387.498) -- 0:00:17
706000 -- (-389.704) (-389.335) [-387.102] (-389.342) * (-387.170) (-389.296) (-390.422) [-387.511] -- 0:00:17
706500 -- (-387.600) (-391.730) [-387.282] (-390.504) * (-388.961) [-387.216] (-386.613) (-387.030) -- 0:00:17
707000 -- [-387.368] (-387.102) (-388.426) (-390.454) * (-387.195) (-387.641) [-387.499] (-390.811) -- 0:00:17
707500 -- (-386.864) [-387.103] (-388.457) (-387.810) * [-389.702] (-386.929) (-388.119) (-389.807) -- 0:00:17
708000 -- (-389.120) (-388.550) [-386.464] (-390.447) * (-391.098) (-388.515) [-389.806] (-391.793) -- 0:00:17
708500 -- (-387.934) (-387.091) (-385.988) [-387.248] * [-388.148] (-388.004) (-392.286) (-388.216) -- 0:00:17
709000 -- (-393.036) [-387.769] (-386.649) (-388.574) * (-387.631) [-389.425] (-387.649) (-389.704) -- 0:00:17
709500 -- (-390.539) [-390.377] (-390.379) (-386.979) * (-388.404) (-389.194) [-388.106] (-389.054) -- 0:00:17
710000 -- [-389.883] (-386.421) (-394.406) (-388.684) * (-386.677) (-389.874) [-386.462] (-391.123) -- 0:00:17
Average standard deviation of split frequencies: 0.008311
710500 -- (-387.636) (-387.324) [-391.492] (-392.010) * [-387.158] (-391.177) (-387.910) (-387.130) -- 0:00:17
711000 -- (-392.430) (-389.500) (-387.455) [-388.894] * (-389.866) (-388.711) [-387.781] (-387.406) -- 0:00:17
711500 -- (-393.291) (-387.531) (-387.559) [-386.938] * (-390.667) (-387.567) (-393.181) [-390.563] -- 0:00:17
712000 -- (-388.224) (-389.513) (-389.355) [-388.526] * [-392.876] (-387.295) (-388.647) (-388.674) -- 0:00:17
712500 -- (-390.207) (-389.820) (-389.920) [-388.704] * (-389.356) (-388.860) [-387.374] (-390.171) -- 0:00:17
713000 -- (-390.458) (-390.114) [-388.780] (-399.978) * (-388.608) (-387.112) [-388.891] (-388.709) -- 0:00:17
713500 -- (-386.899) [-386.591] (-389.588) (-386.227) * [-389.961] (-392.806) (-388.217) (-387.457) -- 0:00:17
714000 -- (-387.827) (-389.041) (-387.685) [-386.607] * (-393.185) (-394.297) (-390.077) [-388.042] -- 0:00:17
714500 -- [-387.882] (-386.773) (-389.079) (-386.275) * (-391.524) (-387.459) [-387.485] (-386.501) -- 0:00:17
715000 -- [-388.649] (-388.130) (-387.873) (-387.642) * (-389.157) [-386.865] (-391.400) (-388.731) -- 0:00:17
Average standard deviation of split frequencies: 0.007823
715500 -- (-387.608) (-388.124) [-387.755] (-388.018) * (-387.921) (-389.970) (-388.719) [-389.019] -- 0:00:17
716000 -- (-389.132) (-393.626) [-389.666] (-387.448) * (-386.874) (-389.140) (-390.721) [-387.768] -- 0:00:17
716500 -- (-388.195) (-387.367) [-388.113] (-389.372) * [-387.270] (-387.601) (-389.166) (-388.006) -- 0:00:17
717000 -- (-387.536) (-387.928) [-388.406] (-386.954) * (-389.153) [-391.319] (-386.922) (-386.735) -- 0:00:16
717500 -- (-389.249) (-388.962) [-388.493] (-387.735) * (-386.997) (-388.924) [-386.239] (-389.611) -- 0:00:16
718000 -- [-390.022] (-387.635) (-388.385) (-390.137) * [-388.093] (-387.081) (-388.898) (-389.362) -- 0:00:16
718500 -- [-387.130] (-389.472) (-388.580) (-389.153) * (-387.466) [-388.423] (-387.830) (-386.095) -- 0:00:16
719000 -- (-387.413) [-388.226] (-395.497) (-390.199) * (-387.115) [-388.465] (-392.864) (-387.923) -- 0:00:16
719500 -- (-392.678) (-387.613) (-395.354) [-391.985] * (-387.255) (-387.516) [-389.265] (-389.375) -- 0:00:16
720000 -- (-392.876) [-387.995] (-387.465) (-395.164) * (-387.477) [-388.948] (-389.167) (-388.873) -- 0:00:16
Average standard deviation of split frequencies: 0.007195
720500 -- [-391.815] (-388.950) (-390.447) (-387.130) * (-386.909) [-387.707] (-388.681) (-393.032) -- 0:00:16
721000 -- (-392.920) (-392.301) [-387.677] (-387.922) * [-387.103] (-389.922) (-387.612) (-390.336) -- 0:00:17
721500 -- (-391.410) [-389.102] (-387.844) (-387.887) * (-386.540) (-387.726) (-388.746) [-388.989] -- 0:00:16
722000 -- (-387.163) [-387.550] (-386.541) (-388.250) * [-387.044] (-387.137) (-389.643) (-393.237) -- 0:00:16
722500 -- (-387.222) [-387.097] (-388.078) (-387.221) * [-386.324] (-388.735) (-389.713) (-390.287) -- 0:00:16
723000 -- [-388.327] (-387.330) (-386.421) (-389.065) * [-386.645] (-388.399) (-389.827) (-388.366) -- 0:00:16
723500 -- (-388.952) (-389.397) (-386.977) [-390.477] * (-389.205) (-389.302) (-389.355) [-390.547] -- 0:00:16
724000 -- (-390.354) (-388.751) [-386.275] (-390.035) * (-388.749) [-391.498] (-390.262) (-387.671) -- 0:00:16
724500 -- (-387.110) (-389.039) [-388.213] (-387.680) * (-387.922) (-387.148) (-393.139) [-387.547] -- 0:00:16
725000 -- (-390.252) (-386.864) [-388.094] (-388.644) * (-387.899) (-387.641) [-389.999] (-388.126) -- 0:00:16
Average standard deviation of split frequencies: 0.007295
725500 -- [-390.068] (-390.064) (-387.439) (-392.231) * (-386.620) (-387.147) (-390.213) [-389.594] -- 0:00:16
726000 -- (-387.048) (-386.697) [-390.897] (-390.332) * (-387.430) (-386.656) [-387.797] (-386.625) -- 0:00:16
726500 -- (-393.790) (-386.795) (-389.027) [-389.505] * (-386.854) [-392.466] (-389.265) (-386.924) -- 0:00:16
727000 -- (-386.752) (-387.365) [-389.798] (-388.384) * (-390.320) [-386.469] (-389.118) (-387.908) -- 0:00:16
727500 -- (-387.747) (-390.276) (-394.637) [-387.374] * [-388.308] (-386.660) (-388.034) (-389.020) -- 0:00:16
728000 -- (-388.214) (-388.357) (-389.468) [-387.013] * (-387.189) [-386.833] (-387.806) (-390.512) -- 0:00:16
728500 -- [-387.615] (-389.006) (-389.684) (-388.626) * [-386.916] (-387.501) (-389.759) (-389.638) -- 0:00:16
729000 -- (-388.131) [-387.749] (-391.184) (-389.543) * [-387.250] (-387.055) (-386.922) (-386.768) -- 0:00:16
729500 -- [-390.666] (-391.131) (-388.634) (-391.518) * (-388.264) [-387.722] (-388.520) (-392.692) -- 0:00:16
730000 -- (-387.863) (-387.695) (-387.695) [-387.896] * (-387.907) [-386.762] (-387.839) (-389.366) -- 0:00:16
Average standard deviation of split frequencies: 0.006983
730500 -- [-386.932] (-387.983) (-389.158) (-387.701) * (-387.605) [-386.856] (-388.421) (-390.509) -- 0:00:16
731000 -- [-386.561] (-386.759) (-389.491) (-388.405) * (-388.533) [-391.333] (-386.873) (-387.919) -- 0:00:16
731500 -- (-390.264) [-387.680] (-390.336) (-389.620) * (-390.320) (-388.545) (-388.678) [-387.510] -- 0:00:16
732000 -- [-386.860] (-386.589) (-392.392) (-386.824) * (-387.312) (-387.459) (-390.316) [-387.783] -- 0:00:16
732500 -- [-388.638] (-389.971) (-388.473) (-389.766) * (-386.508) (-388.643) (-387.835) [-389.811] -- 0:00:16
733000 -- [-387.130] (-388.835) (-388.124) (-390.989) * (-386.708) (-388.496) (-388.802) [-386.575] -- 0:00:16
733500 -- (-389.378) (-388.810) [-388.330] (-390.506) * [-386.427] (-390.118) (-386.869) (-387.255) -- 0:00:15
734000 -- [-386.434] (-388.136) (-388.841) (-389.858) * (-387.666) [-389.814] (-388.098) (-386.226) -- 0:00:15
734500 -- (-392.720) [-388.705] (-390.445) (-387.729) * (-390.338) (-391.374) (-392.961) [-387.614] -- 0:00:15
735000 -- (-389.763) [-392.183] (-387.404) (-394.493) * (-387.721) (-386.903) [-388.621] (-386.655) -- 0:00:15
Average standard deviation of split frequencies: 0.007158
735500 -- (-387.341) (-396.024) [-390.303] (-388.029) * (-390.066) (-389.910) (-387.196) [-391.540] -- 0:00:15
736000 -- [-386.341] (-387.689) (-388.401) (-388.140) * (-386.739) (-389.254) (-390.027) [-388.350] -- 0:00:15
736500 -- [-388.970] (-387.306) (-390.082) (-390.627) * (-386.610) [-388.182] (-388.402) (-388.034) -- 0:00:15
737000 -- (-387.722) (-393.101) [-390.349] (-389.410) * (-388.908) [-392.544] (-387.106) (-388.131) -- 0:00:15
737500 -- (-387.775) (-389.064) (-387.253) [-389.047] * (-390.296) (-389.840) (-387.839) [-387.185] -- 0:00:15
738000 -- (-386.451) (-389.642) (-387.375) [-391.124] * (-389.736) (-396.166) (-389.028) [-387.659] -- 0:00:15
738500 -- (-388.151) (-388.091) (-389.655) [-388.564] * (-387.897) (-389.920) [-390.760] (-390.075) -- 0:00:15
739000 -- (-388.497) [-388.699] (-389.261) (-388.038) * (-387.280) [-387.818] (-386.496) (-389.065) -- 0:00:15
739500 -- (-386.824) (-387.977) [-388.291] (-387.182) * (-387.326) (-390.305) (-386.928) [-386.415] -- 0:00:15
740000 -- (-388.452) (-388.391) [-387.329] (-387.737) * (-388.218) [-389.064] (-390.389) (-388.604) -- 0:00:15
Average standard deviation of split frequencies: 0.007301
740500 -- [-386.851] (-389.371) (-386.744) (-387.747) * [-388.648] (-392.042) (-387.443) (-388.419) -- 0:00:15
741000 -- (-387.813) (-390.835) (-389.527) [-387.767] * (-386.372) (-392.431) (-386.475) [-387.567] -- 0:00:15
741500 -- (-387.711) [-386.955] (-387.799) (-388.430) * (-388.857) (-390.620) (-387.239) [-386.629] -- 0:00:15
742000 -- (-390.864) (-387.240) (-390.114) [-388.724] * (-387.458) (-389.169) (-386.111) [-387.149] -- 0:00:15
742500 -- (-391.034) [-387.572] (-389.921) (-387.725) * (-386.802) [-387.468] (-386.375) (-389.231) -- 0:00:15
743000 -- (-388.353) (-389.060) [-389.389] (-386.414) * (-387.451) (-388.782) [-388.189] (-390.190) -- 0:00:15
743500 -- (-388.866) (-390.155) [-386.929] (-389.936) * (-389.762) (-387.628) (-388.429) [-386.332] -- 0:00:15
744000 -- (-386.555) [-395.517] (-389.421) (-387.931) * (-387.375) [-389.900] (-387.840) (-388.944) -- 0:00:15
744500 -- [-389.909] (-389.174) (-386.819) (-388.216) * (-388.697) (-389.447) [-386.133] (-387.127) -- 0:00:15
745000 -- [-387.443] (-387.229) (-386.805) (-390.062) * (-391.569) (-388.721) [-386.037] (-387.208) -- 0:00:15
Average standard deviation of split frequencies: 0.007211
745500 -- [-387.181] (-386.798) (-387.468) (-388.498) * [-391.798] (-386.668) (-388.152) (-387.615) -- 0:00:15
746000 -- (-391.479) (-387.990) (-388.668) [-387.039] * (-390.002) (-387.212) (-387.137) [-386.745] -- 0:00:15
746500 -- (-389.347) (-396.087) [-387.640] (-387.281) * (-388.952) [-390.798] (-386.987) (-387.976) -- 0:00:15
747000 -- (-387.739) (-392.818) (-389.565) [-388.333] * [-387.754] (-390.917) (-387.201) (-386.780) -- 0:00:15
747500 -- (-388.541) (-390.313) [-389.395] (-388.933) * (-388.849) (-389.695) [-390.090] (-386.789) -- 0:00:15
748000 -- (-387.113) (-390.334) [-386.674] (-389.332) * [-388.212] (-389.737) (-388.141) (-386.364) -- 0:00:15
748500 -- (-388.827) (-392.424) (-387.659) [-390.174] * (-389.658) [-387.102] (-388.212) (-389.156) -- 0:00:15
749000 -- [-389.557] (-388.719) (-387.958) (-390.482) * (-390.296) (-388.688) [-390.477] (-388.914) -- 0:00:15
749500 -- (-390.159) [-389.795] (-390.790) (-386.865) * (-388.422) (-387.547) (-387.545) [-388.380] -- 0:00:15
750000 -- (-389.518) [-387.309] (-387.376) (-389.015) * (-392.084) (-391.113) (-388.378) [-386.088] -- 0:00:15
Average standard deviation of split frequencies: 0.007203
750500 -- (-388.257) (-391.540) [-389.326] (-388.482) * [-389.922] (-389.598) (-386.072) (-387.768) -- 0:00:14
751000 -- [-387.005] (-386.588) (-390.728) (-386.690) * (-388.761) (-387.644) (-390.498) [-388.489] -- 0:00:14
751500 -- (-387.329) (-387.212) (-386.411) [-388.706] * (-389.403) (-388.337) (-388.574) [-388.631] -- 0:00:14
752000 -- (-389.368) [-388.253] (-386.538) (-388.967) * [-389.850] (-392.404) (-388.441) (-386.782) -- 0:00:14
752500 -- (-390.321) [-388.734] (-388.490) (-386.482) * (-388.713) [-389.105] (-390.551) (-388.038) -- 0:00:14
753000 -- (-396.168) [-387.763] (-389.980) (-387.103) * (-387.872) [-390.090] (-388.807) (-388.504) -- 0:00:14
753500 -- (-388.020) (-390.720) (-388.990) [-388.122] * [-386.434] (-388.414) (-388.177) (-390.810) -- 0:00:14
754000 -- (-389.884) [-389.267] (-387.534) (-390.394) * [-388.021] (-389.405) (-388.018) (-387.712) -- 0:00:14
754500 -- [-387.571] (-388.130) (-387.680) (-386.747) * (-386.330) [-389.142] (-390.657) (-388.647) -- 0:00:14
755000 -- [-388.312] (-389.019) (-387.134) (-386.763) * (-387.864) (-386.791) [-391.427] (-388.388) -- 0:00:14
Average standard deviation of split frequencies: 0.007519
755500 -- (-389.042) (-389.425) (-388.390) [-386.934] * (-387.873) (-388.166) [-390.156] (-391.735) -- 0:00:14
756000 -- (-390.447) [-390.272] (-387.647) (-389.521) * [-387.757] (-387.200) (-389.346) (-389.926) -- 0:00:14
756500 -- (-388.481) (-393.233) [-386.334] (-392.228) * (-389.199) (-390.210) (-388.535) [-390.345] -- 0:00:14
757000 -- (-387.702) (-392.008) [-387.466] (-391.579) * (-387.601) (-390.691) (-389.797) [-387.418] -- 0:00:14
757500 -- (-388.959) (-391.499) (-386.897) [-388.730] * (-386.358) (-387.303) (-389.092) [-393.647] -- 0:00:14
758000 -- (-386.395) (-386.679) [-389.679] (-387.150) * (-386.234) [-387.420] (-388.176) (-386.995) -- 0:00:14
758500 -- (-387.070) (-389.455) [-387.265] (-388.333) * (-388.163) [-387.471] (-389.892) (-386.741) -- 0:00:14
759000 -- (-390.108) (-395.440) [-387.528] (-389.705) * (-387.856) (-390.803) (-386.645) [-389.084] -- 0:00:14
759500 -- (-386.702) [-389.086] (-387.804) (-388.427) * (-388.356) [-389.092] (-386.451) (-390.820) -- 0:00:14
760000 -- (-389.353) (-388.626) (-387.553) [-388.126] * [-386.583] (-386.697) (-388.528) (-391.700) -- 0:00:14
Average standard deviation of split frequencies: 0.007874
760500 -- [-387.905] (-388.738) (-387.986) (-393.066) * (-387.972) [-388.994] (-390.683) (-387.316) -- 0:00:14
761000 -- (-387.585) [-388.523] (-387.346) (-390.618) * (-387.208) (-389.775) [-389.872] (-390.920) -- 0:00:14
761500 -- (-389.126) (-387.628) [-387.500] (-386.937) * (-388.146) (-387.928) (-388.922) [-387.381] -- 0:00:14
762000 -- (-389.440) [-386.246] (-387.097) (-391.759) * (-391.522) [-387.690] (-386.842) (-386.985) -- 0:00:14
762500 -- (-388.810) (-388.858) (-389.405) [-391.825] * (-389.593) [-389.877] (-387.219) (-387.472) -- 0:00:14
763000 -- (-386.426) [-389.607] (-389.894) (-387.409) * (-388.765) [-387.428] (-387.544) (-387.695) -- 0:00:14
763500 -- (-386.798) (-390.929) (-390.354) [-390.164] * (-392.912) (-390.469) [-388.497] (-387.494) -- 0:00:14
764000 -- [-387.326] (-388.068) (-388.037) (-392.636) * (-386.478) (-388.908) (-388.325) [-387.357] -- 0:00:14
764500 -- [-389.439] (-393.010) (-387.083) (-388.364) * [-386.954] (-389.377) (-389.259) (-389.475) -- 0:00:14
765000 -- (-389.817) (-391.085) (-387.356) [-388.201] * [-388.889] (-390.024) (-387.697) (-387.912) -- 0:00:14
Average standard deviation of split frequencies: 0.007892
765500 -- [-389.363] (-387.536) (-390.284) (-387.995) * (-386.921) [-389.809] (-387.141) (-389.620) -- 0:00:14
766000 -- [-388.010] (-387.620) (-389.455) (-388.228) * [-387.374] (-389.009) (-388.279) (-387.588) -- 0:00:14
766500 -- [-388.964] (-386.975) (-393.329) (-390.178) * [-389.907] (-387.365) (-386.316) (-388.382) -- 0:00:14
767000 -- (-387.663) (-390.952) (-387.827) [-389.145] * (-387.973) (-389.002) (-390.677) [-389.824] -- 0:00:13
767500 -- (-387.011) [-389.497] (-388.910) (-388.285) * (-389.851) [-390.406] (-390.934) (-389.511) -- 0:00:13
768000 -- (-386.922) (-388.383) (-387.505) [-389.537] * (-389.541) [-387.691] (-387.461) (-386.697) -- 0:00:13
768500 -- (-386.422) [-387.341] (-387.997) (-390.129) * (-391.133) (-387.304) (-389.608) [-386.540] -- 0:00:13
769000 -- (-387.334) [-386.273] (-390.900) (-389.150) * [-390.786] (-386.744) (-391.889) (-387.988) -- 0:00:13
769500 -- (-389.232) [-391.091] (-386.987) (-388.826) * (-387.513) (-387.821) (-390.072) [-386.218] -- 0:00:13
770000 -- (-389.503) (-391.090) [-386.666] (-390.791) * (-386.622) (-386.154) (-387.187) [-387.885] -- 0:00:13
Average standard deviation of split frequencies: 0.007880
770500 -- (-388.384) [-387.732] (-387.290) (-387.780) * (-388.117) (-387.254) [-389.983] (-393.442) -- 0:00:13
771000 -- (-387.894) (-391.406) (-388.708) [-389.532] * (-391.026) [-388.975] (-389.528) (-386.900) -- 0:00:13
771500 -- (-389.493) (-386.687) (-389.775) [-388.218] * (-391.924) [-387.992] (-388.294) (-388.006) -- 0:00:13
772000 -- (-388.050) [-387.529] (-387.596) (-389.166) * (-389.223) (-392.009) [-389.199] (-386.579) -- 0:00:13
772500 -- (-389.646) (-389.041) (-386.787) [-387.861] * (-387.818) (-397.204) [-386.211] (-390.700) -- 0:00:13
773000 -- (-389.587) [-386.751] (-388.383) (-390.142) * (-388.933) (-390.414) (-390.549) [-388.245] -- 0:00:13
773500 -- (-386.351) (-386.853) (-389.990) [-386.738] * (-390.400) [-388.211] (-391.590) (-392.581) -- 0:00:13
774000 -- (-388.801) (-388.271) [-388.249] (-387.740) * (-402.490) (-387.561) (-394.348) [-390.139] -- 0:00:13
774500 -- [-386.901] (-388.791) (-388.755) (-388.467) * (-386.291) (-388.104) (-391.127) [-387.591] -- 0:00:13
775000 -- (-386.322) (-388.554) (-391.644) [-388.880] * (-389.088) (-387.449) (-388.847) [-387.989] -- 0:00:13
Average standard deviation of split frequencies: 0.008040
775500 -- (-386.712) (-387.143) (-389.454) [-388.028] * (-393.625) (-388.443) [-390.985] (-388.508) -- 0:00:13
776000 -- [-389.127] (-387.150) (-389.158) (-388.401) * (-393.116) (-386.366) (-388.680) [-387.272] -- 0:00:13
776500 -- (-390.064) (-388.757) [-388.219] (-389.057) * (-391.506) (-386.978) [-388.652] (-387.242) -- 0:00:13
777000 -- (-389.581) (-388.156) (-390.083) [-388.168] * (-386.720) (-387.195) (-387.815) [-388.336] -- 0:00:13
777500 -- (-386.548) (-391.065) (-387.576) [-387.109] * (-390.542) [-388.459] (-387.170) (-389.320) -- 0:00:13
778000 -- (-388.491) (-389.223) (-388.891) [-386.184] * (-391.744) (-388.314) (-388.997) [-387.905] -- 0:00:13
778500 -- [-389.740] (-392.684) (-387.647) (-389.118) * [-389.176] (-393.671) (-389.333) (-389.199) -- 0:00:13
779000 -- (-386.695) (-390.976) (-387.126) [-386.381] * (-390.086) [-388.935] (-392.357) (-391.334) -- 0:00:13
779500 -- (-392.362) (-386.928) (-388.221) [-387.611] * [-388.009] (-390.093) (-390.070) (-391.154) -- 0:00:13
780000 -- [-388.177] (-387.335) (-388.545) (-389.073) * [-389.013] (-389.200) (-386.794) (-394.616) -- 0:00:13
Average standard deviation of split frequencies: 0.007495
780500 -- (-386.876) (-389.705) [-389.202] (-390.658) * (-388.520) [-386.312] (-387.823) (-390.365) -- 0:00:13
781000 -- (-389.155) (-389.670) (-387.038) [-388.920] * [-391.195] (-390.488) (-386.088) (-386.963) -- 0:00:13
781500 -- (-387.617) [-389.373] (-390.741) (-389.176) * [-388.205] (-390.053) (-389.168) (-390.644) -- 0:00:13
782000 -- (-388.957) [-387.405] (-388.148) (-387.698) * (-387.876) [-387.413] (-388.290) (-389.791) -- 0:00:13
782500 -- [-389.702] (-386.611) (-387.130) (-391.007) * [-389.355] (-393.496) (-390.955) (-389.048) -- 0:00:13
783000 -- (-390.197) (-389.333) (-390.938) [-391.655] * (-388.158) [-386.258] (-388.785) (-391.626) -- 0:00:13
783500 -- (-387.310) (-386.647) (-387.100) [-388.023] * (-387.767) [-387.041] (-388.215) (-391.531) -- 0:00:12
784000 -- (-390.140) (-386.952) (-387.663) [-392.815] * (-387.741) (-387.364) [-388.336] (-388.294) -- 0:00:12
784500 -- (-388.855) (-387.562) [-386.458] (-388.929) * [-387.063] (-387.004) (-391.501) (-387.956) -- 0:00:12
785000 -- (-391.980) (-388.328) [-389.890] (-387.223) * (-390.083) (-392.180) (-388.146) [-387.641] -- 0:00:12
Average standard deviation of split frequencies: 0.007515
785500 -- (-388.052) (-390.416) [-390.134] (-389.510) * (-389.234) (-386.706) (-388.415) [-388.374] -- 0:00:12
786000 -- (-388.597) (-391.538) [-388.655] (-391.014) * [-390.301] (-388.484) (-386.472) (-387.505) -- 0:00:12
786500 -- [-390.175] (-389.843) (-389.914) (-391.719) * [-389.511] (-388.004) (-388.446) (-388.625) -- 0:00:12
787000 -- (-388.065) [-388.029] (-390.290) (-396.391) * (-387.784) (-389.395) (-389.456) [-387.418] -- 0:00:12
787500 -- [-387.454] (-390.400) (-392.623) (-392.313) * (-387.474) (-389.805) [-390.355] (-393.861) -- 0:00:12
788000 -- (-389.237) [-388.271] (-393.630) (-390.422) * [-387.301] (-389.907) (-395.016) (-388.569) -- 0:00:12
788500 -- (-389.278) (-389.278) [-387.381] (-389.447) * (-386.373) (-389.431) [-390.465] (-389.176) -- 0:00:12
789000 -- (-393.216) (-388.139) [-387.824] (-390.825) * [-386.796] (-387.750) (-390.412) (-389.197) -- 0:00:12
789500 -- (-388.044) (-387.381) [-387.680] (-387.630) * [-386.317] (-389.992) (-392.910) (-390.852) -- 0:00:12
790000 -- [-389.367] (-387.607) (-388.155) (-386.370) * [-386.725] (-390.342) (-388.824) (-392.131) -- 0:00:12
Average standard deviation of split frequencies: 0.007225
790500 -- [-387.695] (-389.731) (-388.534) (-387.056) * (-387.106) (-392.019) [-388.890] (-388.769) -- 0:00:12
791000 -- (-390.524) (-389.209) (-388.618) [-390.538] * (-387.612) (-388.194) (-386.800) [-387.040] -- 0:00:12
791500 -- [-387.600] (-398.450) (-389.320) (-390.095) * (-386.609) [-387.677] (-388.309) (-389.115) -- 0:00:12
792000 -- [-388.252] (-387.845) (-390.640) (-387.976) * (-386.818) (-387.849) [-386.936] (-389.838) -- 0:00:12
792500 -- (-387.785) (-387.697) (-388.680) [-388.696] * [-390.050] (-387.173) (-388.619) (-391.420) -- 0:00:12
793000 -- (-389.103) (-386.442) [-388.915] (-390.785) * [-386.924] (-390.921) (-389.091) (-388.955) -- 0:00:12
793500 -- (-388.472) [-386.171] (-387.484) (-389.821) * (-389.244) (-388.952) (-386.925) [-390.297] -- 0:00:12
794000 -- (-388.314) (-386.550) (-387.978) [-387.492] * [-387.322] (-387.806) (-389.647) (-390.702) -- 0:00:12
794500 -- (-388.982) [-388.036] (-387.188) (-388.462) * [-386.093] (-386.804) (-390.792) (-388.456) -- 0:00:12
795000 -- (-388.914) (-390.444) (-393.432) [-391.057] * (-393.781) [-386.753] (-389.011) (-395.980) -- 0:00:12
Average standard deviation of split frequencies: 0.007070
795500 -- (-392.492) [-391.145] (-387.332) (-388.195) * (-387.158) (-388.203) (-387.808) [-389.286] -- 0:00:12
796000 -- [-391.654] (-391.602) (-390.678) (-389.090) * (-387.735) (-389.174) (-389.393) [-386.547] -- 0:00:12
796500 -- [-388.257] (-392.352) (-390.084) (-389.758) * (-390.550) (-391.293) (-390.469) [-387.602] -- 0:00:12
797000 -- [-386.894] (-388.562) (-388.699) (-388.983) * (-393.468) [-390.784] (-392.196) (-389.639) -- 0:00:12
797500 -- (-389.209) [-388.029] (-389.731) (-387.127) * (-390.199) (-394.893) [-388.857] (-387.372) -- 0:00:12
798000 -- (-387.452) (-387.726) [-392.948] (-389.209) * (-389.991) (-393.896) [-390.249] (-387.947) -- 0:00:12
798500 -- [-389.397] (-387.267) (-389.931) (-392.051) * (-390.363) [-394.014] (-387.425) (-392.517) -- 0:00:12
799000 -- (-389.919) (-388.709) [-390.030] (-392.026) * (-387.727) (-391.845) (-388.422) [-388.058] -- 0:00:12
799500 -- [-386.942] (-388.208) (-389.140) (-392.559) * (-390.132) (-387.313) [-387.219] (-387.953) -- 0:00:12
800000 -- (-388.282) (-392.016) [-390.667] (-387.509) * (-388.840) [-387.846] (-388.535) (-389.360) -- 0:00:12
Average standard deviation of split frequencies: 0.007412
800500 -- (-393.831) (-390.837) [-388.632] (-387.276) * (-388.676) (-388.040) (-386.545) [-388.746] -- 0:00:11
801000 -- [-388.397] (-387.853) (-387.708) (-387.294) * [-387.810] (-391.133) (-387.673) (-387.620) -- 0:00:11
801500 -- (-393.117) [-389.793] (-388.173) (-386.997) * (-392.023) [-390.339] (-387.042) (-387.411) -- 0:00:11
802000 -- (-389.231) (-387.474) [-387.642] (-391.109) * (-388.941) (-388.486) [-387.889] (-388.582) -- 0:00:11
802500 -- (-387.798) [-386.583] (-393.807) (-389.328) * (-390.414) (-389.360) (-388.195) [-389.328] -- 0:00:11
803000 -- (-389.550) (-386.967) (-391.310) [-387.690] * (-390.422) (-388.933) (-387.022) [-388.336] -- 0:00:11
803500 -- (-389.449) [-387.489] (-390.463) (-388.513) * (-389.415) [-394.691] (-387.645) (-391.049) -- 0:00:11
804000 -- (-389.634) (-387.733) (-390.231) [-388.175] * (-388.681) (-389.291) (-387.484) [-389.899] -- 0:00:11
804500 -- [-387.673] (-387.376) (-387.210) (-389.057) * (-387.552) (-387.288) [-386.436] (-390.949) -- 0:00:11
805000 -- [-387.353] (-387.380) (-388.512) (-386.035) * (-388.866) (-387.267) (-386.241) [-388.158] -- 0:00:11
Average standard deviation of split frequencies: 0.007156
805500 -- (-389.407) (-387.175) (-387.873) [-390.120] * (-388.236) (-386.651) [-387.451] (-391.287) -- 0:00:11
806000 -- (-387.865) (-388.130) [-386.686] (-387.851) * [-389.090] (-387.202) (-386.809) (-392.067) -- 0:00:11
806500 -- (-388.077) (-388.498) [-388.918] (-387.273) * (-388.287) (-386.497) [-386.659] (-388.702) -- 0:00:11
807000 -- (-388.806) (-390.748) (-389.369) [-388.201] * (-387.787) (-390.460) [-387.646] (-387.624) -- 0:00:11
807500 -- (-388.851) (-387.871) [-390.192] (-390.291) * (-386.930) (-388.776) (-386.787) [-389.533] -- 0:00:11
808000 -- (-390.939) (-388.735) (-389.020) [-386.724] * (-387.745) [-389.011] (-387.516) (-388.044) -- 0:00:11
808500 -- (-386.659) [-391.141] (-386.162) (-392.208) * (-388.668) (-390.235) [-387.787] (-387.530) -- 0:00:11
809000 -- [-391.159] (-395.869) (-387.316) (-389.547) * (-387.278) (-386.056) [-389.009] (-388.875) -- 0:00:11
809500 -- (-386.503) [-389.638] (-390.738) (-388.068) * (-388.090) [-386.614] (-388.307) (-389.216) -- 0:00:11
810000 -- (-389.688) [-389.522] (-388.302) (-391.852) * (-390.197) (-392.453) (-387.666) [-387.479] -- 0:00:11
Average standard deviation of split frequencies: 0.006944
810500 -- (-392.548) (-387.556) [-386.372] (-390.941) * (-387.368) (-389.291) [-388.037] (-387.948) -- 0:00:11
811000 -- (-391.514) (-390.896) (-386.056) [-392.472] * (-386.579) (-387.322) (-388.422) [-392.748] -- 0:00:11
811500 -- (-387.976) [-386.981] (-389.333) (-389.675) * (-386.103) (-396.739) [-387.945] (-388.380) -- 0:00:11
812000 -- [-386.259] (-387.392) (-389.414) (-393.253) * (-386.108) (-387.057) (-388.873) [-389.732] -- 0:00:11
812500 -- (-386.702) (-388.940) [-387.023] (-388.701) * (-386.685) (-387.075) [-389.823] (-388.425) -- 0:00:11
813000 -- (-391.762) (-391.484) (-387.975) [-388.380] * (-387.401) (-388.117) [-387.573] (-387.075) -- 0:00:11
813500 -- (-386.474) [-387.688] (-387.521) (-388.690) * (-386.314) [-389.274] (-386.389) (-388.709) -- 0:00:11
814000 -- (-390.339) [-390.418] (-387.402) (-388.205) * (-387.071) (-390.757) (-387.718) [-389.341] -- 0:00:11
814500 -- (-388.668) (-390.545) (-387.789) [-387.495] * (-387.927) (-387.939) [-387.190] (-387.794) -- 0:00:11
815000 -- (-387.365) (-389.343) (-387.122) [-387.188] * [-388.095] (-391.070) (-386.918) (-387.678) -- 0:00:11
Average standard deviation of split frequencies: 0.006830
815500 -- [-386.519] (-389.841) (-390.890) (-390.056) * (-386.962) (-392.674) (-387.485) [-388.101] -- 0:00:11
816000 -- [-386.511] (-391.090) (-388.599) (-386.908) * (-392.517) (-389.401) (-389.682) [-390.499] -- 0:00:11
816500 -- (-387.372) [-388.685] (-389.380) (-389.187) * (-388.102) (-390.890) (-389.332) [-389.772] -- 0:00:11
817000 -- (-387.352) (-388.331) [-389.943] (-386.786) * (-387.322) (-388.274) [-386.782] (-388.685) -- 0:00:10
817500 -- (-390.981) [-388.236] (-389.946) (-389.367) * (-388.369) (-388.653) (-387.846) [-388.034] -- 0:00:10
818000 -- (-391.755) (-388.340) (-392.290) [-391.030] * (-388.712) (-392.390) (-388.441) [-386.682] -- 0:00:10
818500 -- [-391.552] (-387.013) (-389.730) (-389.027) * (-391.476) (-390.393) (-387.527) [-387.306] -- 0:00:10
819000 -- (-389.068) [-387.561] (-386.264) (-393.966) * (-391.948) [-386.874] (-387.278) (-388.788) -- 0:00:10
819500 -- (-387.933) (-387.836) (-388.338) [-389.136] * [-388.604] (-393.387) (-388.916) (-387.359) -- 0:00:10
820000 -- (-389.910) (-387.563) [-388.846] (-387.519) * (-388.806) [-389.077] (-390.644) (-387.514) -- 0:00:10
Average standard deviation of split frequencies: 0.006785
820500 -- [-388.657] (-388.606) (-389.898) (-387.057) * (-391.777) [-387.583] (-387.506) (-387.606) -- 0:00:10
821000 -- (-388.910) [-388.068] (-388.510) (-386.613) * (-387.328) (-389.572) [-386.649] (-387.562) -- 0:00:10
821500 -- (-390.443) [-388.362] (-387.000) (-393.478) * (-388.685) (-389.000) (-388.135) [-388.476] -- 0:00:10
822000 -- (-386.766) [-389.095] (-389.753) (-388.716) * (-389.993) (-387.225) (-393.873) [-390.997] -- 0:00:10
822500 -- (-389.272) (-386.710) (-389.621) [-387.161] * (-386.879) [-388.434] (-388.185) (-388.077) -- 0:00:10
823000 -- (-391.420) [-387.725] (-388.934) (-388.080) * (-387.801) (-393.322) [-388.236] (-387.938) -- 0:00:10
823500 -- (-390.494) (-388.445) (-388.911) [-389.025] * (-388.702) [-388.597] (-387.346) (-387.811) -- 0:00:10
824000 -- [-386.305] (-388.297) (-388.933) (-389.165) * (-387.627) (-387.071) [-387.033] (-388.309) -- 0:00:10
824500 -- (-387.713) [-387.752] (-387.819) (-394.010) * (-390.332) (-388.847) (-387.443) [-390.112] -- 0:00:10
825000 -- (-387.401) [-391.464] (-386.816) (-389.609) * (-388.558) [-388.696] (-388.251) (-387.839) -- 0:00:10
Average standard deviation of split frequencies: 0.006882
825500 -- (-387.927) [-391.923] (-391.755) (-387.841) * (-386.229) (-389.199) (-387.567) [-390.360] -- 0:00:10
826000 -- (-394.960) (-387.371) [-388.823] (-387.138) * (-386.558) (-387.209) (-388.045) [-389.427] -- 0:00:10
826500 -- (-393.986) (-388.773) [-387.868] (-387.308) * [-387.024] (-388.292) (-387.826) (-387.709) -- 0:00:10
827000 -- (-391.100) [-387.740] (-387.788) (-387.504) * (-390.181) (-392.312) [-386.880] (-388.426) -- 0:00:10
827500 -- [-387.753] (-388.942) (-388.595) (-387.627) * [-389.367] (-390.533) (-387.075) (-388.302) -- 0:00:10
828000 -- [-389.145] (-390.095) (-387.987) (-388.356) * (-389.212) [-390.103] (-387.956) (-387.200) -- 0:00:10
828500 -- (-392.688) (-389.652) [-387.163] (-388.950) * (-390.204) [-388.256] (-386.916) (-387.458) -- 0:00:10
829000 -- [-392.280] (-389.983) (-386.760) (-389.462) * (-386.397) (-391.179) (-388.929) [-388.724] -- 0:00:10
829500 -- (-386.741) [-388.395] (-386.758) (-387.237) * (-386.852) (-388.966) [-389.343] (-387.238) -- 0:00:10
830000 -- (-386.453) (-391.762) (-390.091) [-387.383] * (-390.313) [-387.230] (-389.100) (-388.567) -- 0:00:10
Average standard deviation of split frequencies: 0.006910
830500 -- [-386.365] (-388.718) (-389.195) (-388.167) * [-388.666] (-388.060) (-388.620) (-387.941) -- 0:00:10
831000 -- (-389.135) [-389.867] (-388.043) (-387.164) * (-387.841) (-389.737) [-386.285] (-387.937) -- 0:00:10
831500 -- (-386.771) (-388.033) (-386.417) [-387.621] * [-389.020] (-386.866) (-389.036) (-386.865) -- 0:00:10
832000 -- (-388.820) (-390.693) [-389.116] (-386.982) * [-386.703] (-389.465) (-387.821) (-387.491) -- 0:00:10
832500 -- (-387.879) (-390.560) (-387.818) [-387.205] * (-390.965) (-388.880) [-387.951] (-387.618) -- 0:00:10
833000 -- (-388.065) (-390.003) [-388.346] (-386.835) * (-389.429) (-387.684) [-388.577] (-389.415) -- 0:00:10
833500 -- (-387.210) (-387.963) [-386.618] (-387.500) * (-386.855) [-386.817] (-391.040) (-387.429) -- 0:00:09
834000 -- (-386.744) (-388.743) [-390.590] (-387.017) * [-390.160] (-387.091) (-389.636) (-387.776) -- 0:00:09
834500 -- [-388.791] (-392.909) (-390.548) (-387.940) * (-389.377) (-391.724) [-387.344] (-388.969) -- 0:00:09
835000 -- (-388.911) (-393.087) [-388.233] (-386.678) * (-388.811) [-388.764] (-390.586) (-388.160) -- 0:00:09
Average standard deviation of split frequencies: 0.006485
835500 -- (-392.873) (-386.792) [-386.881] (-386.209) * [-387.496] (-388.062) (-388.696) (-386.603) -- 0:00:09
836000 -- (-388.604) (-388.280) [-387.000] (-387.129) * (-388.223) [-389.129] (-388.644) (-389.228) -- 0:00:09
836500 -- [-387.231] (-388.275) (-388.727) (-389.607) * (-390.141) (-387.093) [-390.132] (-393.272) -- 0:00:09
837000 -- (-387.191) (-389.176) [-386.666] (-389.160) * (-387.594) [-386.402] (-388.501) (-389.078) -- 0:00:09
837500 -- (-388.287) (-389.112) [-387.154] (-391.814) * (-388.925) (-387.707) [-388.283] (-387.633) -- 0:00:09
838000 -- [-388.238] (-387.355) (-388.209) (-388.000) * [-392.911] (-388.480) (-389.021) (-386.475) -- 0:00:09
838500 -- (-387.372) (-386.567) [-388.637] (-386.110) * (-388.646) [-388.340] (-388.147) (-386.375) -- 0:00:09
839000 -- [-386.528] (-386.902) (-392.272) (-388.012) * (-391.846) [-388.905] (-387.555) (-387.799) -- 0:00:09
839500 -- (-387.809) (-388.474) (-387.354) [-387.607] * (-392.753) (-389.098) [-388.875] (-391.258) -- 0:00:09
840000 -- [-388.465] (-388.167) (-386.399) (-388.863) * (-388.324) (-390.057) [-390.550] (-390.048) -- 0:00:09
Average standard deviation of split frequencies: 0.006589
840500 -- (-390.013) (-392.710) [-388.056] (-389.518) * (-391.241) [-388.601] (-387.625) (-388.096) -- 0:00:09
841000 -- (-387.287) (-389.313) [-389.442] (-391.458) * (-389.158) (-392.777) [-387.216] (-388.128) -- 0:00:09
841500 -- (-386.940) [-388.628] (-387.386) (-390.721) * [-388.057] (-389.119) (-387.316) (-390.170) -- 0:00:09
842000 -- (-386.608) (-387.640) [-386.802] (-387.573) * (-387.095) (-389.357) (-391.149) [-388.648] -- 0:00:09
842500 -- (-389.017) (-386.852) (-387.289) [-386.336] * [-387.035] (-386.943) (-391.152) (-389.685) -- 0:00:09
843000 -- (-388.528) [-386.974] (-387.194) (-387.450) * [-388.514] (-389.077) (-387.614) (-388.054) -- 0:00:09
843500 -- (-386.248) [-391.446] (-394.362) (-387.593) * (-388.305) (-391.174) [-388.106] (-387.838) -- 0:00:09
844000 -- [-386.784] (-387.622) (-391.603) (-387.616) * (-390.138) (-388.141) [-387.886] (-387.250) -- 0:00:09
844500 -- (-386.716) [-388.488] (-387.781) (-388.671) * (-388.847) [-389.249] (-388.279) (-388.371) -- 0:00:09
845000 -- (-387.170) [-388.118] (-389.825) (-387.076) * [-389.574] (-388.051) (-387.503) (-391.961) -- 0:00:09
Average standard deviation of split frequencies: 0.006896
845500 -- [-389.920] (-387.581) (-396.076) (-389.036) * (-390.012) (-386.149) [-389.392] (-392.173) -- 0:00:09
846000 -- (-387.099) [-387.094] (-388.769) (-390.072) * (-386.720) (-386.812) (-386.154) [-388.612] -- 0:00:09
846500 -- (-386.282) (-386.591) [-391.080] (-390.333) * (-391.299) (-389.968) [-389.573] (-389.733) -- 0:00:09
847000 -- (-389.580) [-387.254] (-392.707) (-390.839) * (-388.788) [-390.209] (-386.398) (-392.957) -- 0:00:09
847500 -- (-388.108) [-389.489] (-386.942) (-388.522) * (-390.314) [-387.703] (-388.537) (-388.754) -- 0:00:09
848000 -- (-390.293) [-389.420] (-388.793) (-388.168) * (-391.713) (-388.943) (-388.610) [-386.722] -- 0:00:09
848500 -- (-389.582) (-386.892) [-387.479] (-387.603) * (-391.026) (-389.057) [-386.136] (-386.420) -- 0:00:09
849000 -- [-387.608] (-388.966) (-391.916) (-389.287) * [-390.323] (-387.565) (-388.192) (-388.878) -- 0:00:09
849500 -- (-387.138) (-388.581) (-393.830) [-386.987] * (-387.445) (-387.326) (-389.371) [-388.299] -- 0:00:09
850000 -- (-389.601) [-387.339] (-388.704) (-390.639) * (-388.438) (-389.248) (-387.287) [-388.276] -- 0:00:09
Average standard deviation of split frequencies: 0.006719
850500 -- (-389.988) [-387.667] (-391.919) (-392.627) * (-388.273) (-387.154) [-388.002] (-389.348) -- 0:00:08
851000 -- (-388.318) [-386.718] (-388.540) (-387.575) * (-386.282) (-388.985) (-387.019) [-389.179] -- 0:00:08
851500 -- (-387.791) (-387.317) [-388.461] (-388.307) * (-388.349) [-388.172] (-387.083) (-388.065) -- 0:00:08
852000 -- [-390.515] (-387.430) (-387.321) (-388.499) * [-389.027] (-387.104) (-389.812) (-389.715) -- 0:00:08
852500 -- (-391.510) [-389.429] (-387.037) (-387.232) * (-387.011) (-391.655) [-388.133] (-393.825) -- 0:00:08
853000 -- (-389.013) (-389.641) [-390.042] (-391.941) * [-387.867] (-391.414) (-389.885) (-389.693) -- 0:00:08
853500 -- (-388.709) [-388.033] (-394.740) (-391.632) * (-389.544) (-388.328) (-387.664) [-388.045] -- 0:00:08
854000 -- [-391.100] (-391.445) (-389.651) (-388.845) * [-387.016] (-388.206) (-386.508) (-386.705) -- 0:00:08
854500 -- (-394.958) (-389.845) (-388.716) [-387.800] * (-390.403) (-388.398) [-387.954] (-387.775) -- 0:00:08
855000 -- (-389.084) [-389.770] (-388.274) (-388.276) * [-386.838] (-386.819) (-387.505) (-388.435) -- 0:00:08
Average standard deviation of split frequencies: 0.006884
855500 -- (-388.542) (-391.410) (-389.172) [-386.833] * (-390.591) (-387.530) (-386.767) [-389.202] -- 0:00:08
856000 -- [-388.876] (-388.632) (-388.721) (-386.976) * (-389.259) [-387.244] (-388.355) (-390.856) -- 0:00:08
856500 -- (-388.327) [-390.748] (-387.554) (-391.564) * (-388.026) (-388.145) [-387.474] (-386.403) -- 0:00:08
857000 -- (-387.242) (-390.103) [-387.700] (-397.862) * [-392.208] (-388.959) (-386.926) (-387.977) -- 0:00:08
857500 -- (-387.370) (-388.116) [-387.659] (-394.799) * (-388.343) [-389.959] (-393.600) (-388.219) -- 0:00:08
858000 -- (-388.619) [-388.045] (-386.818) (-396.301) * (-391.577) (-387.178) (-388.279) [-388.097] -- 0:00:08
858500 -- (-388.595) (-388.752) (-387.984) [-390.323] * [-389.945] (-388.399) (-388.021) (-387.079) -- 0:00:08
859000 -- [-387.534] (-387.058) (-388.375) (-386.415) * [-390.286] (-389.723) (-391.722) (-388.329) -- 0:00:08
859500 -- (-387.037) (-386.924) [-387.199] (-387.030) * (-388.511) [-390.685] (-391.308) (-389.959) -- 0:00:08
860000 -- (-388.479) [-387.048] (-386.532) (-388.256) * (-387.338) (-390.004) [-388.667] (-387.150) -- 0:00:08
Average standard deviation of split frequencies: 0.007018
860500 -- (-387.224) [-386.343] (-386.549) (-390.039) * (-387.817) (-387.858) (-389.024) [-388.670] -- 0:00:08
861000 -- [-386.336] (-388.829) (-390.773) (-390.481) * (-386.704) (-387.267) (-387.478) [-388.216] -- 0:00:08
861500 -- (-392.450) (-388.441) [-388.878] (-386.648) * [-386.692] (-387.414) (-388.384) (-387.363) -- 0:00:08
862000 -- (-388.399) (-388.824) [-390.160] (-388.414) * (-388.228) [-387.728] (-388.717) (-386.474) -- 0:00:08
862500 -- (-387.652) [-390.052] (-389.540) (-387.772) * (-387.865) (-389.866) (-387.191) [-388.143] -- 0:00:08
863000 -- (-393.016) (-388.678) (-387.666) [-385.942] * (-387.906) (-387.294) (-388.200) [-387.697] -- 0:00:08
863500 -- (-389.602) [-389.142] (-388.358) (-385.927) * (-387.124) (-388.542) (-391.454) [-387.730] -- 0:00:08
864000 -- (-387.125) (-388.422) [-388.617] (-391.637) * (-390.028) (-389.398) (-393.153) [-387.973] -- 0:00:08
864500 -- (-392.143) (-389.084) (-388.769) [-389.315] * [-390.775] (-390.436) (-387.827) (-387.333) -- 0:00:08
865000 -- (-392.506) [-389.763] (-390.069) (-388.698) * (-389.993) (-389.893) (-387.326) [-390.666] -- 0:00:08
Average standard deviation of split frequencies: 0.006600
865500 -- (-390.344) (-388.585) (-389.050) [-387.816] * [-388.483] (-387.627) (-389.113) (-391.067) -- 0:00:08
866000 -- [-388.264] (-388.945) (-388.109) (-392.135) * [-387.819] (-387.595) (-388.920) (-387.983) -- 0:00:08
866500 -- (-388.294) [-388.705] (-387.450) (-388.661) * (-391.088) (-391.806) [-386.921] (-388.515) -- 0:00:08
867000 -- (-391.484) (-388.431) (-387.426) [-387.103] * (-391.234) (-389.684) [-388.041] (-390.075) -- 0:00:07
867500 -- [-387.801] (-388.735) (-392.109) (-388.193) * (-386.852) (-387.489) [-388.194] (-389.371) -- 0:00:07
868000 -- [-387.883] (-387.196) (-389.802) (-387.066) * (-389.598) (-388.877) [-388.575] (-390.622) -- 0:00:07
868500 -- (-389.630) (-390.213) [-392.851] (-386.488) * (-389.304) [-389.600] (-390.155) (-386.701) -- 0:00:07
869000 -- [-392.464] (-392.648) (-391.203) (-387.584) * (-387.419) (-387.510) [-386.712] (-388.042) -- 0:00:07
869500 -- [-388.434] (-391.634) (-387.397) (-388.548) * (-388.040) [-387.219] (-387.835) (-389.277) -- 0:00:07
870000 -- [-386.801] (-388.757) (-387.387) (-388.070) * (-388.117) (-386.934) (-388.623) [-391.388] -- 0:00:07
Average standard deviation of split frequencies: 0.006497
870500 -- (-389.603) [-389.787] (-389.652) (-388.696) * (-388.262) [-387.626] (-388.329) (-387.619) -- 0:00:07
871000 -- [-387.172] (-386.035) (-386.756) (-388.651) * (-391.655) (-387.485) (-391.567) [-386.587] -- 0:00:07
871500 -- [-387.795] (-386.298) (-388.581) (-388.427) * (-386.380) (-388.191) (-386.635) [-386.302] -- 0:00:07
872000 -- (-386.943) (-386.893) (-388.766) [-387.723] * [-386.808] (-388.598) (-388.371) (-387.125) -- 0:00:07
872500 -- (-389.614) (-387.941) (-388.944) [-389.219] * (-388.275) (-386.976) (-388.246) [-386.267] -- 0:00:07
873000 -- (-388.078) [-386.523] (-390.381) (-388.780) * (-389.269) (-389.654) [-390.886] (-386.269) -- 0:00:07
873500 -- (-386.304) [-387.793] (-387.148) (-388.941) * (-386.996) (-387.254) (-387.285) [-389.776] -- 0:00:07
874000 -- (-389.691) [-390.694] (-388.015) (-389.207) * (-386.300) (-389.979) (-391.099) [-388.467] -- 0:00:07
874500 -- (-388.311) [-386.610] (-390.315) (-386.370) * [-389.039] (-390.511) (-387.934) (-386.325) -- 0:00:07
875000 -- (-392.513) (-392.160) (-386.627) [-388.755] * (-387.871) [-389.376] (-387.740) (-388.432) -- 0:00:07
Average standard deviation of split frequencies: 0.006458
875500 -- (-386.854) [-389.286] (-387.384) (-386.674) * (-388.690) (-390.392) (-386.902) [-388.853] -- 0:00:07
876000 -- (-387.876) (-390.504) (-388.661) [-387.368] * (-388.863) (-389.077) (-388.506) [-389.295] -- 0:00:07
876500 -- [-388.810] (-388.820) (-391.833) (-387.064) * (-390.829) (-387.754) (-388.118) [-387.962] -- 0:00:07
877000 -- [-388.584] (-386.805) (-392.319) (-387.427) * (-390.072) (-389.538) [-387.798] (-390.208) -- 0:00:07
877500 -- [-390.016] (-396.446) (-388.944) (-391.470) * (-386.175) [-388.650] (-395.465) (-386.276) -- 0:00:07
878000 -- (-389.927) [-388.868] (-389.063) (-390.447) * (-389.091) (-388.235) (-387.900) [-387.213] -- 0:00:07
878500 -- (-387.408) (-387.912) (-389.828) [-393.462] * (-390.110) [-391.838] (-388.701) (-387.744) -- 0:00:07
879000 -- (-387.219) [-390.107] (-388.152) (-391.615) * (-387.167) (-388.198) (-387.491) [-386.606] -- 0:00:07
879500 -- (-392.201) (-388.638) (-387.350) [-393.282] * (-389.129) [-388.298] (-390.581) (-386.466) -- 0:00:07
880000 -- (-389.361) [-388.611] (-386.885) (-391.398) * (-388.898) (-390.127) (-391.787) [-387.928] -- 0:00:07
Average standard deviation of split frequencies: 0.006356
880500 -- (-391.241) [-388.648] (-389.408) (-386.909) * (-387.735) [-391.935] (-388.439) (-387.519) -- 0:00:07
881000 -- (-390.117) [-389.160] (-388.224) (-388.557) * (-387.697) (-390.841) (-388.556) [-391.270] -- 0:00:07
881500 -- (-389.139) (-389.196) [-389.996] (-388.910) * (-386.890) (-386.430) [-391.866] (-398.130) -- 0:00:07
882000 -- (-386.343) (-391.813) [-388.737] (-388.275) * [-387.784] (-387.621) (-388.447) (-390.868) -- 0:00:07
882500 -- (-391.167) [-390.466] (-389.365) (-387.669) * (-387.787) [-387.648] (-387.288) (-391.249) -- 0:00:07
883000 -- (-390.741) (-391.447) (-391.666) [-387.120] * (-388.058) (-389.836) [-388.490] (-386.781) -- 0:00:07
883500 -- [-389.817] (-387.480) (-390.161) (-387.280) * [-388.326] (-393.365) (-388.278) (-386.601) -- 0:00:06
884000 -- (-388.449) [-392.241] (-388.975) (-386.782) * (-392.052) (-388.644) [-386.946] (-388.925) -- 0:00:06
884500 -- (-386.448) [-390.061] (-387.330) (-388.777) * (-389.138) (-389.314) (-386.303) [-388.156] -- 0:00:06
885000 -- (-391.901) [-388.574] (-386.914) (-389.615) * [-391.159] (-391.397) (-386.675) (-387.653) -- 0:00:06
Average standard deviation of split frequencies: 0.006152
885500 -- (-389.702) (-389.223) [-387.192] (-392.324) * (-390.559) [-389.462] (-387.211) (-387.538) -- 0:00:06
886000 -- (-388.760) (-387.471) (-386.462) [-391.067] * [-389.466] (-388.931) (-390.777) (-387.324) -- 0:00:06
886500 -- (-390.669) (-387.587) [-386.506] (-389.006) * [-388.119] (-390.634) (-389.301) (-388.572) -- 0:00:06
887000 -- (-390.583) (-388.626) [-387.333] (-389.108) * (-388.132) (-386.249) [-387.535] (-389.815) -- 0:00:06
887500 -- (-389.056) (-388.286) [-391.693] (-386.527) * (-393.052) (-387.313) (-389.616) [-390.941] -- 0:00:06
888000 -- [-389.050] (-389.459) (-388.829) (-388.751) * (-388.320) (-389.161) [-387.772] (-386.965) -- 0:00:06
888500 -- (-387.938) [-390.366] (-389.122) (-387.244) * (-386.301) [-389.012] (-389.633) (-389.249) -- 0:00:06
889000 -- (-390.080) (-389.853) [-388.144] (-387.320) * (-389.427) [-386.510] (-387.154) (-389.714) -- 0:00:06
889500 -- (-387.877) (-388.113) (-393.043) [-388.693] * (-390.174) (-386.749) [-387.969] (-387.308) -- 0:00:06
890000 -- (-387.202) (-386.984) (-389.945) [-388.412] * (-386.654) (-388.098) [-390.432] (-386.616) -- 0:00:06
Average standard deviation of split frequencies: 0.006285
890500 -- (-389.749) [-387.016] (-387.422) (-389.044) * (-394.018) (-386.299) (-386.842) [-386.332] -- 0:00:06
891000 -- (-389.411) (-390.334) (-388.739) [-387.911] * (-394.078) (-389.270) [-387.290] (-387.451) -- 0:00:06
891500 -- [-388.415] (-389.395) (-389.029) (-386.994) * [-396.606] (-387.529) (-387.605) (-387.690) -- 0:00:06
892000 -- (-387.006) (-386.740) [-387.559] (-386.400) * [-390.519] (-388.461) (-389.368) (-387.273) -- 0:00:06
892500 -- [-386.692] (-386.366) (-388.993) (-388.825) * (-387.559) [-389.221] (-390.494) (-388.645) -- 0:00:06
893000 -- (-388.369) [-387.199] (-389.602) (-387.081) * (-387.695) (-389.761) (-387.513) [-387.762] -- 0:00:06
893500 -- [-388.288] (-387.273) (-388.526) (-388.200) * (-387.196) (-389.205) (-386.808) [-387.767] -- 0:00:06
894000 -- [-390.776] (-389.854) (-387.115) (-390.908) * (-387.647) (-388.508) (-389.147) [-387.240] -- 0:00:06
894500 -- (-391.818) (-386.941) [-386.411] (-388.461) * (-388.370) (-387.585) [-386.503] (-387.784) -- 0:00:06
895000 -- (-388.260) (-389.737) [-387.242] (-387.593) * [-387.135] (-390.110) (-386.223) (-387.403) -- 0:00:06
Average standard deviation of split frequencies: 0.006445
895500 -- [-387.884] (-389.735) (-390.339) (-387.808) * (-390.948) (-388.734) [-389.633] (-389.372) -- 0:00:06
896000 -- (-390.871) (-387.113) (-389.854) [-387.107] * (-391.932) (-392.786) (-386.140) [-386.903] -- 0:00:06
896500 -- (-388.914) [-388.994] (-390.057) (-389.425) * (-389.971) (-390.985) [-387.481] (-389.480) -- 0:00:06
897000 -- (-388.451) (-390.463) [-386.920] (-386.911) * (-386.826) (-394.452) (-390.413) [-392.043] -- 0:00:06
897500 -- [-389.165] (-387.326) (-387.400) (-387.373) * (-386.985) (-391.312) [-389.406] (-389.890) -- 0:00:06
898000 -- (-389.036) (-386.626) (-388.253) [-388.939] * [-387.254] (-393.666) (-388.457) (-387.155) -- 0:00:06
898500 -- (-390.225) [-387.858] (-394.565) (-387.256) * (-386.586) (-388.629) [-386.899] (-386.590) -- 0:00:06
899000 -- (-390.679) (-387.125) (-388.467) [-388.599] * [-389.266] (-390.988) (-389.978) (-390.684) -- 0:00:06
899500 -- (-389.100) (-390.284) [-387.332] (-389.663) * [-386.482] (-389.307) (-388.597) (-391.690) -- 0:00:06
900000 -- (-387.850) (-388.448) (-388.870) [-389.627] * (-388.072) (-392.391) [-388.391] (-386.209) -- 0:00:06
Average standard deviation of split frequencies: 0.006641
900500 -- (-388.522) (-386.732) [-387.888] (-387.063) * [-388.720] (-386.936) (-388.473) (-389.633) -- 0:00:05
901000 -- (-386.379) (-388.286) (-391.372) [-389.324] * (-388.984) [-388.412] (-388.809) (-388.583) -- 0:00:05
901500 -- (-386.980) [-387.332] (-391.123) (-391.371) * (-387.910) (-387.088) [-389.316] (-386.707) -- 0:00:05
902000 -- [-387.263] (-388.247) (-392.152) (-391.319) * (-388.116) (-386.769) [-390.853] (-387.404) -- 0:00:05
902500 -- (-386.852) (-389.886) [-388.371] (-391.734) * (-387.394) (-392.102) (-389.619) [-388.606] -- 0:00:05
903000 -- (-387.547) (-386.541) (-387.837) [-388.311] * (-389.950) (-390.665) (-391.231) [-387.861] -- 0:00:05
903500 -- (-387.843) [-390.329] (-387.621) (-388.485) * [-390.228] (-391.062) (-387.580) (-388.555) -- 0:00:05
904000 -- (-388.242) [-393.108] (-387.595) (-387.113) * [-389.489] (-391.678) (-388.957) (-387.424) -- 0:00:05
904500 -- (-391.326) (-388.080) (-387.646) [-391.659] * [-386.949] (-388.226) (-390.850) (-387.325) -- 0:00:05
905000 -- [-389.455] (-387.936) (-390.015) (-394.317) * (-388.368) (-389.263) [-388.421] (-387.907) -- 0:00:05
Average standard deviation of split frequencies: 0.006699
905500 -- (-390.216) [-388.850] (-391.849) (-395.225) * [-388.016] (-389.886) (-388.955) (-392.374) -- 0:00:05
906000 -- (-387.743) [-388.726] (-386.429) (-388.595) * (-388.900) (-388.958) (-390.498) [-387.537] -- 0:00:05
906500 -- (-391.894) (-387.126) [-389.335] (-389.501) * (-387.331) (-390.392) (-391.640) [-387.744] -- 0:00:05
907000 -- (-387.668) (-387.671) (-386.768) [-392.793] * (-388.130) (-391.950) (-390.893) [-389.745] -- 0:00:05
907500 -- [-387.696] (-388.879) (-387.832) (-392.580) * (-387.964) [-387.767] (-392.217) (-390.723) -- 0:00:05
908000 -- (-387.993) [-388.813] (-389.873) (-389.133) * (-387.856) (-389.204) [-387.841] (-388.250) -- 0:00:05
908500 -- (-386.266) (-388.744) (-388.933) [-386.915] * [-389.312] (-391.798) (-388.554) (-390.751) -- 0:00:05
909000 -- (-387.877) (-387.411) (-389.930) [-387.344] * [-387.571] (-390.976) (-388.551) (-389.693) -- 0:00:05
909500 -- (-388.796) (-387.076) [-392.459] (-388.310) * (-389.224) (-388.894) [-387.154] (-389.923) -- 0:00:05
910000 -- [-392.195] (-389.187) (-388.228) (-387.632) * (-389.925) [-389.515] (-387.449) (-390.203) -- 0:00:05
Average standard deviation of split frequencies: 0.006924
910500 -- (-387.445) (-390.824) (-388.457) [-390.071] * (-390.734) [-390.174] (-388.298) (-388.861) -- 0:00:05
911000 -- (-387.183) (-387.555) (-387.695) [-386.560] * (-386.828) [-388.578] (-390.032) (-391.030) -- 0:00:05
911500 -- [-387.404] (-388.753) (-387.620) (-388.301) * [-386.847] (-391.552) (-386.838) (-388.867) -- 0:00:05
912000 -- [-389.115] (-389.219) (-388.511) (-387.937) * [-386.505] (-388.265) (-386.741) (-389.624) -- 0:00:05
912500 -- (-388.181) (-387.607) [-388.401] (-389.550) * (-387.355) [-388.819] (-389.043) (-389.265) -- 0:00:05
913000 -- (-386.991) [-388.514] (-390.868) (-389.547) * (-386.848) (-387.874) [-387.201] (-387.232) -- 0:00:05
913500 -- (-388.229) (-390.804) (-388.018) [-386.296] * [-388.812] (-388.214) (-387.374) (-388.598) -- 0:00:05
914000 -- (-388.439) [-387.236] (-389.244) (-386.251) * [-388.998] (-391.065) (-387.001) (-387.980) -- 0:00:05
914500 -- (-387.432) (-387.896) (-388.027) [-387.262] * (-388.127) (-393.715) (-391.793) [-387.448] -- 0:00:05
915000 -- (-387.569) (-389.426) (-394.050) [-386.540] * [-388.620] (-389.763) (-389.839) (-387.191) -- 0:00:05
Average standard deviation of split frequencies: 0.007012
915500 -- (-392.414) (-388.130) [-390.245] (-391.326) * (-388.159) (-387.293) [-388.802] (-387.851) -- 0:00:05
916000 -- (-388.560) (-387.501) (-388.756) [-389.973] * (-387.970) (-390.521) (-392.447) [-390.140] -- 0:00:05
916500 -- (-389.603) (-388.924) [-391.289] (-388.836) * (-388.826) (-386.662) (-386.678) [-394.416] -- 0:00:05
917000 -- (-387.867) (-387.801) (-391.650) [-388.020] * (-392.334) (-390.556) (-388.547) [-391.954] -- 0:00:04
917500 -- (-386.746) (-390.821) [-391.487] (-388.172) * [-386.284] (-386.747) (-387.645) (-388.720) -- 0:00:04
918000 -- (-393.090) [-387.301] (-390.811) (-387.582) * (-387.431) (-388.601) (-389.396) [-389.646] -- 0:00:04
918500 -- [-386.535] (-389.067) (-396.213) (-392.228) * (-386.083) [-388.598] (-389.523) (-392.300) -- 0:00:04
919000 -- (-386.656) [-389.487] (-389.303) (-387.813) * (-387.387) (-387.996) (-389.335) [-392.012] -- 0:00:04
919500 -- (-388.812) (-386.791) (-392.934) [-387.970] * (-386.766) [-387.818] (-388.377) (-390.921) -- 0:00:04
920000 -- (-390.748) (-390.698) [-388.260] (-389.857) * (-388.688) [-388.794] (-390.357) (-393.533) -- 0:00:04
Average standard deviation of split frequencies: 0.006964
920500 -- [-390.334] (-386.954) (-388.224) (-389.643) * (-386.743) [-388.681] (-387.811) (-390.351) -- 0:00:04
921000 -- (-387.665) [-386.214] (-387.593) (-390.755) * (-387.888) (-388.448) [-387.023] (-386.982) -- 0:00:04
921500 -- (-387.600) [-390.381] (-390.119) (-386.650) * (-387.458) (-391.327) [-390.640] (-389.418) -- 0:00:04
922000 -- [-387.569] (-389.886) (-390.825) (-388.679) * [-387.079] (-388.477) (-388.070) (-387.621) -- 0:00:04
922500 -- (-386.334) [-389.788] (-392.501) (-387.829) * [-387.526] (-388.744) (-390.157) (-386.797) -- 0:00:04
923000 -- (-387.646) (-389.729) (-386.769) [-387.819] * (-388.075) (-387.080) (-388.097) [-389.241] -- 0:00:04
923500 -- (-389.120) (-390.968) (-386.980) [-387.727] * [-387.560] (-387.251) (-386.845) (-388.720) -- 0:00:04
924000 -- (-386.536) (-387.969) (-387.515) [-386.876] * (-387.142) [-389.072] (-388.531) (-390.431) -- 0:00:04
924500 -- [-390.109] (-387.549) (-386.403) (-389.573) * [-386.799] (-387.440) (-389.317) (-391.642) -- 0:00:04
925000 -- (-390.467) [-388.567] (-389.415) (-388.401) * (-388.149) [-388.302] (-390.013) (-388.557) -- 0:00:04
Average standard deviation of split frequencies: 0.006991
925500 -- (-388.068) (-390.323) (-391.754) [-387.109] * (-386.383) (-393.198) (-387.090) [-387.136] -- 0:00:04
926000 -- (-392.280) [-387.648] (-390.020) (-389.516) * [-388.051] (-388.985) (-388.179) (-387.314) -- 0:00:04
926500 -- (-387.387) (-389.701) (-387.596) [-389.136] * (-386.876) [-391.560] (-387.227) (-387.605) -- 0:00:04
927000 -- [-388.933] (-387.426) (-386.971) (-389.037) * (-391.953) (-393.870) (-388.752) [-389.999] -- 0:00:04
927500 -- (-390.604) (-386.643) (-387.886) [-390.487] * [-388.169] (-387.350) (-388.429) (-387.949) -- 0:00:04
928000 -- [-389.760] (-391.365) (-387.440) (-389.928) * (-388.088) [-387.022] (-388.062) (-388.358) -- 0:00:04
928500 -- (-388.941) (-387.901) (-390.355) [-388.245] * (-388.909) (-386.686) [-387.055] (-388.456) -- 0:00:04
929000 -- (-387.514) (-391.524) (-388.516) [-388.728] * [-387.169] (-388.164) (-388.006) (-386.398) -- 0:00:04
929500 -- (-387.085) (-386.334) (-390.054) [-389.527] * (-387.448) (-387.402) [-388.188] (-386.586) -- 0:00:04
930000 -- (-387.730) (-393.331) (-390.294) [-387.787] * (-386.669) [-391.176] (-390.354) (-388.677) -- 0:00:04
Average standard deviation of split frequencies: 0.006821
930500 -- (-387.375) (-388.778) [-389.382] (-389.656) * (-386.928) [-389.993] (-386.097) (-388.247) -- 0:00:04
931000 -- (-387.309) (-387.181) [-387.043] (-387.256) * [-388.007] (-387.333) (-386.883) (-387.146) -- 0:00:04
931500 -- [-386.712] (-387.293) (-387.392) (-387.527) * (-386.910) [-388.215] (-391.702) (-387.401) -- 0:00:04
932000 -- (-386.415) (-389.971) [-389.659] (-387.759) * [-390.534] (-387.253) (-391.940) (-388.248) -- 0:00:04
932500 -- (-388.203) [-387.900] (-389.097) (-387.714) * (-392.998) (-390.229) (-386.750) [-387.460] -- 0:00:04
933000 -- (-392.815) (-389.013) [-391.663] (-388.989) * (-390.182) [-386.690] (-389.830) (-389.543) -- 0:00:04
933500 -- (-386.816) [-389.571] (-388.905) (-388.164) * (-386.524) [-387.656] (-388.515) (-391.746) -- 0:00:03
934000 -- [-391.840] (-387.558) (-387.742) (-387.199) * (-386.537) (-391.630) [-389.772] (-388.914) -- 0:00:03
934500 -- (-386.999) (-387.504) [-386.685] (-387.726) * [-386.941] (-388.838) (-387.048) (-389.362) -- 0:00:03
935000 -- (-392.404) (-386.084) [-386.266] (-387.732) * (-387.262) [-388.183] (-386.798) (-390.698) -- 0:00:03
Average standard deviation of split frequencies: 0.006480
935500 -- (-387.174) (-386.877) (-389.758) [-388.002] * [-387.097] (-391.135) (-386.710) (-388.587) -- 0:00:03
936000 -- (-388.027) (-386.910) (-386.302) [-388.782] * (-388.008) [-389.951] (-387.139) (-387.229) -- 0:00:03
936500 -- [-390.369] (-388.848) (-389.383) (-390.849) * (-387.487) (-387.717) (-387.872) [-386.800] -- 0:00:03
937000 -- (-389.779) [-387.875] (-390.627) (-390.820) * (-389.230) (-389.135) [-387.698] (-389.609) -- 0:00:03
937500 -- (-392.865) (-386.805) (-391.100) [-390.919] * (-387.210) (-388.743) [-386.927] (-389.255) -- 0:00:03
938000 -- (-388.255) [-387.270] (-387.710) (-387.991) * (-388.728) (-390.015) [-389.375] (-389.173) -- 0:00:03
938500 -- [-386.833] (-387.521) (-389.677) (-388.519) * (-388.083) (-387.226) (-391.132) [-389.316] -- 0:00:03
939000 -- [-386.726] (-388.551) (-387.153) (-389.772) * (-387.048) (-390.712) [-387.456] (-386.691) -- 0:00:03
939500 -- (-387.216) (-390.335) (-388.420) [-388.307] * (-389.431) (-389.079) (-391.272) [-387.092] -- 0:00:03
940000 -- [-387.347] (-388.488) (-390.257) (-388.244) * (-388.697) [-386.158] (-387.280) (-390.698) -- 0:00:03
Average standard deviation of split frequencies: 0.006415
940500 -- [-387.271] (-388.022) (-391.002) (-389.516) * (-387.523) (-391.193) (-390.359) [-388.902] -- 0:00:03
941000 -- [-390.616] (-387.548) (-386.611) (-386.316) * (-389.029) [-388.262] (-389.129) (-388.902) -- 0:00:03
941500 -- (-387.312) (-387.076) [-386.384] (-389.426) * [-389.830] (-392.399) (-388.426) (-390.382) -- 0:00:03
942000 -- (-389.102) [-386.472] (-387.577) (-388.218) * (-390.409) (-390.709) [-389.804] (-387.968) -- 0:00:03
942500 -- (-387.062) [-388.378] (-387.472) (-389.907) * (-387.711) [-389.932] (-390.389) (-388.441) -- 0:00:03
943000 -- (-390.173) (-387.889) (-391.368) [-391.457] * [-388.499] (-387.476) (-390.743) (-390.982) -- 0:00:03
943500 -- [-389.380] (-387.246) (-388.714) (-388.127) * (-386.908) (-389.151) (-390.819) [-388.389] -- 0:00:03
944000 -- (-388.249) (-386.927) [-387.985] (-386.551) * (-387.899) [-387.170] (-389.414) (-387.334) -- 0:00:03
944500 -- (-387.579) (-386.931) (-388.671) [-387.002] * (-387.800) (-386.807) [-388.710] (-389.741) -- 0:00:03
945000 -- (-387.904) [-390.341] (-387.612) (-387.284) * [-386.355] (-389.106) (-389.036) (-387.428) -- 0:00:03
Average standard deviation of split frequencies: 0.005947
945500 -- (-387.766) (-388.512) [-390.924] (-388.182) * (-386.877) (-386.724) (-386.843) [-388.762] -- 0:00:03
946000 -- (-388.840) (-387.289) (-388.597) [-390.257] * (-394.597) (-389.665) (-387.833) [-387.626] -- 0:00:03
946500 -- [-391.085] (-387.616) (-389.840) (-387.008) * [-387.620] (-389.294) (-389.262) (-389.101) -- 0:00:03
947000 -- (-388.341) (-387.789) (-389.198) [-387.178] * (-387.077) (-386.704) [-387.455] (-390.196) -- 0:00:03
947500 -- (-388.165) (-386.794) [-388.037] (-386.169) * (-386.750) (-390.252) [-387.160] (-388.640) -- 0:00:03
948000 -- (-387.156) (-386.390) [-387.121] (-387.859) * (-391.122) (-389.461) (-389.715) [-387.826] -- 0:00:03
948500 -- [-387.565] (-387.574) (-387.757) (-388.185) * (-386.662) [-387.181] (-390.430) (-388.371) -- 0:00:03
949000 -- (-386.893) [-389.853] (-387.765) (-388.622) * [-387.622] (-389.514) (-389.450) (-386.219) -- 0:00:03
949500 -- [-387.573] (-389.324) (-388.943) (-389.374) * (-390.097) (-389.042) [-390.732] (-386.219) -- 0:00:03
950000 -- (-388.278) [-388.280] (-388.155) (-387.463) * (-390.433) (-390.368) (-387.084) [-393.682] -- 0:00:03
Average standard deviation of split frequencies: 0.005917
950500 -- [-388.765] (-388.832) (-388.038) (-389.858) * (-389.112) (-387.581) [-386.726] (-391.496) -- 0:00:02
951000 -- [-388.300] (-387.190) (-389.149) (-387.288) * (-387.831) (-386.362) (-388.114) [-386.492] -- 0:00:02
951500 -- [-389.292] (-388.091) (-387.668) (-387.627) * [-387.639] (-387.537) (-387.304) (-387.321) -- 0:00:02
952000 -- [-388.389] (-387.453) (-389.128) (-388.232) * (-389.798) [-389.389] (-387.857) (-387.916) -- 0:00:02
952500 -- (-388.050) (-388.986) (-389.398) [-387.289] * [-386.878] (-387.571) (-387.338) (-388.108) -- 0:00:02
953000 -- [-387.582] (-387.939) (-389.989) (-388.676) * [-387.716] (-392.132) (-389.530) (-388.680) -- 0:00:02
953500 -- (-387.469) [-387.377] (-389.619) (-389.334) * (-388.144) (-389.037) [-390.527] (-387.223) -- 0:00:02
954000 -- [-387.857] (-389.198) (-388.951) (-393.224) * (-387.434) [-389.166] (-387.988) (-387.223) -- 0:00:02
954500 -- [-387.437] (-386.694) (-392.879) (-393.118) * (-386.919) [-388.078] (-387.020) (-387.115) -- 0:00:02
955000 -- (-387.248) (-388.105) [-386.587] (-388.619) * (-389.561) [-387.636] (-395.695) (-387.979) -- 0:00:02
Average standard deviation of split frequencies: 0.006379
955500 -- (-388.222) (-388.307) (-387.585) [-387.460] * [-390.731] (-386.840) (-392.596) (-387.017) -- 0:00:02
956000 -- (-391.230) (-388.068) (-389.129) [-387.441] * [-392.101] (-388.645) (-388.139) (-387.429) -- 0:00:02
956500 -- (-390.188) (-386.583) [-389.950] (-387.691) * (-389.023) (-387.800) (-386.918) [-387.957] -- 0:00:02
957000 -- (-388.398) (-389.794) (-388.831) [-388.763] * (-388.567) (-388.791) [-387.051] (-389.251) -- 0:00:02
957500 -- (-388.245) [-389.193] (-388.027) (-392.386) * (-387.650) [-389.575] (-387.246) (-390.332) -- 0:00:02
958000 -- [-387.447] (-387.227) (-386.480) (-389.358) * [-388.068] (-391.621) (-386.410) (-387.285) -- 0:00:02
958500 -- [-388.081] (-390.115) (-386.552) (-388.197) * (-389.714) (-388.656) [-390.247] (-389.480) -- 0:00:02
959000 -- (-389.547) (-390.357) [-387.317] (-387.492) * (-386.896) [-388.317] (-389.282) (-388.682) -- 0:00:02
959500 -- (-390.020) [-388.725] (-389.004) (-388.856) * (-387.924) (-387.324) (-390.677) [-386.850] -- 0:00:02
960000 -- (-391.873) (-390.005) (-386.869) [-387.859] * (-388.685) (-387.108) (-386.184) [-388.205] -- 0:00:02
Average standard deviation of split frequencies: 0.006349
960500 -- [-389.949] (-388.441) (-386.869) (-389.746) * (-387.968) (-387.360) [-387.781] (-387.942) -- 0:00:02
961000 -- (-392.650) [-387.708] (-386.945) (-389.084) * (-387.972) (-389.108) (-387.779) [-387.334] -- 0:00:02
961500 -- (-387.990) (-389.024) [-389.369] (-387.264) * (-388.117) [-388.913] (-386.336) (-387.343) -- 0:00:02
962000 -- [-386.905] (-386.533) (-387.409) (-392.495) * [-387.646] (-387.707) (-389.220) (-388.462) -- 0:00:02
962500 -- (-391.602) (-387.691) [-388.697] (-388.106) * [-389.139] (-389.553) (-389.047) (-388.533) -- 0:00:02
963000 -- [-386.699] (-390.128) (-390.025) (-391.272) * (-388.855) (-387.959) (-390.841) [-387.295] -- 0:00:02
963500 -- [-386.938] (-389.608) (-387.079) (-390.059) * (-386.743) [-388.508] (-387.566) (-387.890) -- 0:00:02
964000 -- [-388.158] (-390.270) (-387.737) (-387.932) * [-386.567] (-390.827) (-387.748) (-388.608) -- 0:00:02
964500 -- (-387.638) (-387.276) (-387.310) [-387.788] * (-389.414) (-386.950) (-388.931) [-387.084] -- 0:00:02
965000 -- (-387.410) (-388.903) [-386.693] (-389.988) * (-387.221) [-387.047] (-390.218) (-388.716) -- 0:00:02
Average standard deviation of split frequencies: 0.006313
965500 -- (-389.149) (-386.159) [-387.638] (-388.274) * (-388.280) [-388.382] (-391.923) (-387.468) -- 0:00:02
966000 -- (-386.678) [-386.883] (-388.680) (-391.448) * [-387.520] (-388.317) (-392.663) (-386.148) -- 0:00:02
966500 -- (-386.577) (-394.851) (-388.398) [-391.879] * (-388.758) (-388.383) (-387.358) [-386.505] -- 0:00:02
967000 -- (-389.144) [-391.949] (-386.843) (-387.567) * (-390.661) (-390.837) [-388.569] (-386.094) -- 0:00:01
967500 -- (-387.446) (-391.576) (-387.481) [-388.862] * (-387.885) [-390.660] (-389.297) (-386.946) -- 0:00:01
968000 -- (-388.199) (-386.684) [-388.907] (-387.846) * (-388.756) (-387.045) (-391.594) [-387.439] -- 0:00:01
968500 -- (-388.093) [-388.371] (-387.943) (-389.801) * (-388.714) (-388.981) (-388.718) [-388.635] -- 0:00:01
969000 -- (-388.401) (-387.266) (-386.206) [-387.485] * [-386.443] (-389.297) (-387.626) (-387.302) -- 0:00:01
969500 -- (-388.742) [-388.910] (-388.112) (-387.760) * [-390.414] (-389.152) (-388.884) (-391.433) -- 0:00:01
970000 -- (-392.681) (-388.786) [-389.490] (-388.971) * (-389.565) (-388.842) (-395.274) [-391.434] -- 0:00:01
Average standard deviation of split frequencies: 0.006184
970500 -- [-388.490] (-387.905) (-389.601) (-389.337) * (-387.584) (-387.905) (-392.162) [-387.776] -- 0:00:01
971000 -- [-390.647] (-386.684) (-391.629) (-389.426) * (-386.851) [-388.146] (-389.024) (-386.921) -- 0:00:01
971500 -- (-386.993) [-387.968] (-390.332) (-388.347) * (-387.580) (-387.076) [-387.360] (-388.461) -- 0:00:01
972000 -- [-391.055] (-388.188) (-391.910) (-388.872) * [-387.508] (-388.655) (-387.363) (-386.803) -- 0:00:01
972500 -- (-388.422) (-388.454) [-389.479] (-387.474) * (-387.980) (-389.218) [-389.244] (-388.022) -- 0:00:01
973000 -- (-386.331) (-388.205) (-386.812) [-389.267] * (-390.282) [-394.206] (-392.609) (-388.988) -- 0:00:01
973500 -- [-386.187] (-390.373) (-388.404) (-387.594) * (-388.131) (-392.215) (-392.410) [-389.551] -- 0:00:01
974000 -- [-386.773] (-388.144) (-388.447) (-387.568) * (-391.845) (-391.025) (-393.414) [-387.823] -- 0:00:01
974500 -- [-390.436] (-388.105) (-387.941) (-388.465) * (-387.928) (-389.752) [-389.212] (-388.300) -- 0:00:01
975000 -- [-389.556] (-387.695) (-386.217) (-388.499) * (-387.502) (-388.641) (-388.546) [-391.484] -- 0:00:01
Average standard deviation of split frequencies: 0.005764
975500 -- [-387.372] (-388.876) (-388.380) (-388.911) * (-394.133) (-388.983) (-387.793) [-388.043] -- 0:00:01
976000 -- (-388.721) [-387.604] (-389.877) (-387.512) * (-390.931) (-387.947) (-387.081) [-386.548] -- 0:00:01
976500 -- (-390.855) (-390.786) [-387.640] (-387.626) * (-388.213) (-390.651) (-388.984) [-389.043] -- 0:00:01
977000 -- (-388.708) [-387.218] (-388.683) (-386.086) * (-389.466) (-389.517) [-386.776] (-392.831) -- 0:00:01
977500 -- [-390.036] (-387.138) (-391.880) (-386.202) * (-389.707) [-386.877] (-390.666) (-387.300) -- 0:00:01
978000 -- (-389.154) [-386.776] (-396.305) (-387.931) * [-388.926] (-386.732) (-390.952) (-387.426) -- 0:00:01
978500 -- (-386.726) (-390.142) [-392.808] (-387.968) * (-390.007) [-387.279] (-389.777) (-386.636) -- 0:00:01
979000 -- (-387.329) (-388.692) [-388.302] (-389.093) * (-386.774) (-386.416) (-388.724) [-391.454] -- 0:00:01
979500 -- [-389.910] (-389.498) (-387.661) (-387.818) * (-387.821) (-386.296) (-388.697) [-387.648] -- 0:00:01
980000 -- (-394.342) (-386.634) (-387.562) [-386.831] * [-388.153] (-386.345) (-387.658) (-387.675) -- 0:00:01
Average standard deviation of split frequencies: 0.005416
980500 -- (-391.988) [-388.665] (-389.769) (-388.273) * (-386.975) (-389.039) (-387.769) [-386.483] -- 0:00:01
981000 -- (-388.174) [-389.383] (-391.428) (-388.825) * (-387.137) (-387.346) [-386.790] (-396.288) -- 0:00:01
981500 -- (-387.395) (-388.765) [-390.394] (-390.380) * (-391.596) (-390.288) [-386.775] (-393.170) -- 0:00:01
982000 -- (-395.014) [-387.555] (-386.551) (-389.124) * (-387.956) [-388.653] (-390.133) (-389.228) -- 0:00:01
982500 -- (-390.922) (-387.832) [-387.164] (-388.119) * (-387.381) (-389.171) [-391.870] (-386.691) -- 0:00:01
983000 -- (-391.900) (-388.466) [-386.890] (-387.156) * (-388.831) [-388.179] (-387.436) (-389.519) -- 0:00:01
983500 -- (-386.813) [-389.861] (-393.533) (-386.924) * (-386.913) (-386.543) [-389.339] (-391.328) -- 0:00:00
984000 -- (-388.023) (-390.920) [-388.931] (-388.196) * (-387.609) (-386.448) (-387.179) [-387.683] -- 0:00:00
984500 -- (-390.491) (-394.861) [-388.366] (-386.260) * (-389.627) [-388.213] (-388.092) (-386.530) -- 0:00:00
985000 -- (-391.599) (-388.950) [-386.332] (-386.787) * (-389.158) [-386.814] (-389.325) (-388.762) -- 0:00:00
Average standard deviation of split frequencies: 0.005323
985500 -- (-391.267) [-391.709] (-388.220) (-387.734) * (-389.803) (-388.806) [-387.056] (-387.407) -- 0:00:00
986000 -- (-386.499) [-387.741] (-388.502) (-389.181) * (-387.514) (-389.238) (-391.448) [-388.085] -- 0:00:00
986500 -- (-388.326) (-388.370) [-389.328] (-387.790) * (-392.412) (-390.954) [-390.153] (-387.384) -- 0:00:00
987000 -- (-389.083) (-389.283) [-391.341] (-388.249) * (-391.223) (-386.174) (-387.574) [-386.923] -- 0:00:00
987500 -- (-393.196) [-388.175] (-387.858) (-387.830) * (-386.882) (-388.033) [-386.954] (-389.266) -- 0:00:00
988000 -- [-389.864] (-387.531) (-389.474) (-387.178) * (-386.611) (-398.077) [-386.762] (-388.644) -- 0:00:00
988500 -- (-387.856) [-387.417] (-388.487) (-388.363) * [-386.131] (-392.873) (-390.004) (-387.088) -- 0:00:00
989000 -- [-387.935] (-386.911) (-388.347) (-388.320) * (-387.744) (-388.190) [-389.429] (-389.024) -- 0:00:00
989500 -- (-387.053) [-387.292] (-395.334) (-388.024) * (-388.824) (-389.459) [-387.796] (-390.928) -- 0:00:00
990000 -- (-386.148) [-387.517] (-394.158) (-387.534) * (-391.523) (-392.120) (-387.027) [-389.526] -- 0:00:00
Average standard deviation of split frequencies: 0.005488
990500 -- (-386.163) (-387.435) [-388.058] (-393.082) * [-387.748] (-388.760) (-389.764) (-389.192) -- 0:00:00
991000 -- (-389.294) [-388.176] (-390.101) (-387.780) * (-388.401) (-390.848) (-394.226) [-387.708] -- 0:00:00
991500 -- (-386.437) (-387.171) [-388.403] (-387.352) * (-387.116) (-394.387) (-391.795) [-390.971] -- 0:00:00
992000 -- (-386.656) [-386.785] (-389.097) (-389.985) * (-386.336) (-389.512) [-389.542] (-387.201) -- 0:00:00
992500 -- (-387.564) (-390.924) (-390.712) [-386.829] * (-387.227) [-388.681] (-387.066) (-386.808) -- 0:00:00
993000 -- (-391.534) (-391.086) (-392.303) [-387.122] * [-386.866] (-387.487) (-386.600) (-389.515) -- 0:00:00
993500 -- (-389.415) [-396.658] (-396.399) (-388.547) * (-387.032) (-391.257) [-387.195] (-387.793) -- 0:00:00
994000 -- (-387.787) (-396.262) (-392.384) [-389.432] * (-388.159) (-388.605) (-388.638) [-387.834] -- 0:00:00
994500 -- (-388.837) (-389.347) (-391.923) [-386.715] * (-387.864) (-387.859) [-387.405] (-387.616) -- 0:00:00
995000 -- (-387.822) [-386.394] (-389.195) (-390.844) * (-389.740) (-392.655) (-389.107) [-386.249] -- 0:00:00
Average standard deviation of split frequencies: 0.005900
995500 -- (-386.317) [-386.044] (-389.276) (-393.219) * (-389.344) (-397.871) [-387.632] (-386.270) -- 0:00:00
996000 -- (-386.071) (-386.432) (-388.552) [-390.881] * (-388.484) (-389.452) [-388.931] (-392.733) -- 0:00:00
996500 -- (-388.884) (-390.598) (-387.600) [-388.131] * [-390.482] (-386.968) (-387.169) (-387.000) -- 0:00:00
997000 -- [-387.797] (-388.270) (-389.145) (-389.262) * (-388.337) [-390.067] (-389.858) (-389.791) -- 0:00:00
997500 -- (-391.912) [-386.703] (-388.520) (-386.241) * (-391.960) (-386.412) (-388.667) [-388.086] -- 0:00:00
998000 -- (-389.526) (-387.302) (-389.928) [-390.570] * (-388.533) [-389.082] (-390.174) (-387.339) -- 0:00:00
998500 -- (-388.836) (-389.132) (-387.282) [-386.412] * (-392.654) (-387.031) (-388.077) [-388.583] -- 0:00:00
999000 -- (-386.629) (-386.943) [-389.641] (-387.316) * (-389.543) (-387.791) (-392.070) [-390.057] -- 0:00:00
999500 -- (-386.605) (-387.943) (-388.304) [-388.665] * (-387.295) (-387.087) [-391.713] (-388.001) -- 0:00:00
1000000 -- (-389.684) (-386.251) (-387.139) [-388.032] * (-387.746) [-387.293] (-387.707) (-388.682) -- 0:00:00
Average standard deviation of split frequencies: 0.005779
Analysis completed in 60 seconds
Analysis used 58.42 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -385.90
Likelihood of best state for "cold" chain of run 2 was -385.90
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
40.0 % ( 28 %) Dirichlet(Pi{all})
38.5 % ( 32 %) Slider(Pi{all})
79.3 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 49 %) Multiplier(Alpha{3})
26.3 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.3 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 91 %) ParsSPR(Tau{all},V{all})
28.3 % ( 25 %) Multiplier(V{all})
97.5 % ( 94 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
40.6 % ( 34 %) Dirichlet(Pi{all})
37.8 % ( 21 %) Slider(Pi{all})
78.8 % ( 51 %) Multiplier(Alpha{1,2})
78.1 % ( 51 %) Multiplier(Alpha{3})
25.9 % ( 18 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167074 0.83 0.67
3 | 166175 166822 0.84
4 | 166581 166933 166415
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166692 0.82 0.67
3 | 166880 166737 0.84
4 | 166420 166334 166937
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -387.75
| 2 |
| 1 1 |
| 1 2 1 2 2 |
|* 1 2 1 21 1 21 |
| 2 2 2 1 1 1 1 2 12 1 21|
| * 2 2 22 *2 2 2 |
| 21 1 2 1 11 * 1 1 21 1 2 2|
| 211 2 2 1 11 *2 2 2 1 21 2 2 |
| 1 2 1 2* 2 1 2 2 2 1 112 2 1 11 |
| 221 12 2 1 2 |
| 1 1 1* 12 2 2 |
| 2 |
| 2 1 2 |
| 1 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -389.39
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.70 -392.02
2 -387.68 -391.12
--------------------------------------
TOTAL -387.69 -391.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900367 0.091236 0.380552 1.503334 0.861904 1501.00 1501.00 1.002
r(A<->C){all} 0.155940 0.018780 0.000040 0.431289 0.117792 98.80 215.40 1.002
r(A<->G){all} 0.177329 0.020981 0.000060 0.460676 0.139571 110.37 148.84 1.003
r(A<->T){all} 0.165944 0.020037 0.000239 0.446151 0.131487 188.23 227.51 1.002
r(C<->G){all} 0.160616 0.018578 0.000108 0.426750 0.128281 265.68 281.96 1.001
r(C<->T){all} 0.169222 0.020580 0.000103 0.455421 0.133132 193.14 222.73 1.001
r(G<->T){all} 0.170950 0.020322 0.000140 0.457791 0.134163 177.55 186.75 1.000
pi(A){all} 0.136050 0.000415 0.098245 0.176363 0.135393 884.93 1099.83 1.000
pi(C){all} 0.270058 0.000700 0.220641 0.323632 0.269999 1308.40 1336.91 1.000
pi(G){all} 0.369925 0.000806 0.315444 0.423611 0.368996 1150.09 1179.74 1.000
pi(T){all} 0.223966 0.000618 0.177142 0.271704 0.222862 1271.07 1285.55 1.000
alpha{1,2} 0.419797 0.234434 0.000111 1.372967 0.246198 757.89 950.99 1.000
alpha{3} 0.445862 0.215030 0.000173 1.355229 0.301002 1167.29 1208.25 1.001
pinvar{all} 0.994019 0.000056 0.979377 0.999995 0.996487 1132.10 1264.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- ...*.*
9 -- ....**
10 -- .****.
11 -- .***.*
12 -- ..**..
13 -- ...**.
14 -- ..****
15 -- .*.***
16 -- .**...
17 -- ..*..*
18 -- .**.**
19 -- .*.*..
20 -- ..*.*.
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.003298 0.149900 0.154564 2
8 451 0.150233 0.008951 0.143904 0.156562 2
9 443 0.147568 0.007066 0.142572 0.152565 2
10 443 0.147568 0.000471 0.147235 0.147901 2
11 439 0.146236 0.005182 0.142572 0.149900 2
12 436 0.145237 0.006595 0.140573 0.149900 2
13 430 0.143238 0.001884 0.141905 0.144570 2
14 429 0.142905 0.003298 0.140573 0.145237 2
15 428 0.142572 0.000942 0.141905 0.143238 2
16 428 0.142572 0.007537 0.137242 0.147901 2
17 427 0.142239 0.009893 0.135243 0.149234 2
18 417 0.138907 0.008951 0.132578 0.145237 2
19 406 0.135243 0.015075 0.124584 0.145903 2
20 404 0.134577 0.003769 0.131912 0.137242 2
21 398 0.132578 0.003769 0.129913 0.135243 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099694 0.009947 0.000029 0.303640 0.069375 1.001 2
length{all}[2] 0.099625 0.009690 0.000041 0.301231 0.067711 1.000 2
length{all}[3] 0.100252 0.010629 0.000005 0.299323 0.068729 1.000 2
length{all}[4] 0.099774 0.010344 0.000022 0.311204 0.068662 1.000 2
length{all}[5] 0.099364 0.009998 0.000057 0.308727 0.069020 1.000 2
length{all}[6] 0.100082 0.010104 0.000004 0.298140 0.069874 1.002 2
length{all}[7] 0.104159 0.009863 0.000111 0.310935 0.076427 0.998 2
length{all}[8] 0.102076 0.009680 0.000050 0.292572 0.072419 1.001 2
length{all}[9] 0.093180 0.007635 0.000049 0.264221 0.065236 0.999 2
length{all}[10] 0.102814 0.009553 0.000415 0.298549 0.075735 0.998 2
length{all}[11] 0.103796 0.011147 0.000132 0.317417 0.073404 1.001 2
length{all}[12] 0.103429 0.011201 0.000171 0.305339 0.072949 0.998 2
length{all}[13] 0.095931 0.011842 0.000389 0.285071 0.068657 1.003 2
length{all}[14] 0.096598 0.009698 0.000097 0.281652 0.068938 1.004 2
length{all}[15] 0.099054 0.011508 0.000219 0.282923 0.070752 1.003 2
length{all}[16] 0.092912 0.006950 0.000061 0.256097 0.065937 0.998 2
length{all}[17] 0.104573 0.010178 0.000031 0.311336 0.075554 1.002 2
length{all}[18] 0.104426 0.009181 0.000559 0.296748 0.078788 1.003 2
length{all}[19] 0.101104 0.010329 0.000172 0.291743 0.070325 1.003 2
length{all}[20] 0.109238 0.012229 0.000183 0.329502 0.078815 0.998 2
length{all}[21] 0.092414 0.008461 0.000071 0.270201 0.061872 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005779
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 291
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 97 / 97 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 97 / 97 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101389 0.057812 0.043099 0.054033 0.103875 0.074804 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -412.520145
Iterating by ming2
Initial: fx= 412.520145
x= 0.10139 0.05781 0.04310 0.05403 0.10388 0.07480 0.30000 1.30000
1 h-m-p 0.0000 0.0005 231.2838 +++ 388.145751 m 0.0005 14 | 1/8
2 h-m-p 0.0054 0.0665 17.5533 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 212.7521 ++ 382.918627 m 0.0001 46 | 2/8
4 h-m-p 0.0014 0.1029 15.5503 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 190.4796 ++ 381.470159 m 0.0000 77 | 3/8
6 h-m-p 0.0005 0.1281 12.8946 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 164.7845 +++ 376.572488 m 0.0002 109 | 4/8
8 h-m-p 0.0024 0.1697 10.1034 ------------.. | 4/8
9 h-m-p 0.0000 0.0003 134.7590 +++ 371.414076 m 0.0003 142 | 5/8
10 h-m-p 0.0036 0.2411 7.4134 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 95.7898 ++ 371.170799 m 0.0000 174 | 6/8
12 h-m-p 0.0510 8.0000 0.0000 C 371.170799 0 0.0127 185 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ---Y 371.170799 0 0.0049 201
Out..
lnL = -371.170799
202 lfun, 202 eigenQcodon, 1212 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064758 0.021596 0.065588 0.103185 0.090459 0.057693 0.300003 0.798503 0.269846
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.361390
np = 9
lnL0 = -407.473462
Iterating by ming2
Initial: fx= 407.473462
x= 0.06476 0.02160 0.06559 0.10318 0.09046 0.05769 0.30000 0.79850 0.26985
1 h-m-p 0.0000 0.0002 211.2528 +++ 396.274331 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 242.6703 ++ 379.810559 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0000 8647.7396 ++ 377.181349 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 121.1136 ++ 376.912390 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0002 386.9999 ++ 372.297982 m 0.0002 63 | 5/9
6 h-m-p 0.0000 0.0001 746.6704 ++ 371.170757 m 0.0001 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 371.170757 m 8.0000 87 | 6/9
8 h-m-p 0.0002 0.0171 2.5482 ++++ 371.170750 m 0.0171 104 | 7/9
9 h-m-p 0.2121 4.9514 0.1588 -----------Y 371.170750 0 0.0000 127 | 7/9
10 h-m-p 0.0160 8.0000 0.0050 +++++ 371.170744 m 8.0000 144 | 7/9
11 h-m-p 0.1522 3.1833 0.2646 --------------Y 371.170744 0 0.0000 172 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 --C 371.170744 0 0.0003 188 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170744 m 8.0000 205 | 7/9
14 h-m-p 0.0071 3.5398 0.2480 -----------C 371.170744 0 0.0000 230 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 ---------C 371.170744 0 0.0000 253 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170744 m 8.0000 270 | 7/9
17 h-m-p 0.0070 3.5234 0.2366 -------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170744 m 8.0000 312 | 7/9
19 h-m-p 0.0074 3.7003 0.2236 ----------Y 371.170744 0 0.0000 336 | 7/9
20 h-m-p 0.0160 8.0000 0.0003 +++++ 371.170743 m 8.0000 353 | 7/9
21 h-m-p 0.0050 0.9108 0.4194 ------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170743 m 8.0000 394 | 7/9
23 h-m-p 0.0075 3.7291 0.2226 ---------C 371.170743 0 0.0000 417 | 7/9
24 h-m-p 0.0004 0.1957 0.8688 +++++ 371.170695 m 0.1957 434 | 8/9
25 h-m-p 0.8589 8.0000 0.0000 ++ 371.170695 m 8.0000 448 | 8/9
26 h-m-p 0.0160 8.0000 0.9051 ---------Y 371.170695 0 0.0000 470 | 8/9
27 h-m-p 0.0160 8.0000 0.0001 +++++ 371.170695 m 8.0000 486 | 8/9
28 h-m-p 0.0160 8.0000 1.5889 ---------Y 371.170695 0 0.0000 508 | 8/9
29 h-m-p 0.0369 8.0000 0.0000 ++++ 371.170695 m 8.0000 522 | 8/9
30 h-m-p 0.0382 8.0000 0.0001 ++++ 371.170695 m 8.0000 537 | 8/9
31 h-m-p 0.0160 8.0000 1.0313 ---------C 371.170695 0 0.0000 559 | 8/9
32 h-m-p 0.0315 8.0000 0.0000 C 371.170695 0 0.0079 571 | 8/9
33 h-m-p 0.0326 8.0000 0.0000 --------C 371.170695 0 0.0000 592
Out..
lnL = -371.170695
593 lfun, 1779 eigenQcodon, 7116 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029872 0.029586 0.068196 0.050287 0.088147 0.015648 0.300121 1.131288 0.458364 0.360849 1.395822
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.581078
np = 11
lnL0 = -397.042866
Iterating by ming2
Initial: fx= 397.042866
x= 0.02987 0.02959 0.06820 0.05029 0.08815 0.01565 0.30012 1.13129 0.45836 0.36085 1.39582
1 h-m-p 0.0000 0.0002 217.5535 +++ 388.670509 m 0.0002 17 | 1/11
2 h-m-p 0.0003 0.0013 77.8999 ++ 382.003487 m 0.0013 31 | 2/11
3 h-m-p 0.0000 0.0000 476.8006 ++ 381.904422 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 634.6267 +++ 376.379328 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0000 2701.1173 ++ 373.095509 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 1737.9563 ++ 372.168067 m 0.0000 88 | 6/11
7 h-m-p 0.0075 0.2323 2.6418 -------------.. | 6/11
8 h-m-p 0.0000 0.0001 93.8665 ++ 371.170778 m 0.0001 127 | 7/11
9 h-m-p 0.1655 8.0000 0.0000 +++ 371.170778 m 8.0000 142 | 7/11
10 h-m-p 0.0238 8.0000 0.0026 +++++ 371.170778 m 8.0000 163 | 7/11
11 h-m-p 0.0068 0.2034 3.0249 +++ 371.170773 m 0.2034 182 | 8/11
12 h-m-p 0.5001 2.5003 0.2910 ++ 371.170772 m 2.5003 196 | 8/11
13 h-m-p 0.0130 4.8519 55.9789 -----------N 371.170772 0 0.0000 224 | 8/11
14 h-m-p 0.0030 0.0149 0.0000 ++ 371.170772 m 0.0149 238 | 8/11
15 h-m-p 0.0160 8.0000 0.0002 ----N 371.170772 0 0.0000 259
Out..
lnL = -371.170772
260 lfun, 1040 eigenQcodon, 4680 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -371.177913 S = -371.169515 -0.003212
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:03
did 20 / 41 patterns 0:03
did 30 / 41 patterns 0:03
did 40 / 41 patterns 0:03
did 41 / 41 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040125 0.048104 0.088019 0.078184 0.018923 0.017219 0.000100 0.304199 1.897489
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 24.364388
np = 9
lnL0 = -396.853740
Iterating by ming2
Initial: fx= 396.853740
x= 0.04013 0.04810 0.08802 0.07818 0.01892 0.01722 0.00011 0.30420 1.89749
1 h-m-p 0.0000 0.0000 207.4599 ++ 396.579460 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0476 9.0781 ----------.. | 1/9
3 h-m-p 0.0000 0.0002 207.6625 +++ 388.111913 m 0.0002 47 | 2/9
4 h-m-p 0.0041 0.0404 9.0034 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 194.8341 ++ 387.375762 m 0.0000 81 | 3/9
6 h-m-p 0.0003 0.0327 9.7375 ----------.. | 3/9
7 h-m-p 0.0000 0.0002 173.9197 +++ 379.902818 m 0.0002 114 | 4/9
8 h-m-p 0.0036 0.0298 10.2062 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 154.8022 ++ 377.733882 m 0.0001 148 | 5/9
10 h-m-p 0.0011 0.0302 9.9181 -----------.. | 5/9
11 h-m-p 0.0000 0.0003 126.8960 +++ 372.122002 m 0.0003 182 | 6/9
12 h-m-p 0.0036 0.0352 8.5054 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 92.4169 ++ 371.170735 m 0.0001 216 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 371.170735 m 8.0000 228 | 7/9
15 h-m-p 0.0500 8.0000 0.0002 ++++ 371.170735 m 8.0000 244 | 7/9
16 h-m-p 0.0160 8.0000 1.1500 +++++ 371.170732 m 8.0000 261 | 7/9
17 h-m-p 1.6000 8.0000 0.0234 ------N 371.170732 0 0.0000 279 | 7/9
18 h-m-p 1.1397 8.0000 0.0000 N 371.170732 0 1.1397 293 | 7/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170732 m 8.0000 310 | 7/9
20 h-m-p 0.0160 8.0000 0.3553 +++++ 371.170732 m 8.0000 327 | 7/9
21 h-m-p 0.6420 8.0000 4.4273 ++ 371.170731 m 8.0000 341 | 7/9
22 h-m-p 1.6000 8.0000 2.0109 ++ 371.170731 m 8.0000 353 | 7/9
23 h-m-p 1.6000 8.0000 7.3950 ----------C 371.170731 0 0.0000 375 | 7/9
24 h-m-p 0.6057 8.0000 0.0000 -------Y 371.170731 0 0.0000 394 | 7/9
25 h-m-p 0.0160 8.0000 0.0000 ------Y 371.170731 0 0.0000 414
Out..
lnL = -371.170731
415 lfun, 4565 eigenQcodon, 24900 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076564 0.033163 0.030379 0.075460 0.055961 0.070482 0.000100 0.900000 0.791866 1.582886 1.299870
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.974560
np = 11
lnL0 = -401.353079
Iterating by ming2
Initial: fx= 401.353079
x= 0.07656 0.03316 0.03038 0.07546 0.05596 0.07048 0.00011 0.90000 0.79187 1.58289 1.29987
1 h-m-p 0.0000 0.0000 202.3972 ++ 400.987165 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0039 70.0410 ++++ 384.861209 m 0.0039 32 | 2/11
3 h-m-p 0.0000 0.0000 2164.4857 ++ 383.650668 m 0.0000 46 | 3/11
4 h-m-p 0.0009 0.0258 20.6082 +++ 377.521769 m 0.0258 61 | 4/11
5 h-m-p 0.0003 0.0014 139.7413 ++ 373.581471 m 0.0014 75 | 5/11
6 h-m-p 0.0006 0.0032 98.4551 ++ 371.348916 m 0.0032 89 | 6/11
7 h-m-p 0.0000 0.0000 146203153.5556 ++ 371.170767 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0006 ++ 371.170767 m 8.0000 117 | 7/11
9 h-m-p 0.0187 5.5122 0.2590 ----------Y 371.170767 0 0.0000 145 | 7/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 371.170766 m 8.0000 166 | 7/11
11 h-m-p 0.0092 1.0061 0.2871 -----------Y 371.170766 0 0.0000 195 | 7/11
12 h-m-p 0.0160 8.0000 0.0012 +++++ 371.170765 m 8.0000 216 | 7/11
13 h-m-p 0.0308 1.1920 0.3198 ------------Y 371.170765 0 0.0000 246 | 7/11
14 h-m-p 0.0160 8.0000 0.0012 +++++ 371.170764 m 8.0000 267 | 7/11
15 h-m-p 0.0194 0.8885 0.5054 ------------C 371.170764 0 0.0000 297 | 7/11
16 h-m-p 0.0160 8.0000 0.0017 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170764 m 8.0000 347 | 7/11
18 h-m-p 0.0106 5.3056 0.1653 -----------N 371.170764 0 0.0000 376 | 7/11
19 h-m-p 0.0160 8.0000 0.0013 +++++ 371.170762 m 8.0000 397 | 7/11
20 h-m-p 0.0585 4.7319 0.1840 ------------Y 371.170762 0 0.0000 427 | 7/11
21 h-m-p 0.0160 8.0000 0.0138 +++++ 371.170733 m 8.0000 448 | 7/11
22 h-m-p 0.5249 4.7441 0.2102 ---------------C 371.170733 0 0.0000 481 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170733 m 8.0000 502 | 7/11
24 h-m-p 0.0160 8.0000 0.1388 ----------Y 371.170733 0 0.0000 530 | 7/11
25 h-m-p 0.0160 8.0000 0.0024 +++++ 371.170725 m 8.0000 551 | 7/11
26 h-m-p 0.1575 8.0000 0.1203 ---------------.. | 7/11
27 h-m-p 0.0160 8.0000 0.0005 +++++ 371.170723 m 8.0000 603 | 7/11
28 h-m-p 0.0397 8.0000 0.1001 -----------Y 371.170723 0 0.0000 632 | 7/11
29 h-m-p 0.0000 0.0101 1.2938 +++++ 371.170715 m 0.0101 653 | 8/11
30 h-m-p 0.1427 8.0000 0.0258 -------------C 371.170715 0 0.0000 680 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170715 m 8.0000 700 | 8/11
32 h-m-p 0.0160 8.0000 1.0916 -----------Y 371.170715 0 0.0000 728 | 8/11
33 h-m-p 0.0160 8.0000 0.0001 +++++ 371.170715 m 8.0000 745 | 8/11
34 h-m-p 0.0160 8.0000 0.9590 -------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170715 m 8.0000 793 | 8/11
36 h-m-p 0.0160 8.0000 0.2299 ------------C 371.170715 0 0.0000 822 | 8/11
37 h-m-p 0.0160 8.0000 0.0001 +++++ 371.170715 m 8.0000 842 | 8/11
38 h-m-p 0.0060 3.0048 0.7218 ----------C 371.170715 0 0.0000 869 | 8/11
39 h-m-p 0.0160 8.0000 0.0020 +++++ 371.170714 m 8.0000 889 | 8/11
40 h-m-p 0.0222 2.0844 0.7117 -------------.. | 8/11
41 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170713 m 8.0000 937 | 8/11
42 h-m-p 0.0160 8.0000 0.2247 -------------.. | 8/11
43 h-m-p 0.0160 8.0000 0.0002 +++++ 371.170713 m 8.0000 985 | 8/11
44 h-m-p 0.0160 8.0000 0.2240 -----------C 371.170713 0 0.0000 1013 | 8/11
45 h-m-p 0.0160 8.0000 0.0000 ----N 371.170713 0 0.0000 1034 | 8/11
46 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170713 m 8.0000 1054 | 8/11
47 h-m-p 0.0032 1.6248 2.5275 ---------N 371.170713 0 0.0000 1080 | 8/11
48 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170713 m 8.0000 1097 | 8/11
49 h-m-p 0.0160 8.0000 1.2760 -----------C 371.170713 0 0.0000 1125 | 8/11
50 h-m-p 0.0160 8.0000 0.0000 +++++ 371.170713 m 8.0000 1142 | 8/11
51 h-m-p 0.0160 8.0000 0.0146 +++++ 371.170713 m 8.0000 1162 | 8/11
52 h-m-p 0.0339 0.2604 3.4519 -----------N 371.170713 0 0.0000 1190 | 8/11
53 h-m-p 0.0160 8.0000 0.0000 Y 371.170713 0 0.0040 1204 | 8/11
54 h-m-p 0.0160 8.0000 0.0000 -----C 371.170713 0 0.0000 1226
Out..
lnL = -371.170713
1227 lfun, 14724 eigenQcodon, 80982 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -371.193951 S = -371.170666 -0.010250
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:30
did 20 / 41 patterns 0:31
did 30 / 41 patterns 0:31
did 40 / 41 patterns 0:31
did 41 / 41 patterns 0:31
Time used: 0:31
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=97
NC_011896_1_WP_010908410_1_1667_MLBR_RS07910 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
NC_002677_1_NP_302089_1_961_ML1575 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST
**************************************************
NC_011896_1_WP_010908410_1_1667_MLBR_RS07910 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
NC_002677_1_NP_302089_1_961_ML1575 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855 AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
***********************************************
>NC_011896_1_WP_010908410_1_1667_MLBR_RS07910 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT >NC_002677_1_NP_302089_1_961_ML1575 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT >NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT >NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT >NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT >NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855 TTGATGCCCTGGGGATCGCCTGGGCGGTGGTGGTCAGCGACCGTGTCGGC GGTGAAGCTCGCCTGGGAGGAGTTGGCGGCGCTCAGGTTAGGTCGGCCGT TGGTCTCGCCGCTATCCATCGCGGACATCCGCTGGTGGCTGACCTCAACG GCGTGGTTCGCGATGGAGACTGTCCGCCGGTGGAGATTGCTACCACCGTG CTGGTCAGTTTTCCTGACGCTCGGGCAGATGATAGGTAGACAGGCCCGTG GTTCAGTCCACGCCGATTACCGCATGGTGGACCTGCTGGGT
>NC_011896_1_WP_010908410_1_1667_MLBR_RS07910 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG >NC_002677_1_NP_302089_1_961_ML1575 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG >NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG >NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG >NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG >NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855 LMPWGSPGRWWSATVSAVKLAWEELAALRLGRPLVSPLSIADIRWWLTST AWFAMETVRRWRLLPPCWSVFLTLGQMIGRQARGSVHADYRMVDLLG
#NEXUS
[ID: 5694859264]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908410_1_1667_MLBR_RS07910
NC_002677_1_NP_302089_1_961_ML1575
NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640
NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230
NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640
NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908410_1_1667_MLBR_RS07910,
2 NC_002677_1_NP_302089_1_961_ML1575,
3 NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640,
4 NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230,
5 NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640,
6 NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06937475,2:0.06771098,3:0.06872915,4:0.06866196,5:0.06901997,6:0.06987387);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06937475,2:0.06771098,3:0.06872915,4:0.06866196,5:0.06901997,6:0.06987387);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -387.70 -392.02
2 -387.68 -391.12
--------------------------------------
TOTAL -387.69 -391.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1575/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900367 0.091236 0.380552 1.503334 0.861904 1501.00 1501.00 1.002
r(A<->C){all} 0.155940 0.018780 0.000040 0.431289 0.117792 98.80 215.40 1.002
r(A<->G){all} 0.177329 0.020981 0.000060 0.460676 0.139571 110.37 148.84 1.003
r(A<->T){all} 0.165944 0.020037 0.000239 0.446151 0.131487 188.23 227.51 1.002
r(C<->G){all} 0.160616 0.018578 0.000108 0.426750 0.128281 265.68 281.96 1.001
r(C<->T){all} 0.169222 0.020580 0.000103 0.455421 0.133132 193.14 222.73 1.001
r(G<->T){all} 0.170950 0.020322 0.000140 0.457791 0.134163 177.55 186.75 1.000
pi(A){all} 0.136050 0.000415 0.098245 0.176363 0.135393 884.93 1099.83 1.000
pi(C){all} 0.270058 0.000700 0.220641 0.323632 0.269999 1308.40 1336.91 1.000
pi(G){all} 0.369925 0.000806 0.315444 0.423611 0.368996 1150.09 1179.74 1.000
pi(T){all} 0.223966 0.000618 0.177142 0.271704 0.222862 1271.07 1285.55 1.000
alpha{1,2} 0.419797 0.234434 0.000111 1.372967 0.246198 757.89 950.99 1.000
alpha{3} 0.445862 0.215030 0.000173 1.355229 0.301002 1167.29 1208.25 1.001
pinvar{all} 0.994019 0.000056 0.979377 0.999995 0.996487 1132.10 1264.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1575/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 97
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 2 2 2 2 2 2 | AAC 0 0 0 0 0 0 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 2 2 2 2 2 2
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 4 4 4 4 4 4
GTC 3 3 3 3 3 3 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 7 7 7 7 7 7 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908410_1_1667_MLBR_RS07910
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
#2: NC_002677_1_NP_302089_1_961_ML1575
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
#3: NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
#4: NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
#5: NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
#6: NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 6 | TGC 6
Leu L TTA 6 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 54
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 18 | CCC 6 | CAC 6 | CGC 18
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 24 | CCG 18 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 12 | AAC 0 | AGC 0
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 12
Met M ATG 24 | ACG 12 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 24
GTC 18 | GCC 18 | GAC 12 | GGC 0
GTA 0 | GCA 0 | Glu E GAA 0 | GGA 6
GTG 18 | GCG 42 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.26804 C:0.25773 A:0.16495 G:0.30928
position 2: T:0.30928 C:0.29897 A:0.11340 G:0.27835
position 3: T:0.09278 C:0.25773 A:0.12371 G:0.52577
Average T:0.22337 C:0.27148 A:0.13402 G:0.37113
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -371.170799 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300003 1.299870
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908410_1_1667_MLBR_RS07910: 0.000004, NC_002677_1_NP_302089_1_961_ML1575: 0.000004, NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640: 0.000004, NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230: 0.000004, NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640: 0.000004, NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30000
omega (dN/dS) = 1.29987
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 228.6 62.4 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -371.170695 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300121 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908410_1_1667_MLBR_RS07910: 0.000004, NC_002677_1_NP_302089_1_961_ML1575: 0.000004, NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640: 0.000004, NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230: 0.000004, NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640: 0.000004, NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30012
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 228.6 62.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -371.170772 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.584101 0.240344 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908410_1_1667_MLBR_RS07910: 0.000004, NC_002677_1_NP_302089_1_961_ML1575: 0.000004, NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640: 0.000004, NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230: 0.000004, NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640: 0.000004, NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.58410 0.24034 0.17556
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
7..2 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
7..3 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
7..4 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
7..5 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
7..6 0.000 230.7 60.3 0.4159 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908410_1_1667_MLBR_RS07910)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -371.170731 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 8.838036 64.872574
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908410_1_1667_MLBR_RS07910: 0.000004, NC_002677_1_NP_302089_1_961_ML1575: 0.000004, NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640: 0.000004, NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230: 0.000004, NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640: 0.000004, NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 8.83804 q = 64.87257
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.06445 0.08147 0.09283 0.10257 0.11182 0.12122 0.13139 0.14326 0.15891 0.18711
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
7..2 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
7..3 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
7..4 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
7..5 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
7..6 0.000 230.7 60.3 0.1195 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -371.170713 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.116213 1.756847 1.884254
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908410_1_1667_MLBR_RS07910: 0.000004, NC_002677_1_NP_302089_1_961_ML1575: 0.000004, NZ_LVXE01000006_1_WP_010908410_1_2291_A3216_RS03640: 0.000004, NZ_LYPH01000002_1_WP_010908410_1_259_A8144_RS01230: 0.000004, NZ_CP029543_1_WP_010908410_1_1698_DIJ64_RS08640: 0.000004, NZ_AP014567_1_WP_010908410_1_1741_JK2ML_RS08855: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.11621 q = 1.75685
(p1 = 0.00001) w = 1.88425
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00005 0.00047 0.00267 0.01132 0.03952 0.12290 0.38685 1.88425
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
7..2 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
7..3 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
7..4 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
7..5 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
7..6 0.000 230.7 60.3 0.0564 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908410_1_1667_MLBR_RS07910)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:31
Model 1: NearlyNeutral -371.170695 Model 2: PositiveSelection -371.170772 Model 0: one-ratio -371.170799 Model 7: beta -371.170731 Model 8: beta&w>1 -371.170713 Model 0 vs 1 2.0799999992959783E-4 Model 2 vs 1 1.539999999522479E-4 Model 8 vs 7 3.6000000022795575E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
