--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:58:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1589/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1267.47         -1270.83
2      -1267.46         -1271.58
--------------------------------------
TOTAL    -1267.47         -1271.27
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893368    0.093038    0.329988    1.472398    0.857452   1501.00   1501.00    1.000
r(A<->C){all}   0.169379    0.019962    0.000013    0.457803    0.136969    374.44    411.68    1.000
r(A<->G){all}   0.159134    0.019284    0.000101    0.441358    0.120980    174.03    297.38    1.003
r(A<->T){all}   0.169820    0.020166    0.000037    0.447295    0.132356    155.98    273.41    1.011
r(C<->G){all}   0.171881    0.020370    0.000124    0.461442    0.134350    174.10    205.43    1.005
r(C<->T){all}   0.161612    0.018675    0.000155    0.432410    0.124951    180.00    236.95    1.010
r(G<->T){all}   0.168174    0.019199    0.000045    0.453384    0.134459    214.72    274.04    1.000
pi(A){all}      0.153061    0.000138    0.130208    0.176267    0.152657   1270.71   1326.09    1.001
pi(C){all}      0.264984    0.000200    0.236799    0.291998    0.264777   1259.64   1297.82    1.000
pi(G){all}      0.329383    0.000233    0.299393    0.359198    0.329508   1021.10   1089.87    1.000
pi(T){all}      0.252571    0.000214    0.225859    0.282009    0.251878   1159.89   1209.85    1.000
alpha{1,2}      0.415050    0.234805    0.000128    1.348974    0.247434   1282.64   1285.03    1.000
alpha{3}        0.469095    0.243589    0.000655    1.438532    0.299167   1297.02   1369.08    1.000
pinvar{all}     0.998323    0.000004    0.994838    0.999999    0.998911   1277.37   1299.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1235.303745
Model 2: PositiveSelection	-1235.303764
Model 0: one-ratio	-1235.303789
Model 7: beta	-1235.303678
Model 8: beta&w>1	-1235.303671


Model 0 vs 1	8.800000023256871E-5

Model 2 vs 1	3.80000001314329E-5

Model 8 vs 7	1.4000000192027073E-5
>C1
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C2
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C3
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C4
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C5
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C6
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=312 

C1              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C2              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C3              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C4              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C5              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C6              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
                **************************************************

C1              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C2              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C3              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C4              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C5              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C6              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
                **************************************************

C1              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C2              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C3              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C4              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C5              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C6              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
                **************************************************

C1              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C2              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C3              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C4              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C5              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C6              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
                **************************************************

C1              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C2              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C3              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C4              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C5              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C6              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
                **************************************************

C1              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C2              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C3              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C4              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C5              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C6              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
                **************************************************

C1              AVVAWTMLTLLP
C2              AVVAWTMLTLLP
C3              AVVAWTMLTLLP
C4              AVVAWTMLTLLP
C5              AVVAWTMLTLLP
C6              AVVAWTMLTLLP
                ************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  312 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  312 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9360]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9360]--->[9360]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.510 Mb, Max= 30.876 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C2              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C3              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C4              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C5              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
C6              VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
                **************************************************

C1              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C2              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C3              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C4              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C5              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
C6              LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
                **************************************************

C1              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C2              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C3              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C4              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C5              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
C6              VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
                **************************************************

C1              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C2              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C3              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C4              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C5              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
C6              YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
                **************************************************

C1              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C2              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C3              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C4              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C5              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
C6              TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
                **************************************************

C1              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C2              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C3              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C4              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C5              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
C6              ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
                **************************************************

C1              AVVAWTMLTLLP
C2              AVVAWTMLTLLP
C3              AVVAWTMLTLLP
C4              AVVAWTMLTLLP
C5              AVVAWTMLTLLP
C6              AVVAWTMLTLLP
                ************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
C2              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
C3              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
C4              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
C5              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
C6              GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
                **************************************************

C1              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
C2              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
C3              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
C4              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
C5              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
C6              TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
                **************************************************

C1              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
C2              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
C3              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
C4              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
C5              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
C6              GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
                **************************************************

C1              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
C2              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
C3              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
C4              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
C5              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
C6              CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
                **************************************************

C1              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
C2              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
C3              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
C4              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
C5              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
C6              TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
                **************************************************

C1              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
C2              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
C3              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
C4              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
C5              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
C6              CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
                **************************************************

C1              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
C2              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
C3              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
C4              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
C5              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
C6              GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
                **************************************************

C1              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
C2              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
C3              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
C4              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
C5              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
C6              TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
                **************************************************

C1              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
C2              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
C3              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
C4              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
C5              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
C6              GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
                **************************************************

C1              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
C2              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
C3              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
C4              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
C5              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
C6              TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
                **************************************************

C1              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
C2              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
C3              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
C4              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
C5              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
C6              GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
                **************************************************

C1              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
C2              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
C3              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
C4              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
C5              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
C6              GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
                **************************************************

C1              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
C2              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
C3              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
C4              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
C5              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
C6              ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
                **************************************************

C1              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
C2              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
C3              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
C4              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
C5              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
C6              GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
                **************************************************

C1              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
C2              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
C3              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
C4              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
C5              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
C6              CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
                **************************************************

C1              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
C2              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
C3              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
C4              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
C5              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
C6              GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
                **************************************************

C1              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
C2              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
C3              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
C4              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
C5              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
C6              GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
                **************************************************

C1              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
C2              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
C3              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
C4              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
C5              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
C6              TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
                **************************************************

C1              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
C2              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
C3              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
C4              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
C5              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
C6              GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
                ************************************



>C1
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C2
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C3
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C4
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C5
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C6
GTGGCTTCCACCGATCCCGGCACAGGCACCCCGCTTGACGAGTCGGTGCC
TGGGATCAAGAGGGCTATGCGGCAATCGACTAAGAATACCCCCCGGGCGG
GACGTAATCTGCCCGCCGCGATCGCGGTGGGCTTAAGTATTGGTGGTGTT
CTCGTCGCAACGCTGGTGTTTGCTCCGCGAATCTGGGTTGTCTTGTGCGC
TGGCGCCATTTTCGTTGCTAGCCATGAGGTGGTGCGGCGGCTACGGGAAG
CTGGATATGTGATTCCGGCTATCCCGCTGCTCATCGGTGGGCAGTTCACC
GTCTGGTTAACTTGGCCGTATCGCACCGTTGGTGCATTGGCTGGCTTCGG
TGCGACGGTGGTGGTCTGCATGATTTGGCGGCTTGTCATGCACGACAACA
GCAAGCAGCACGAATCTCGGGAAGCTTTGGCAGGTCCGCCGGTGTCAAAT
TACCTGCGGGACGCGTCGGCCACCGTTTTTTTGGCCGCGTGGGTCCCGTT
GTTTGCCTCGTTCGCAGCATTGCTGGTTTATCCGAAGGATGGTGCGGGCC
GGGTATTCTGCCTGATGATTGCGGTGGTAGCTTCCGATGTGGGTGGTTAC
ACAGTAGGGGTACTTTTCGGCAAACATCCACTGGTTCCAAGGATTAGCCC
GAATAAGTCCTGGGAGGGATTCGCCGGTTCGCTGGTCTGCGGGACCACCG
CAACCATCCTGACTGCTACCTTCCTGGCTGGCAAAACACCGTGGGTTGGG
GCTTTGCTCAGTTTTGTACTGGTGCTCACCTGCACGCTGGGGGATTTGGT
GGAGTCCCAAGTTAAGCGCGACCTCGGCATCAAAGATATGGGCCGGCTGC
TACCCGGCCACGGTGGCCTGATGGACCGGCTTGATGGTGTGCTGCCGTCG
GCGGTTGTAGCTTGGACCATGCTTACGTTGCTGCCC
>C1
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C2
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C3
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C4
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C5
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP
>C6
VASTDPGTGTPLDESVPGIKRAMRQSTKNTPRAGRNLPAAIAVGLSIGGV
LVATLVFAPRIWVVLCAGAIFVASHEVVRRLREAGYVIPAIPLLIGGQFT
VWLTWPYRTVGALAGFGATVVVCMIWRLVMHDNSKQHESREALAGPPVSN
YLRDASATVFLAAWVPLFASFAALLVYPKDGAGRVFCLMIAVVASDVGGY
TVGVLFGKHPLVPRISPNKSWEGFAGSLVCGTTATILTATFLAGKTPWVG
ALLSFVLVLTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPS
AVVAWTMLTLLP


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 936 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856244
      Setting output file names to "/data/7res/ML1589/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1806512773
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5927676728
      Seed = 104823354
      Swapseed = 1579856244
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2094.812863 -- -24.965149
         Chain 2 -- -2094.812863 -- -24.965149
         Chain 3 -- -2094.812545 -- -24.965149
         Chain 4 -- -2094.812863 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2094.812863 -- -24.965149
         Chain 2 -- -2094.812863 -- -24.965149
         Chain 3 -- -2094.812741 -- -24.965149
         Chain 4 -- -2094.812741 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2094.813] (-2094.813) (-2094.813) (-2094.813) * [-2094.813] (-2094.813) (-2094.813) (-2094.813) 
        500 -- (-1287.034) (-1309.885) (-1281.856) [-1286.526] * (-1278.978) (-1290.301) [-1271.793] (-1287.483) -- 0:00:00
       1000 -- (-1279.140) [-1282.768] (-1276.277) (-1278.370) * (-1278.941) (-1278.973) (-1276.119) [-1276.505] -- 0:00:00
       1500 -- [-1272.181] (-1280.329) (-1276.114) (-1272.188) * [-1276.236] (-1272.041) (-1278.531) (-1278.960) -- 0:00:00
       2000 -- [-1276.956] (-1274.865) (-1280.189) (-1282.246) * (-1273.747) [-1276.996] (-1278.356) (-1272.597) -- 0:00:00
       2500 -- (-1273.800) [-1272.861] (-1289.758) (-1281.193) * (-1273.253) (-1287.110) (-1281.149) [-1276.883] -- 0:00:00
       3000 -- (-1283.744) (-1272.897) [-1276.463] (-1282.773) * (-1276.245) [-1279.756] (-1276.330) (-1276.651) -- 0:00:00
       3500 -- (-1281.247) (-1274.142) (-1275.725) [-1278.435] * [-1279.809] (-1278.515) (-1273.671) (-1274.723) -- 0:00:00
       4000 -- (-1276.574) (-1277.088) (-1281.964) [-1274.081] * (-1279.220) [-1272.947] (-1277.449) (-1277.292) -- 0:00:00
       4500 -- (-1273.121) (-1280.834) (-1275.854) [-1272.765] * (-1285.743) [-1275.499] (-1274.077) (-1281.047) -- 0:00:00
       5000 -- (-1282.868) (-1272.821) (-1281.258) [-1273.354] * (-1281.411) [-1272.081] (-1280.167) (-1281.688) -- 0:00:00

      Average standard deviation of split frequencies: 0.088815

       5500 -- [-1274.776] (-1275.507) (-1275.775) (-1270.517) * (-1277.895) (-1274.346) (-1271.821) [-1278.518] -- 0:00:00
       6000 -- (-1276.961) (-1277.334) (-1286.520) [-1275.459] * (-1272.017) [-1275.862] (-1275.861) (-1278.422) -- 0:00:00
       6500 -- (-1280.360) [-1275.859] (-1280.567) (-1279.700) * (-1282.773) (-1289.261) (-1273.992) [-1275.920] -- 0:02:32
       7000 -- [-1271.845] (-1278.549) (-1273.249) (-1277.160) * (-1279.712) (-1277.124) (-1275.745) [-1276.417] -- 0:02:21
       7500 -- [-1278.935] (-1279.289) (-1273.271) (-1275.639) * (-1276.236) [-1272.306] (-1284.348) (-1277.113) -- 0:02:12
       8000 -- (-1273.575) (-1286.027) [-1279.210] (-1278.215) * (-1272.586) (-1285.446) (-1286.320) [-1277.211] -- 0:02:04
       8500 -- (-1272.440) [-1274.057] (-1278.235) (-1281.882) * [-1277.174] (-1281.368) (-1287.292) (-1277.518) -- 0:01:56
       9000 -- [-1271.014] (-1273.332) (-1277.157) (-1276.435) * [-1275.403] (-1277.131) (-1275.994) (-1278.233) -- 0:01:50
       9500 -- (-1273.479) [-1278.260] (-1277.978) (-1275.442) * (-1275.657) (-1276.719) [-1275.854] (-1280.832) -- 0:01:44
      10000 -- (-1276.319) [-1280.404] (-1281.979) (-1271.441) * [-1276.917] (-1279.608) (-1276.084) (-1273.672) -- 0:01:39

      Average standard deviation of split frequencies: 0.092808

      10500 -- (-1280.105) (-1279.470) [-1273.709] (-1273.706) * (-1288.252) (-1278.529) (-1274.927) [-1273.531] -- 0:01:34
      11000 -- [-1275.964] (-1284.549) (-1279.487) (-1277.985) * (-1273.355) (-1279.568) (-1278.856) [-1273.096] -- 0:01:29
      11500 -- [-1276.591] (-1276.849) (-1272.877) (-1277.227) * (-1275.082) [-1276.618] (-1272.890) (-1278.527) -- 0:01:25
      12000 -- (-1269.398) (-1274.105) [-1273.371] (-1279.855) * (-1276.396) (-1277.012) (-1277.125) [-1280.619] -- 0:01:22
      12500 -- [-1273.972] (-1286.305) (-1276.464) (-1278.420) * (-1281.409) (-1274.473) [-1276.822] (-1275.695) -- 0:01:19
      13000 -- (-1276.634) (-1275.617) (-1277.837) [-1274.801] * [-1277.432] (-1274.328) (-1281.730) (-1284.860) -- 0:01:15
      13500 -- (-1277.095) (-1275.741) [-1282.499] (-1274.604) * (-1278.515) (-1277.463) [-1271.449] (-1279.102) -- 0:01:13
      14000 -- [-1281.850] (-1276.397) (-1283.410) (-1282.948) * (-1272.354) [-1279.187] (-1280.851) (-1279.647) -- 0:01:10
      14500 -- (-1275.721) (-1278.241) (-1282.210) [-1280.545] * (-1283.529) (-1277.461) (-1283.911) [-1274.972] -- 0:01:07
      15000 -- (-1279.630) (-1274.467) (-1277.749) [-1274.562] * [-1277.476] (-1281.364) (-1272.820) (-1278.130) -- 0:01:05

      Average standard deviation of split frequencies: 0.083969

      15500 -- (-1273.595) (-1278.048) (-1282.944) [-1278.858] * (-1284.744) (-1283.453) [-1277.678] (-1283.671) -- 0:01:03
      16000 -- (-1281.965) (-1277.347) (-1280.963) [-1280.008] * (-1275.487) (-1280.282) (-1281.620) [-1271.411] -- 0:01:01
      16500 -- (-1274.375) (-1272.460) [-1272.896] (-1275.299) * (-1279.057) (-1284.497) [-1276.541] (-1284.095) -- 0:00:59
      17000 -- (-1273.894) [-1276.914] (-1285.610) (-1280.813) * [-1280.583] (-1286.936) (-1279.375) (-1273.484) -- 0:00:57
      17500 -- [-1283.345] (-1274.914) (-1273.050) (-1269.731) * [-1278.605] (-1272.640) (-1276.988) (-1276.511) -- 0:00:56
      18000 -- (-1283.499) (-1280.796) [-1282.784] (-1277.596) * (-1282.385) [-1280.629] (-1280.299) (-1270.619) -- 0:00:54
      18500 -- (-1288.010) (-1281.993) [-1285.132] (-1279.291) * [-1282.600] (-1280.214) (-1280.622) (-1282.123) -- 0:00:53
      19000 -- (-1287.519) (-1288.790) (-1278.011) [-1279.091] * [-1281.929] (-1278.049) (-1285.941) (-1273.413) -- 0:00:51
      19500 -- [-1278.428] (-1285.899) (-1275.826) (-1281.213) * (-1277.174) (-1276.927) [-1278.150] (-1274.807) -- 0:00:50
      20000 -- [-1273.267] (-1270.575) (-1275.147) (-1272.390) * (-1279.840) (-1277.852) [-1273.486] (-1276.998) -- 0:00:49

      Average standard deviation of split frequencies: 0.069570

      20500 -- (-1280.434) (-1270.158) [-1275.576] (-1275.541) * (-1278.021) (-1274.581) (-1269.294) [-1286.825] -- 0:00:47
      21000 -- [-1278.298] (-1270.263) (-1274.559) (-1283.437) * (-1270.068) (-1283.016) (-1270.040) [-1275.162] -- 0:00:46
      21500 -- [-1274.568] (-1269.737) (-1275.392) (-1275.062) * [-1269.301] (-1300.025) (-1267.872) (-1279.577) -- 0:00:45
      22000 -- (-1284.006) (-1268.730) [-1277.444] (-1273.922) * (-1268.877) (-1284.273) (-1267.183) [-1273.232] -- 0:01:28
      22500 -- (-1283.474) [-1266.406] (-1277.584) (-1281.437) * (-1268.924) [-1278.150] (-1270.476) (-1275.766) -- 0:01:26
      23000 -- (-1282.055) (-1267.688) [-1282.182] (-1279.726) * (-1269.261) (-1274.991) (-1270.351) [-1274.526] -- 0:01:24
      23500 -- [-1275.947] (-1268.137) (-1277.552) (-1283.457) * (-1266.136) (-1271.175) [-1268.507] (-1276.903) -- 0:01:23
      24000 -- (-1278.074) (-1267.598) (-1281.186) [-1278.421] * (-1267.844) (-1284.283) [-1274.223] (-1278.313) -- 0:01:21
      24500 -- [-1276.228] (-1269.258) (-1282.212) (-1278.566) * [-1268.487] (-1283.085) (-1269.108) (-1276.361) -- 0:01:19
      25000 -- [-1272.250] (-1266.571) (-1284.092) (-1283.025) * [-1266.496] (-1272.125) (-1268.116) (-1275.609) -- 0:01:18

      Average standard deviation of split frequencies: 0.048086

      25500 -- (-1274.142) [-1268.719] (-1279.004) (-1279.992) * [-1267.167] (-1269.806) (-1267.951) (-1280.498) -- 0:01:16
      26000 -- (-1278.897) (-1273.508) [-1275.739] (-1274.036) * (-1271.260) (-1270.321) [-1270.573] (-1277.290) -- 0:01:14
      26500 -- (-1281.741) [-1266.801] (-1275.764) (-1288.428) * [-1267.030] (-1274.084) (-1269.805) (-1274.655) -- 0:01:13
      27000 -- (-1280.887) (-1269.159) [-1278.350] (-1281.800) * (-1270.947) (-1275.576) (-1269.592) [-1273.188] -- 0:01:12
      27500 -- (-1274.813) [-1267.013] (-1269.394) (-1276.563) * (-1269.702) (-1268.739) (-1269.052) [-1279.443] -- 0:01:10
      28000 -- (-1278.225) (-1268.057) [-1267.533] (-1276.650) * (-1269.600) (-1272.475) (-1268.279) [-1274.129] -- 0:01:09
      28500 -- (-1278.626) (-1266.746) [-1268.761] (-1275.106) * (-1268.700) [-1270.781] (-1270.334) (-1273.338) -- 0:01:08
      29000 -- (-1275.658) [-1266.762] (-1268.072) (-1269.907) * (-1269.281) (-1271.183) [-1267.346] (-1287.585) -- 0:01:06
      29500 -- (-1273.760) (-1269.386) (-1270.176) [-1267.874] * [-1268.406] (-1270.073) (-1271.801) (-1274.786) -- 0:01:05
      30000 -- (-1275.610) (-1270.171) (-1267.266) [-1268.025] * (-1270.995) (-1268.982) [-1268.669] (-1275.477) -- 0:01:04

      Average standard deviation of split frequencies: 0.036091

      30500 -- (-1280.608) [-1271.313] (-1267.504) (-1268.334) * (-1267.946) (-1270.596) (-1269.914) [-1277.270] -- 0:01:03
      31000 -- (-1272.005) (-1273.383) [-1267.799] (-1267.840) * [-1267.850] (-1269.003) (-1269.092) (-1274.983) -- 0:01:02
      31500 -- (-1278.445) (-1270.861) [-1267.202] (-1273.958) * (-1268.070) [-1269.549] (-1269.302) (-1274.284) -- 0:01:01
      32000 -- (-1275.906) [-1268.198] (-1267.370) (-1268.803) * (-1267.614) (-1269.840) [-1269.804] (-1299.968) -- 0:01:00
      32500 -- [-1272.153] (-1267.755) (-1266.348) (-1269.040) * (-1266.703) (-1267.773) (-1270.792) [-1270.388] -- 0:00:59
      33000 -- (-1280.609) (-1268.880) [-1266.332] (-1269.936) * (-1269.557) (-1266.583) (-1272.638) [-1275.489] -- 0:00:58
      33500 -- (-1279.152) (-1267.852) [-1266.852] (-1268.633) * (-1268.231) [-1266.081] (-1271.810) (-1267.838) -- 0:00:57
      34000 -- [-1278.224] (-1269.181) (-1266.564) (-1267.333) * (-1268.601) (-1266.151) (-1267.519) [-1267.211] -- 0:00:56
      34500 -- [-1270.607] (-1269.962) (-1267.530) (-1268.996) * (-1268.192) (-1268.324) [-1267.577] (-1269.911) -- 0:00:55
      35000 -- (-1280.414) [-1271.171] (-1269.927) (-1268.999) * (-1269.687) (-1268.139) [-1267.576] (-1269.896) -- 0:00:55

      Average standard deviation of split frequencies: 0.034701

      35500 -- (-1287.152) [-1273.318] (-1267.523) (-1266.222) * [-1267.235] (-1267.551) (-1266.815) (-1267.297) -- 0:00:54
      36000 -- (-1277.369) [-1269.751] (-1267.513) (-1266.901) * (-1267.546) (-1267.633) [-1269.434] (-1267.292) -- 0:00:53
      36500 -- [-1272.697] (-1273.577) (-1266.743) (-1268.734) * (-1270.338) (-1270.699) (-1266.899) [-1266.266] -- 0:00:52
      37000 -- (-1275.710) (-1274.265) [-1266.743] (-1268.314) * (-1267.811) (-1269.244) [-1267.227] (-1268.226) -- 0:00:52
      37500 -- (-1276.836) (-1271.100) [-1268.730] (-1266.609) * (-1267.623) (-1267.831) (-1271.171) [-1266.554] -- 0:01:17
      38000 -- [-1277.276] (-1267.649) (-1269.115) (-1266.862) * [-1268.308] (-1268.855) (-1267.823) (-1265.728) -- 0:01:15
      38500 -- (-1277.374) [-1267.959] (-1269.632) (-1266.838) * [-1267.929] (-1269.433) (-1265.954) (-1266.452) -- 0:01:14
      39000 -- [-1274.718] (-1271.529) (-1269.353) (-1266.195) * (-1269.688) (-1268.455) (-1268.307) [-1265.818] -- 0:01:13
      39500 -- [-1277.074] (-1268.071) (-1267.263) (-1265.870) * (-1267.656) [-1269.017] (-1266.557) (-1266.371) -- 0:01:12
      40000 -- [-1275.031] (-1270.660) (-1267.259) (-1265.928) * [-1267.740] (-1272.973) (-1268.585) (-1269.834) -- 0:01:12

      Average standard deviation of split frequencies: 0.029808

      40500 -- (-1286.035) (-1271.829) [-1266.257] (-1266.701) * (-1267.331) (-1272.229) (-1267.727) [-1270.167] -- 0:01:11
      41000 -- (-1274.534) (-1273.534) [-1267.227] (-1268.312) * (-1267.618) [-1271.244] (-1266.906) (-1275.176) -- 0:01:10
      41500 -- (-1281.503) (-1272.784) [-1268.908] (-1269.661) * [-1266.449] (-1270.550) (-1268.473) (-1275.941) -- 0:01:09
      42000 -- (-1275.723) [-1271.863] (-1267.783) (-1266.922) * (-1267.247) [-1267.530] (-1267.542) (-1272.021) -- 0:01:08
      42500 -- (-1275.578) (-1269.120) (-1268.105) [-1267.227] * (-1266.753) [-1267.543] (-1268.558) (-1271.550) -- 0:01:07
      43000 -- (-1280.635) (-1266.828) (-1271.051) [-1267.455] * (-1270.786) [-1267.510] (-1267.799) (-1268.168) -- 0:01:06
      43500 -- [-1278.462] (-1266.939) (-1270.177) (-1267.160) * [-1270.025] (-1269.801) (-1269.057) (-1266.198) -- 0:01:05
      44000 -- (-1280.170) (-1266.507) (-1269.180) [-1266.647] * [-1267.056] (-1269.715) (-1269.838) (-1267.702) -- 0:01:05
      44500 -- (-1281.951) (-1267.621) (-1273.217) [-1267.038] * (-1269.654) (-1265.921) [-1268.755] (-1266.125) -- 0:01:04
      45000 -- (-1272.517) [-1270.462] (-1267.182) (-1266.771) * (-1270.444) (-1268.628) (-1273.048) [-1269.703] -- 0:01:03

      Average standard deviation of split frequencies: 0.025864

      45500 -- (-1275.741) (-1267.468) [-1267.130] (-1267.946) * (-1270.111) (-1267.526) (-1269.128) [-1266.349] -- 0:01:02
      46000 -- (-1274.461) (-1266.696) [-1267.525] (-1267.103) * (-1268.873) (-1266.280) [-1267.361] (-1266.909) -- 0:01:02
      46500 -- (-1273.311) (-1267.720) (-1265.861) [-1267.059] * (-1272.700) [-1269.074] (-1266.853) (-1266.626) -- 0:01:01
      47000 -- (-1280.193) [-1268.635] (-1268.434) (-1266.395) * [-1267.051] (-1268.038) (-1268.269) (-1267.912) -- 0:01:00
      47500 -- [-1277.903] (-1272.827) (-1266.545) (-1267.738) * [-1267.873] (-1268.029) (-1267.667) (-1265.948) -- 0:01:00
      48000 -- (-1298.858) (-1268.848) (-1266.549) [-1267.895] * (-1267.752) [-1267.374] (-1271.932) (-1267.537) -- 0:00:59
      48500 -- (-1300.158) (-1269.090) [-1266.751] (-1266.864) * (-1267.318) [-1267.775] (-1271.581) (-1266.736) -- 0:00:58
      49000 -- (-1272.227) (-1272.947) (-1266.751) [-1269.323] * (-1268.553) (-1271.505) (-1269.385) [-1266.978] -- 0:00:58
      49500 -- (-1270.382) (-1269.684) [-1268.086] (-1266.654) * (-1269.373) (-1270.520) [-1269.825] (-1266.142) -- 0:00:57
      50000 -- (-1268.461) (-1272.863) [-1266.773] (-1267.490) * [-1268.188] (-1268.372) (-1268.766) (-1271.435) -- 0:00:57

      Average standard deviation of split frequencies: 0.025254

      50500 -- (-1270.372) [-1270.955] (-1267.527) (-1267.022) * (-1267.361) [-1267.273] (-1271.148) (-1271.236) -- 0:00:56
      51000 -- (-1267.306) (-1268.745) [-1265.757] (-1266.878) * (-1269.887) (-1270.414) (-1267.117) [-1269.092] -- 0:00:55
      51500 -- (-1269.334) [-1268.029] (-1267.840) (-1266.389) * (-1268.619) (-1268.234) (-1269.706) [-1270.315] -- 0:00:55
      52000 -- (-1268.528) (-1269.304) (-1271.263) [-1265.783] * (-1270.058) [-1268.050] (-1269.233) (-1269.547) -- 0:00:54
      52500 -- (-1267.079) (-1267.480) [-1267.711] (-1267.735) * [-1268.429] (-1266.876) (-1270.897) (-1266.409) -- 0:00:54
      53000 -- (-1266.774) [-1266.369] (-1269.298) (-1268.798) * (-1270.042) [-1266.039] (-1268.947) (-1266.398) -- 0:00:53
      53500 -- (-1266.107) (-1266.876) [-1272.346] (-1267.650) * (-1268.741) (-1267.113) (-1269.193) [-1267.581] -- 0:00:53
      54000 -- (-1268.941) [-1267.376] (-1270.028) (-1267.309) * (-1269.527) (-1268.666) (-1271.831) [-1266.819] -- 0:01:10
      54500 -- (-1271.199) (-1267.433) [-1268.103] (-1267.233) * [-1267.235] (-1269.992) (-1270.523) (-1269.558) -- 0:01:09
      55000 -- [-1267.652] (-1270.433) (-1266.730) (-1268.490) * [-1268.035] (-1268.056) (-1270.824) (-1266.992) -- 0:01:08

      Average standard deviation of split frequencies: 0.023149

      55500 -- (-1273.035) (-1271.243) (-1266.534) [-1269.149] * [-1276.208] (-1267.618) (-1267.467) (-1266.992) -- 0:01:08
      56000 -- (-1269.390) (-1270.878) [-1267.103] (-1269.209) * (-1268.717) (-1266.974) (-1269.808) [-1266.760] -- 0:01:07
      56500 -- (-1269.528) (-1270.403) [-1268.673] (-1268.581) * (-1271.237) (-1266.924) (-1266.373) [-1267.236] -- 0:01:06
      57000 -- (-1267.533) (-1271.524) [-1268.835] (-1269.608) * (-1268.443) (-1267.682) (-1271.649) [-1266.852] -- 0:01:06
      57500 -- [-1271.853] (-1267.602) (-1267.788) (-1268.823) * (-1272.748) [-1274.298] (-1270.050) (-1269.157) -- 0:01:05
      58000 -- (-1268.287) [-1268.326] (-1269.799) (-1269.324) * (-1269.020) (-1269.114) [-1267.736] (-1269.188) -- 0:01:04
      58500 -- (-1270.438) (-1271.833) (-1270.134) [-1268.530] * (-1266.343) (-1268.128) [-1267.816] (-1267.416) -- 0:01:04
      59000 -- (-1273.589) [-1266.512] (-1267.981) (-1266.236) * (-1267.661) [-1266.902] (-1268.841) (-1268.073) -- 0:01:03
      59500 -- (-1268.815) (-1268.076) [-1267.943] (-1267.136) * [-1266.363] (-1268.776) (-1268.103) (-1269.774) -- 0:01:03
      60000 -- (-1268.142) (-1267.980) (-1270.762) [-1266.672] * (-1267.238) (-1268.855) [-1267.322] (-1269.162) -- 0:01:02

      Average standard deviation of split frequencies: 0.024129

      60500 -- (-1267.263) (-1269.203) [-1266.551] (-1269.426) * (-1268.436) [-1268.267] (-1267.077) (-1269.996) -- 0:01:02
      61000 -- (-1267.000) [-1270.260] (-1266.456) (-1269.026) * (-1268.152) (-1275.823) [-1268.983] (-1269.729) -- 0:01:01
      61500 -- [-1271.060] (-1268.616) (-1268.541) (-1269.746) * [-1269.167] (-1279.188) (-1269.162) (-1267.153) -- 0:01:01
      62000 -- (-1267.576) [-1269.200] (-1269.382) (-1268.044) * (-1267.007) (-1270.078) (-1272.454) [-1267.153] -- 0:01:00
      62500 -- (-1270.633) (-1268.736) (-1270.209) [-1271.661] * (-1266.475) (-1270.374) (-1267.977) [-1265.744] -- 0:01:00
      63000 -- (-1271.175) (-1268.799) [-1269.051] (-1269.504) * [-1266.091] (-1267.146) (-1269.963) (-1271.216) -- 0:00:59
      63500 -- (-1271.890) (-1269.433) [-1266.001] (-1269.177) * [-1267.360] (-1276.428) (-1270.466) (-1270.285) -- 0:00:58
      64000 -- (-1269.232) (-1267.763) (-1266.527) [-1270.965] * (-1267.466) (-1271.139) [-1267.518] (-1270.854) -- 0:00:58
      64500 -- [-1267.711] (-1273.824) (-1266.470) (-1271.447) * [-1267.176] (-1270.710) (-1269.029) (-1270.501) -- 0:00:58
      65000 -- (-1268.956) (-1268.906) [-1268.725] (-1269.736) * (-1269.231) [-1269.996] (-1268.376) (-1267.472) -- 0:00:57

      Average standard deviation of split frequencies: 0.019642

      65500 -- (-1266.814) (-1267.920) (-1267.011) [-1268.313] * [-1270.643] (-1268.155) (-1269.569) (-1266.664) -- 0:00:57
      66000 -- (-1266.776) [-1266.929] (-1267.448) (-1272.553) * (-1269.376) (-1269.324) [-1268.396] (-1267.595) -- 0:00:56
      66500 -- (-1267.062) [-1266.215] (-1266.017) (-1269.051) * [-1267.289] (-1269.452) (-1272.714) (-1268.904) -- 0:00:56
      67000 -- [-1266.481] (-1267.259) (-1266.543) (-1267.437) * (-1271.064) (-1269.774) (-1273.223) [-1268.095] -- 0:00:55
      67500 -- (-1267.248) (-1266.511) (-1270.005) [-1266.903] * (-1268.597) (-1266.373) [-1271.922] (-1270.084) -- 0:00:55
      68000 -- (-1266.316) [-1267.256] (-1266.245) (-1268.587) * (-1268.038) (-1269.180) [-1269.477] (-1272.747) -- 0:00:54
      68500 -- [-1266.410] (-1266.490) (-1266.247) (-1269.124) * [-1268.513] (-1266.177) (-1268.423) (-1267.246) -- 0:00:54
      69000 -- [-1266.790] (-1267.371) (-1267.326) (-1268.507) * (-1270.185) (-1268.496) [-1267.742] (-1271.326) -- 0:00:53
      69500 -- (-1266.269) (-1267.778) [-1269.328] (-1269.102) * (-1270.533) (-1270.362) (-1268.010) [-1268.544] -- 0:00:53
      70000 -- (-1268.430) (-1266.329) (-1273.144) [-1268.402] * [-1273.025] (-1270.626) (-1271.406) (-1268.170) -- 0:00:53

      Average standard deviation of split frequencies: 0.020346

      70500 -- (-1268.376) [-1267.345] (-1270.103) (-1267.950) * (-1268.341) (-1269.397) [-1268.162] (-1267.682) -- 0:01:05
      71000 -- (-1267.480) (-1271.643) (-1269.116) [-1268.841] * (-1268.398) (-1268.386) (-1268.692) [-1267.714] -- 0:01:05
      71500 -- (-1268.814) (-1268.889) [-1268.664] (-1269.068) * (-1266.600) (-1269.638) [-1268.421] (-1268.156) -- 0:01:04
      72000 -- (-1267.857) (-1268.731) (-1267.098) [-1267.390] * (-1267.037) (-1267.639) (-1271.333) [-1268.157] -- 0:01:04
      72500 -- (-1269.549) (-1269.257) [-1268.582] (-1269.358) * (-1272.145) (-1266.535) [-1270.289] (-1268.746) -- 0:01:03
      73000 -- [-1267.223] (-1270.737) (-1267.066) (-1274.109) * (-1273.370) (-1268.275) (-1276.135) [-1266.965] -- 0:01:03
      73500 -- (-1266.801) (-1271.065) [-1266.976] (-1267.588) * [-1266.390] (-1270.516) (-1275.256) (-1270.566) -- 0:01:03
      74000 -- (-1268.990) (-1270.706) [-1270.415] (-1268.430) * (-1267.130) (-1272.716) (-1278.422) [-1267.255] -- 0:01:02
      74500 -- (-1269.335) [-1269.065] (-1266.171) (-1276.359) * [-1267.348] (-1272.539) (-1280.807) (-1270.020) -- 0:01:02
      75000 -- (-1266.304) (-1267.987) (-1266.274) [-1266.899] * (-1267.487) (-1269.340) (-1272.528) [-1268.349] -- 0:01:01

      Average standard deviation of split frequencies: 0.022020

      75500 -- (-1266.917) (-1267.464) (-1267.513) [-1267.399] * (-1270.716) [-1272.043] (-1268.220) (-1269.721) -- 0:01:01
      76000 -- (-1269.647) (-1268.922) (-1267.716) [-1267.546] * (-1268.832) [-1272.932] (-1269.605) (-1266.748) -- 0:01:00
      76500 -- (-1270.065) (-1268.567) [-1267.775] (-1270.214) * (-1268.803) (-1268.884) (-1269.408) [-1268.211] -- 0:01:00
      77000 -- (-1269.225) [-1268.176] (-1268.622) (-1266.950) * (-1270.327) (-1275.526) [-1268.788] (-1267.213) -- 0:00:59
      77500 -- (-1272.574) [-1269.781] (-1268.287) (-1269.550) * [-1268.561] (-1271.355) (-1267.203) (-1267.377) -- 0:00:59
      78000 -- (-1270.195) (-1269.483) [-1268.269] (-1267.902) * (-1267.622) (-1266.660) [-1268.126] (-1272.080) -- 0:00:59
      78500 -- (-1268.921) (-1266.957) [-1267.417] (-1269.409) * [-1267.492] (-1269.498) (-1270.195) (-1273.835) -- 0:00:58
      79000 -- (-1269.407) [-1266.179] (-1268.085) (-1268.471) * (-1266.982) [-1268.719] (-1272.885) (-1273.267) -- 0:00:58
      79500 -- (-1270.168) (-1268.858) (-1268.519) [-1267.255] * (-1267.097) (-1270.561) [-1268.645] (-1269.482) -- 0:00:57
      80000 -- [-1269.169] (-1268.334) (-1267.549) (-1269.258) * (-1270.679) [-1268.149] (-1266.466) (-1268.702) -- 0:00:57

      Average standard deviation of split frequencies: 0.018454

      80500 -- (-1267.611) (-1266.893) [-1268.919] (-1266.458) * (-1266.948) (-1266.283) [-1267.310] (-1268.939) -- 0:00:57
      81000 -- (-1266.567) [-1266.952] (-1267.212) (-1268.060) * (-1266.496) (-1266.931) [-1269.761] (-1267.545) -- 0:00:56
      81500 -- (-1268.315) [-1267.852] (-1266.767) (-1267.482) * [-1266.167] (-1266.927) (-1269.200) (-1267.603) -- 0:00:56
      82000 -- (-1268.075) (-1268.901) (-1266.233) [-1266.570] * (-1267.663) (-1268.743) (-1268.860) [-1267.104] -- 0:00:55
      82500 -- (-1269.003) (-1267.641) [-1267.831] (-1269.569) * (-1268.961) (-1266.802) [-1267.490] (-1266.699) -- 0:00:55
      83000 -- (-1267.048) (-1272.731) [-1266.786] (-1267.770) * (-1266.899) [-1266.857] (-1266.141) (-1267.906) -- 0:00:55
      83500 -- (-1266.682) (-1267.564) [-1267.661] (-1268.214) * (-1266.825) (-1273.595) [-1269.029] (-1269.238) -- 0:00:54
      84000 -- (-1268.846) [-1266.882] (-1266.238) (-1271.345) * (-1267.795) (-1267.593) [-1267.524] (-1267.776) -- 0:00:54
      84500 -- (-1268.735) (-1269.352) [-1268.506] (-1271.277) * (-1268.851) (-1267.933) [-1270.006] (-1268.116) -- 0:00:54
      85000 -- (-1266.789) (-1268.845) [-1269.057] (-1270.012) * (-1267.582) [-1267.110] (-1269.786) (-1265.843) -- 0:00:53

      Average standard deviation of split frequencies: 0.018936

      85500 -- (-1266.068) (-1274.853) [-1269.134] (-1270.411) * (-1266.637) [-1266.093] (-1268.454) (-1269.657) -- 0:00:53
      86000 -- (-1268.366) (-1272.308) (-1266.280) [-1268.486] * (-1266.870) [-1268.639] (-1268.638) (-1270.003) -- 0:01:03
      86500 -- (-1268.184) [-1268.955] (-1270.642) (-1268.893) * (-1271.538) [-1267.581] (-1269.289) (-1265.873) -- 0:01:03
      87000 -- (-1269.649) (-1268.102) (-1273.259) [-1268.735] * (-1266.038) [-1267.320] (-1269.731) (-1271.197) -- 0:01:02
      87500 -- (-1269.890) (-1268.396) (-1271.282) [-1268.471] * (-1267.021) [-1267.377] (-1271.563) (-1271.072) -- 0:01:02
      88000 -- (-1271.606) (-1270.897) [-1268.314] (-1268.555) * (-1266.746) (-1266.377) [-1270.934] (-1269.168) -- 0:01:02
      88500 -- (-1269.152) [-1268.569] (-1268.380) (-1274.626) * [-1266.745] (-1266.970) (-1267.285) (-1270.273) -- 0:01:01
      89000 -- (-1267.866) (-1267.618) [-1271.112] (-1269.994) * (-1266.339) [-1269.078] (-1267.665) (-1268.313) -- 0:01:01
      89500 -- (-1267.362) (-1266.286) [-1268.078] (-1268.703) * [-1265.752] (-1268.584) (-1269.652) (-1265.975) -- 0:01:01
      90000 -- (-1268.728) [-1268.385] (-1266.861) (-1269.016) * (-1267.957) [-1269.741] (-1266.954) (-1268.525) -- 0:01:00

      Average standard deviation of split frequencies: 0.022617

      90500 -- (-1268.779) (-1266.552) [-1267.330] (-1266.791) * (-1267.739) [-1270.837] (-1267.459) (-1266.443) -- 0:01:00
      91000 -- [-1269.080] (-1266.714) (-1268.269) (-1268.670) * (-1268.698) (-1269.638) (-1268.203) [-1267.360] -- 0:00:59
      91500 -- (-1268.342) (-1267.230) [-1268.080] (-1271.223) * (-1267.036) (-1270.409) (-1268.719) [-1269.403] -- 0:00:59
      92000 -- (-1268.221) [-1267.367] (-1270.180) (-1268.964) * (-1268.059) [-1267.831] (-1267.507) (-1267.150) -- 0:00:59
      92500 -- (-1267.064) (-1267.422) (-1268.752) [-1268.216] * [-1268.973] (-1267.020) (-1266.920) (-1267.661) -- 0:00:58
      93000 -- (-1266.299) (-1267.989) [-1265.997] (-1267.347) * (-1270.250) (-1268.770) (-1268.942) [-1267.653] -- 0:00:58
      93500 -- [-1266.229] (-1266.791) (-1267.049) (-1267.402) * (-1269.757) (-1269.885) (-1267.180) [-1266.909] -- 0:00:58
      94000 -- (-1267.086) [-1267.422] (-1267.186) (-1268.169) * (-1269.068) (-1271.865) (-1268.189) [-1267.938] -- 0:00:57
      94500 -- [-1266.132] (-1267.117) (-1267.076) (-1269.891) * [-1268.576] (-1267.252) (-1268.854) (-1267.729) -- 0:00:57
      95000 -- (-1270.571) (-1266.681) [-1268.015] (-1276.046) * [-1268.875] (-1267.994) (-1268.008) (-1268.652) -- 0:00:57

      Average standard deviation of split frequencies: 0.019900

      95500 -- (-1269.660) (-1268.930) (-1266.466) [-1272.337] * (-1269.429) (-1270.909) (-1268.759) [-1267.011] -- 0:00:56
      96000 -- (-1267.748) [-1270.385] (-1266.264) (-1268.278) * [-1268.726] (-1266.121) (-1270.732) (-1265.867) -- 0:00:56
      96500 -- (-1273.253) (-1271.490) [-1269.512] (-1270.899) * (-1267.805) (-1269.471) (-1269.402) [-1267.048] -- 0:00:56
      97000 -- (-1266.965) (-1268.358) [-1270.954] (-1268.661) * [-1270.695] (-1269.821) (-1267.816) (-1269.753) -- 0:00:55
      97500 -- (-1268.632) (-1269.566) [-1267.718] (-1268.365) * [-1267.046] (-1267.539) (-1269.723) (-1269.228) -- 0:00:55
      98000 -- (-1268.811) [-1269.838] (-1267.430) (-1268.214) * (-1271.025) [-1268.112] (-1267.355) (-1267.716) -- 0:00:55
      98500 -- (-1269.692) (-1267.992) [-1266.425] (-1266.699) * (-1267.049) (-1266.265) [-1266.676] (-1267.715) -- 0:00:54
      99000 -- (-1271.025) (-1268.315) [-1266.489] (-1269.154) * (-1267.556) (-1266.265) (-1267.860) [-1266.966] -- 0:00:54
      99500 -- (-1270.107) (-1271.606) (-1266.754) [-1272.522] * (-1271.381) (-1266.939) [-1268.227] (-1267.314) -- 0:00:54
      100000 -- (-1271.466) (-1270.605) (-1266.462) [-1267.161] * [-1268.639] (-1270.421) (-1266.782) (-1267.246) -- 0:00:54

      Average standard deviation of split frequencies: 0.017253

      100500 -- (-1274.013) (-1266.867) [-1269.685] (-1266.889) * (-1270.029) (-1268.719) (-1268.620) [-1268.163] -- 0:00:53
      101000 -- (-1276.495) (-1268.586) (-1273.166) [-1269.480] * [-1268.461] (-1267.580) (-1267.639) (-1268.761) -- 0:00:53
      101500 -- (-1269.061) (-1270.427) [-1268.485] (-1266.449) * [-1268.495] (-1266.931) (-1268.197) (-1267.528) -- 0:01:01
      102000 -- (-1268.226) (-1265.890) [-1272.088] (-1267.445) * (-1269.242) (-1266.728) [-1267.948] (-1270.597) -- 0:01:01
      102500 -- [-1266.953] (-1268.112) (-1268.164) (-1267.301) * (-1270.980) (-1267.493) [-1271.401] (-1269.941) -- 0:01:01
      103000 -- (-1267.243) (-1266.465) [-1269.054] (-1266.121) * (-1269.777) (-1266.607) [-1271.251] (-1269.983) -- 0:01:00
      103500 -- [-1267.062] (-1266.293) (-1265.880) (-1269.745) * (-1268.252) [-1267.245] (-1266.693) (-1268.877) -- 0:01:00
      104000 -- (-1270.525) [-1267.625] (-1266.647) (-1268.471) * (-1267.053) [-1269.127] (-1267.863) (-1269.916) -- 0:01:00
      104500 -- (-1271.622) [-1268.920] (-1275.787) (-1269.314) * (-1267.193) (-1267.743) [-1267.809] (-1265.934) -- 0:00:59
      105000 -- (-1269.971) [-1269.695] (-1272.312) (-1268.876) * [-1266.137] (-1269.975) (-1266.741) (-1271.168) -- 0:00:59

      Average standard deviation of split frequencies: 0.018001

      105500 -- [-1270.782] (-1268.992) (-1268.910) (-1270.089) * (-1266.917) (-1267.090) [-1267.935] (-1270.397) -- 0:00:59
      106000 -- (-1269.873) (-1269.520) (-1267.399) [-1269.876] * [-1266.921] (-1266.559) (-1274.078) (-1268.916) -- 0:00:59
      106500 -- (-1268.303) (-1270.564) [-1267.137] (-1274.094) * [-1266.696] (-1267.220) (-1268.871) (-1269.353) -- 0:00:58
      107000 -- (-1268.137) (-1271.647) [-1267.050] (-1270.786) * [-1267.605] (-1267.627) (-1267.283) (-1270.367) -- 0:00:58
      107500 -- (-1268.552) (-1276.395) (-1266.968) [-1269.803] * [-1269.211] (-1266.758) (-1266.878) (-1266.561) -- 0:00:58
      108000 -- (-1268.282) (-1266.822) [-1270.724] (-1268.149) * (-1270.472) [-1268.125] (-1268.308) (-1266.920) -- 0:00:57
      108500 -- (-1269.679) (-1268.255) [-1272.600] (-1270.579) * (-1268.809) [-1269.919] (-1268.296) (-1266.806) -- 0:00:57
      109000 -- [-1268.962] (-1269.392) (-1268.786) (-1270.268) * [-1267.043] (-1271.445) (-1270.331) (-1267.339) -- 0:00:57
      109500 -- (-1271.135) (-1267.896) (-1267.943) [-1268.486] * (-1266.518) (-1269.085) [-1268.321] (-1267.840) -- 0:00:56
      110000 -- (-1273.211) [-1272.154] (-1269.949) (-1267.033) * (-1268.878) (-1268.740) [-1266.894] (-1267.882) -- 0:00:56

      Average standard deviation of split frequencies: 0.018781

      110500 -- [-1269.988] (-1268.664) (-1269.093) (-1267.240) * (-1265.980) [-1268.669] (-1268.184) (-1268.375) -- 0:00:56
      111000 -- (-1267.861) [-1268.396] (-1269.351) (-1268.757) * (-1265.928) (-1272.590) [-1266.855] (-1267.093) -- 0:00:56
      111500 -- (-1272.337) [-1269.298] (-1269.912) (-1267.467) * (-1267.291) [-1270.209] (-1266.866) (-1268.039) -- 0:00:55
      112000 -- [-1266.318] (-1268.456) (-1275.258) (-1269.685) * [-1266.743] (-1270.357) (-1267.996) (-1267.337) -- 0:00:55
      112500 -- [-1267.054] (-1266.757) (-1271.188) (-1270.507) * (-1267.179) [-1269.774] (-1266.973) (-1267.526) -- 0:00:55
      113000 -- [-1267.097] (-1267.563) (-1271.856) (-1271.252) * (-1267.154) [-1267.448] (-1268.265) (-1273.288) -- 0:00:54
      113500 -- (-1266.788) [-1267.650] (-1271.564) (-1269.649) * (-1266.657) [-1267.894] (-1266.265) (-1270.227) -- 0:00:54
      114000 -- (-1265.889) (-1268.517) (-1268.404) [-1269.602] * [-1267.041] (-1268.300) (-1267.729) (-1270.337) -- 0:00:54
      114500 -- (-1268.895) (-1267.530) [-1266.482] (-1272.632) * (-1268.092) [-1266.731] (-1267.093) (-1270.975) -- 0:00:54
      115000 -- [-1267.843] (-1269.048) (-1266.151) (-1268.570) * [-1267.614] (-1266.524) (-1268.286) (-1270.953) -- 0:00:53

      Average standard deviation of split frequencies: 0.019464

      115500 -- (-1266.044) (-1267.801) [-1266.609] (-1272.158) * [-1267.770] (-1267.410) (-1267.065) (-1269.452) -- 0:00:53
      116000 -- (-1266.196) (-1269.505) (-1266.597) [-1269.554] * (-1269.602) (-1270.435) [-1265.846] (-1268.988) -- 0:01:00
      116500 -- (-1266.276) (-1272.735) (-1267.499) [-1271.473] * (-1266.621) [-1268.512] (-1266.180) (-1266.849) -- 0:01:00
      117000 -- [-1266.276] (-1266.300) (-1266.171) (-1270.379) * [-1266.356] (-1268.669) (-1267.875) (-1267.513) -- 0:01:00
      117500 -- (-1266.276) [-1266.643] (-1266.714) (-1269.180) * (-1266.496) [-1267.959] (-1266.575) (-1268.260) -- 0:01:00
      118000 -- (-1266.665) (-1268.747) (-1267.248) [-1267.521] * (-1269.933) (-1267.962) [-1267.761] (-1273.784) -- 0:00:59
      118500 -- (-1268.066) [-1267.121] (-1267.615) (-1270.431) * (-1269.860) [-1269.462] (-1269.310) (-1267.188) -- 0:00:59
      119000 -- (-1267.269) (-1267.651) (-1270.663) [-1272.853] * (-1267.438) [-1269.992] (-1269.194) (-1267.172) -- 0:00:59
      119500 -- (-1267.748) [-1268.776] (-1271.689) (-1270.149) * [-1267.942] (-1268.445) (-1270.273) (-1269.139) -- 0:00:58
      120000 -- (-1266.901) (-1269.017) (-1266.837) [-1269.527] * (-1266.217) (-1266.557) (-1267.175) [-1268.764] -- 0:00:58

      Average standard deviation of split frequencies: 0.019533

      120500 -- (-1269.700) [-1268.576] (-1267.331) (-1273.790) * (-1267.171) (-1266.483) [-1267.595] (-1270.452) -- 0:00:58
      121000 -- [-1269.691] (-1267.591) (-1267.768) (-1267.209) * (-1267.658) (-1267.959) (-1267.525) [-1268.023] -- 0:00:58
      121500 -- [-1267.548] (-1270.313) (-1269.074) (-1267.260) * [-1268.570] (-1267.098) (-1267.600) (-1267.695) -- 0:00:57
      122000 -- (-1271.837) [-1267.568] (-1269.673) (-1272.793) * (-1266.325) [-1268.750] (-1267.221) (-1268.081) -- 0:00:57
      122500 -- [-1268.999] (-1268.211) (-1268.511) (-1270.793) * (-1268.341) (-1266.898) (-1266.961) [-1269.530] -- 0:00:57
      123000 -- (-1269.400) (-1268.729) (-1267.666) [-1269.141] * (-1271.106) [-1267.922] (-1267.518) (-1268.745) -- 0:00:57
      123500 -- [-1268.451] (-1269.003) (-1268.546) (-1267.908) * [-1267.365] (-1269.830) (-1271.973) (-1268.473) -- 0:00:56
      124000 -- (-1268.333) (-1268.379) (-1269.783) [-1269.016] * [-1267.261] (-1268.834) (-1268.181) (-1267.095) -- 0:00:56
      124500 -- (-1268.396) (-1267.254) (-1271.634) [-1267.559] * [-1267.995] (-1269.709) (-1266.917) (-1268.111) -- 0:00:56
      125000 -- (-1267.876) (-1268.356) [-1266.591] (-1269.960) * (-1272.011) (-1270.430) [-1267.173] (-1267.428) -- 0:00:56

      Average standard deviation of split frequencies: 0.018519

      125500 -- [-1268.738] (-1268.302) (-1266.773) (-1267.943) * (-1266.734) (-1272.054) [-1268.181] (-1267.153) -- 0:00:55
      126000 -- (-1269.881) (-1270.424) (-1269.048) [-1271.070] * (-1267.292) (-1269.154) [-1268.171] (-1266.426) -- 0:00:55
      126500 -- (-1272.620) [-1270.841] (-1268.118) (-1271.383) * (-1267.587) [-1274.918] (-1268.710) (-1266.393) -- 0:00:55
      127000 -- [-1266.799] (-1266.939) (-1268.237) (-1266.966) * (-1269.288) (-1268.763) [-1267.216] (-1266.364) -- 0:00:54
      127500 -- [-1266.987] (-1266.615) (-1266.016) (-1269.201) * [-1268.579] (-1272.001) (-1274.969) (-1267.306) -- 0:00:54
      128000 -- (-1268.136) (-1267.430) [-1267.222] (-1267.724) * (-1270.133) [-1266.930] (-1268.049) (-1267.306) -- 0:00:54
      128500 -- (-1267.945) (-1272.240) [-1267.971] (-1268.043) * (-1267.544) (-1268.248) (-1267.553) [-1266.226] -- 0:00:54
      129000 -- (-1269.109) (-1268.621) [-1267.988] (-1266.736) * [-1266.950] (-1268.536) (-1270.502) (-1266.438) -- 0:00:54
      129500 -- [-1267.117] (-1267.307) (-1270.429) (-1266.907) * [-1270.412] (-1266.018) (-1269.408) (-1267.217) -- 0:00:53
      130000 -- (-1267.633) (-1269.145) (-1266.992) [-1269.447] * (-1267.127) [-1266.382] (-1269.178) (-1266.827) -- 0:00:53

      Average standard deviation of split frequencies: 0.017638

      130500 -- [-1267.833] (-1268.349) (-1267.773) (-1267.126) * (-1267.535) [-1266.365] (-1268.577) (-1266.517) -- 0:00:59
      131000 -- (-1268.182) (-1267.644) (-1267.945) [-1266.368] * (-1267.780) [-1266.140] (-1267.171) (-1266.983) -- 0:00:59
      131500 -- (-1266.232) (-1270.694) [-1268.294] (-1266.236) * (-1266.723) [-1269.455] (-1266.423) (-1267.241) -- 0:00:59
      132000 -- (-1269.085) [-1267.608] (-1269.033) (-1271.702) * (-1266.598) (-1267.366) [-1267.878] (-1266.399) -- 0:00:59
      132500 -- (-1270.204) (-1266.333) (-1266.705) [-1269.792] * (-1266.695) (-1266.887) [-1267.723] (-1266.543) -- 0:00:58
      133000 -- (-1267.974) [-1266.527] (-1269.042) (-1268.821) * [-1267.858] (-1267.501) (-1268.889) (-1266.541) -- 0:00:58
      133500 -- (-1266.841) [-1266.122] (-1267.469) (-1269.661) * [-1267.663] (-1269.003) (-1268.956) (-1270.417) -- 0:00:58
      134000 -- (-1268.457) (-1266.119) [-1267.368] (-1268.318) * (-1268.784) [-1267.101] (-1269.289) (-1267.740) -- 0:00:58
      134500 -- (-1271.471) [-1266.733] (-1266.550) (-1269.319) * [-1270.578] (-1267.674) (-1270.061) (-1267.283) -- 0:00:57
      135000 -- (-1266.161) [-1267.227] (-1268.916) (-1267.606) * (-1272.049) (-1266.675) (-1267.075) [-1267.149] -- 0:00:57

      Average standard deviation of split frequencies: 0.017716

      135500 -- (-1266.641) (-1267.154) (-1269.160) [-1270.754] * (-1272.255) (-1266.651) [-1266.912] (-1268.399) -- 0:00:57
      136000 -- (-1269.212) [-1266.910] (-1274.181) (-1272.757) * (-1269.785) (-1267.842) [-1267.402] (-1270.753) -- 0:00:57
      136500 -- (-1268.357) (-1269.905) (-1273.156) [-1271.638] * [-1268.646] (-1266.535) (-1269.622) (-1269.411) -- 0:00:56
      137000 -- [-1268.553] (-1268.104) (-1271.327) (-1270.157) * (-1269.490) (-1266.739) (-1266.456) [-1270.844] -- 0:00:56
      137500 -- [-1269.469] (-1271.198) (-1271.491) (-1270.920) * (-1271.071) (-1267.886) (-1270.034) [-1267.174] -- 0:00:56
      138000 -- (-1269.558) (-1272.629) (-1269.585) [-1267.517] * (-1267.455) [-1268.120] (-1272.143) (-1267.742) -- 0:00:56
      138500 -- (-1271.523) (-1267.203) (-1268.677) [-1266.929] * (-1268.721) [-1269.858] (-1267.108) (-1268.600) -- 0:00:55
      139000 -- [-1266.179] (-1267.926) (-1266.762) (-1267.862) * (-1267.648) (-1268.056) (-1268.451) [-1267.760] -- 0:00:55
      139500 -- [-1266.370] (-1268.872) (-1267.150) (-1267.547) * (-1267.534) (-1268.465) (-1267.590) [-1266.193] -- 0:00:55
      140000 -- (-1267.886) [-1267.939] (-1271.820) (-1270.838) * (-1266.965) (-1266.197) (-1266.268) [-1266.287] -- 0:00:55

      Average standard deviation of split frequencies: 0.019225

      140500 -- (-1267.068) [-1268.199] (-1266.272) (-1272.878) * [-1267.463] (-1268.286) (-1266.584) (-1267.779) -- 0:00:55
      141000 -- (-1270.034) (-1267.751) (-1265.987) [-1270.111] * [-1267.096] (-1271.330) (-1269.249) (-1266.365) -- 0:00:54
      141500 -- [-1267.280] (-1268.239) (-1266.951) (-1269.016) * (-1267.877) (-1266.687) [-1270.054] (-1267.624) -- 0:00:54
      142000 -- [-1268.604] (-1267.325) (-1272.531) (-1269.019) * (-1267.280) [-1266.624] (-1269.325) (-1265.992) -- 0:00:54
      142500 -- (-1270.072) (-1270.921) (-1267.380) [-1268.182] * (-1265.834) (-1270.419) [-1272.416] (-1268.412) -- 0:00:54
      143000 -- (-1268.237) (-1267.825) (-1267.847) [-1269.119] * [-1267.686] (-1269.531) (-1268.102) (-1269.051) -- 0:00:53
      143500 -- (-1267.190) (-1268.378) (-1270.752) [-1268.952] * (-1268.484) (-1271.963) (-1267.618) [-1269.922] -- 0:00:53
      144000 -- [-1268.862] (-1268.479) (-1270.014) (-1269.198) * (-1267.040) [-1268.375] (-1266.097) (-1269.815) -- 0:00:53
      144500 -- (-1270.393) [-1267.315] (-1270.665) (-1268.695) * (-1266.943) (-1268.927) [-1268.885] (-1266.993) -- 0:00:53
      145000 -- [-1267.313] (-1268.990) (-1269.582) (-1269.113) * (-1271.374) [-1267.029] (-1270.728) (-1267.521) -- 0:00:58

      Average standard deviation of split frequencies: 0.018183

      145500 -- (-1267.266) [-1268.465] (-1269.026) (-1268.982) * (-1271.430) [-1267.115] (-1270.706) (-1268.182) -- 0:00:58
      146000 -- [-1267.591] (-1266.390) (-1266.788) (-1268.122) * (-1266.754) [-1269.618] (-1268.865) (-1269.643) -- 0:00:58
      146500 -- (-1270.354) [-1269.285] (-1271.207) (-1266.513) * (-1266.807) [-1267.810] (-1269.492) (-1266.826) -- 0:00:58
      147000 -- [-1268.069] (-1267.380) (-1268.319) (-1266.733) * (-1268.063) (-1269.832) (-1267.805) [-1267.361] -- 0:00:58
      147500 -- (-1267.608) (-1269.933) [-1267.367] (-1268.596) * (-1267.805) (-1266.068) [-1266.777] (-1267.590) -- 0:00:57
      148000 -- [-1267.541] (-1268.374) (-1268.306) (-1268.969) * (-1266.738) (-1266.947) [-1267.570] (-1267.352) -- 0:00:57
      148500 -- (-1266.901) (-1266.899) (-1268.512) [-1266.596] * (-1268.108) (-1271.062) [-1267.860] (-1271.788) -- 0:00:57
      149000 -- [-1269.458] (-1267.307) (-1267.707) (-1266.820) * (-1270.786) [-1266.687] (-1269.962) (-1272.631) -- 0:00:57
      149500 -- (-1269.744) [-1267.307] (-1271.053) (-1267.273) * [-1266.371] (-1270.137) (-1267.967) (-1267.410) -- 0:00:56
      150000 -- (-1269.221) (-1266.265) [-1266.537] (-1279.071) * [-1266.450] (-1269.217) (-1268.914) (-1268.264) -- 0:00:56

      Average standard deviation of split frequencies: 0.016961

      150500 -- (-1268.019) [-1266.061] (-1266.030) (-1267.261) * (-1269.956) [-1268.244] (-1273.122) (-1268.325) -- 0:00:56
      151000 -- (-1270.524) (-1266.064) (-1269.139) [-1267.457] * (-1267.978) (-1269.463) (-1273.466) [-1269.119] -- 0:00:56
      151500 -- (-1269.423) (-1266.122) [-1266.465] (-1267.823) * [-1270.608] (-1267.052) (-1278.353) (-1268.189) -- 0:00:56
      152000 -- (-1270.403) (-1269.517) (-1266.306) [-1267.671] * (-1272.626) (-1269.303) [-1271.241] (-1272.328) -- 0:00:55
      152500 -- [-1269.684] (-1266.795) (-1266.610) (-1270.232) * (-1267.576) (-1266.326) (-1269.782) [-1270.080] -- 0:00:55
      153000 -- (-1268.772) [-1266.964] (-1268.299) (-1268.562) * [-1269.117] (-1266.750) (-1265.968) (-1270.142) -- 0:00:55
      153500 -- (-1270.338) (-1270.642) (-1267.558) [-1268.129] * [-1268.380] (-1266.931) (-1266.043) (-1266.772) -- 0:00:55
      154000 -- (-1272.424) (-1271.820) [-1267.560] (-1267.995) * [-1267.645] (-1269.706) (-1265.992) (-1269.145) -- 0:00:54
      154500 -- [-1267.972] (-1267.323) (-1268.046) (-1269.071) * [-1267.011] (-1270.771) (-1266.018) (-1267.491) -- 0:00:54
      155000 -- (-1273.671) (-1269.221) (-1269.029) [-1267.177] * (-1268.674) (-1270.802) (-1266.262) [-1270.483] -- 0:00:54

      Average standard deviation of split frequencies: 0.016381

      155500 -- (-1269.616) (-1271.900) [-1268.839] (-1266.396) * (-1269.271) (-1267.291) [-1266.970] (-1270.313) -- 0:00:54
      156000 -- [-1266.483] (-1269.340) (-1273.262) (-1266.530) * (-1274.226) (-1266.991) (-1266.970) [-1272.334] -- 0:00:54
      156500 -- (-1270.106) (-1270.198) (-1267.448) [-1266.060] * (-1268.351) (-1267.697) [-1268.875] (-1269.909) -- 0:00:53
      157000 -- (-1267.723) (-1267.377) [-1267.449] (-1268.080) * [-1268.376] (-1267.115) (-1267.329) (-1274.041) -- 0:00:53
      157500 -- (-1266.724) (-1268.389) (-1269.929) [-1268.573] * [-1267.464] (-1266.749) (-1266.852) (-1269.111) -- 0:00:53
      158000 -- (-1266.904) (-1270.599) (-1267.481) [-1268.482] * (-1267.734) [-1267.122] (-1266.360) (-1269.487) -- 0:00:53
      158500 -- (-1267.381) (-1267.552) (-1267.185) [-1265.862] * (-1266.545) (-1274.830) (-1266.743) [-1267.312] -- 0:00:53
      159000 -- (-1266.425) [-1268.187] (-1267.215) (-1266.469) * [-1269.695] (-1274.949) (-1267.905) (-1270.179) -- 0:00:58
      159500 -- (-1267.355) [-1265.926] (-1267.266) (-1266.442) * (-1266.830) [-1268.067] (-1269.573) (-1268.545) -- 0:00:57
      160000 -- (-1267.687) (-1267.255) [-1267.491] (-1268.059) * (-1267.791) (-1267.227) [-1269.831] (-1266.291) -- 0:00:57

      Average standard deviation of split frequencies: 0.016369

      160500 -- (-1273.845) [-1266.402] (-1267.549) (-1268.474) * (-1269.219) (-1270.895) (-1267.470) [-1266.454] -- 0:00:57
      161000 -- (-1273.619) (-1266.848) [-1270.457] (-1272.583) * (-1271.847) (-1269.544) (-1269.192) [-1269.182] -- 0:00:57
      161500 -- (-1269.634) (-1267.070) [-1268.144] (-1272.096) * (-1269.164) (-1267.061) [-1268.179] (-1267.743) -- 0:00:57
      162000 -- (-1268.037) (-1266.983) [-1266.521] (-1269.071) * (-1267.393) (-1267.565) [-1269.270] (-1267.137) -- 0:00:56
      162500 -- (-1269.039) [-1267.512] (-1267.953) (-1269.505) * (-1268.643) (-1270.234) (-1270.370) [-1266.755] -- 0:00:56
      163000 -- (-1267.264) [-1271.300] (-1268.190) (-1267.989) * (-1266.451) (-1270.983) [-1268.013] (-1268.474) -- 0:00:56
      163500 -- (-1267.788) (-1272.121) (-1268.305) [-1268.025] * (-1269.450) [-1268.115] (-1265.941) (-1269.892) -- 0:00:56
      164000 -- (-1269.944) (-1269.679) [-1267.177] (-1268.077) * (-1268.028) (-1271.633) (-1267.583) [-1270.175] -- 0:00:56
      164500 -- (-1266.145) [-1270.613] (-1267.668) (-1270.598) * (-1271.386) (-1272.731) [-1271.015] (-1268.539) -- 0:00:55
      165000 -- [-1267.009] (-1266.673) (-1269.919) (-1269.040) * (-1269.315) (-1268.284) (-1268.206) [-1267.463] -- 0:00:55

      Average standard deviation of split frequencies: 0.016471

      165500 -- (-1269.871) (-1266.431) (-1270.049) [-1267.023] * [-1272.779] (-1270.847) (-1268.897) (-1267.050) -- 0:00:55
      166000 -- [-1272.744] (-1266.116) (-1268.550) (-1267.010) * [-1267.842] (-1270.779) (-1268.588) (-1269.917) -- 0:00:55
      166500 -- [-1271.463] (-1267.452) (-1271.377) (-1269.282) * (-1267.528) (-1268.650) (-1268.588) [-1267.796] -- 0:00:55
      167000 -- (-1267.380) [-1269.028] (-1273.503) (-1266.876) * (-1267.418) [-1267.322] (-1267.722) (-1267.740) -- 0:00:54
      167500 -- (-1267.792) (-1268.561) (-1267.276) [-1266.597] * (-1267.505) [-1268.483] (-1270.143) (-1266.823) -- 0:00:54
      168000 -- [-1266.108] (-1269.273) (-1267.597) (-1268.333) * (-1267.911) (-1271.982) (-1269.076) [-1268.860] -- 0:00:54
      168500 -- (-1266.123) (-1269.128) (-1268.774) [-1267.658] * [-1269.076] (-1276.168) (-1267.513) (-1269.593) -- 0:00:54
      169000 -- (-1267.319) [-1267.272] (-1267.116) (-1271.594) * (-1270.847) (-1269.436) (-1269.628) [-1265.815] -- 0:00:54
      169500 -- (-1267.311) (-1267.282) [-1269.159] (-1269.612) * [-1268.937] (-1270.289) (-1272.820) (-1268.931) -- 0:00:53
      170000 -- [-1265.887] (-1267.713) (-1270.068) (-1269.467) * (-1269.188) (-1270.147) [-1268.170] (-1272.768) -- 0:00:53

      Average standard deviation of split frequencies: 0.015991

      170500 -- (-1265.922) (-1267.541) [-1268.597] (-1275.757) * (-1270.489) [-1271.727] (-1268.453) (-1272.009) -- 0:00:53
      171000 -- [-1265.827] (-1267.273) (-1268.104) (-1269.314) * (-1271.116) (-1269.475) [-1268.687] (-1267.463) -- 0:00:53
      171500 -- (-1266.035) [-1268.203] (-1269.739) (-1268.602) * (-1271.497) [-1270.219] (-1267.003) (-1269.040) -- 0:00:53
      172000 -- (-1267.103) (-1270.203) [-1272.564] (-1271.632) * (-1267.959) (-1268.369) [-1267.817] (-1268.184) -- 0:00:52
      172500 -- (-1266.448) [-1267.897] (-1270.395) (-1271.288) * (-1269.569) (-1268.832) [-1269.618] (-1267.747) -- 0:00:52
      173000 -- (-1270.986) [-1268.285] (-1267.603) (-1266.808) * (-1268.904) (-1267.720) (-1267.953) [-1268.942] -- 0:00:52
      173500 -- (-1273.973) (-1269.697) (-1267.076) [-1267.203] * (-1268.076) (-1267.724) [-1267.229] (-1269.426) -- 0:00:57
      174000 -- (-1266.115) (-1269.962) [-1268.986] (-1268.161) * [-1266.917] (-1266.061) (-1267.390) (-1271.580) -- 0:00:56
      174500 -- (-1265.825) [-1271.536] (-1267.460) (-1266.782) * (-1271.929) (-1269.305) (-1268.291) [-1269.506] -- 0:00:56
      175000 -- (-1267.837) [-1270.443] (-1266.956) (-1270.513) * (-1270.837) [-1270.199] (-1267.030) (-1271.063) -- 0:00:56

      Average standard deviation of split frequencies: 0.017544

      175500 -- (-1267.286) (-1267.176) [-1267.145] (-1272.885) * (-1267.598) (-1267.583) (-1269.233) [-1267.076] -- 0:00:56
      176000 -- [-1267.389] (-1267.116) (-1268.413) (-1272.783) * (-1268.294) [-1266.307] (-1269.462) (-1266.960) -- 0:00:56
      176500 -- [-1269.727] (-1266.117) (-1269.051) (-1272.670) * [-1268.341] (-1269.046) (-1269.022) (-1267.196) -- 0:00:55
      177000 -- [-1268.128] (-1266.520) (-1267.881) (-1268.953) * (-1268.544) [-1272.841] (-1268.939) (-1268.785) -- 0:00:55
      177500 -- (-1270.729) (-1266.227) (-1267.913) [-1272.195] * (-1270.754) (-1270.967) [-1268.859] (-1268.669) -- 0:00:55
      178000 -- (-1266.996) (-1266.394) (-1268.322) [-1268.195] * (-1270.059) (-1271.903) [-1268.009] (-1266.869) -- 0:00:55
      178500 -- (-1268.330) [-1267.788] (-1266.273) (-1269.227) * (-1271.313) (-1266.131) [-1267.513] (-1267.650) -- 0:00:55
      179000 -- (-1271.317) (-1266.520) [-1270.880] (-1270.759) * (-1267.050) (-1266.131) (-1267.955) [-1268.459] -- 0:00:55
      179500 -- (-1267.412) [-1266.889] (-1270.878) (-1268.308) * (-1267.064) (-1266.134) [-1270.550] (-1268.289) -- 0:00:54
      180000 -- (-1267.787) (-1268.173) (-1274.145) [-1268.317] * (-1268.511) (-1266.989) [-1268.802] (-1269.529) -- 0:00:54

      Average standard deviation of split frequencies: 0.017441

      180500 -- (-1267.267) (-1267.018) [-1266.118] (-1266.774) * [-1268.150] (-1267.805) (-1271.008) (-1267.111) -- 0:00:54
      181000 -- (-1270.451) (-1267.340) [-1266.533] (-1266.322) * (-1269.942) [-1267.912] (-1269.113) (-1267.111) -- 0:00:54
      181500 -- (-1267.900) [-1267.563] (-1267.688) (-1266.960) * [-1266.819] (-1269.005) (-1270.573) (-1266.160) -- 0:00:54
      182000 -- [-1267.094] (-1268.928) (-1266.380) (-1270.684) * [-1266.165] (-1269.349) (-1268.143) (-1266.569) -- 0:00:53
      182500 -- (-1272.046) [-1267.722] (-1266.374) (-1268.006) * (-1266.040) [-1271.791] (-1269.143) (-1267.075) -- 0:00:53
      183000 -- (-1267.424) (-1265.930) [-1266.483] (-1269.074) * (-1267.972) (-1269.965) (-1268.061) [-1270.727] -- 0:00:53
      183500 -- [-1268.272] (-1266.726) (-1267.937) (-1270.553) * [-1266.909] (-1268.723) (-1268.432) (-1266.377) -- 0:00:53
      184000 -- [-1267.586] (-1270.590) (-1268.411) (-1268.369) * [-1268.345] (-1269.056) (-1271.057) (-1267.524) -- 0:00:53
      184500 -- (-1267.459) [-1268.150] (-1269.125) (-1267.394) * (-1267.265) (-1268.218) [-1273.458] (-1266.395) -- 0:00:53
      185000 -- (-1267.495) [-1269.922] (-1271.389) (-1269.826) * (-1266.377) [-1269.223] (-1269.370) (-1267.082) -- 0:00:52

      Average standard deviation of split frequencies: 0.015967

      185500 -- (-1266.860) (-1269.183) [-1270.743] (-1272.147) * (-1266.909) (-1268.921) (-1274.115) [-1268.551] -- 0:00:52
      186000 -- (-1266.661) [-1268.145] (-1269.350) (-1270.900) * (-1267.474) [-1267.989] (-1270.358) (-1269.024) -- 0:00:52
      186500 -- [-1267.096] (-1269.983) (-1267.340) (-1273.527) * (-1268.955) (-1269.048) (-1269.484) [-1268.515] -- 0:00:52
      187000 -- (-1268.517) (-1270.884) [-1267.690] (-1272.389) * (-1268.255) (-1267.792) (-1266.392) [-1268.546] -- 0:00:52
      187500 -- [-1266.331] (-1268.126) (-1270.709) (-1272.214) * (-1266.760) (-1268.503) [-1267.539] (-1267.517) -- 0:00:52
      188000 -- [-1266.681] (-1267.711) (-1269.259) (-1273.600) * (-1266.429) (-1269.031) (-1270.774) [-1268.139] -- 0:00:56
      188500 -- [-1267.155] (-1275.332) (-1269.928) (-1271.014) * [-1268.318] (-1268.158) (-1270.544) (-1269.016) -- 0:00:55
      189000 -- [-1271.897] (-1267.123) (-1267.936) (-1269.441) * (-1268.140) (-1269.311) (-1270.422) [-1266.623] -- 0:00:55
      189500 -- (-1271.009) (-1270.287) [-1267.736] (-1275.121) * (-1268.620) (-1267.482) (-1268.886) [-1267.749] -- 0:00:55
      190000 -- (-1269.652) (-1268.380) [-1267.635] (-1269.835) * (-1267.330) (-1268.767) [-1266.882] (-1266.412) -- 0:00:55

      Average standard deviation of split frequencies: 0.014834

      190500 -- (-1267.401) (-1269.628) [-1268.219] (-1266.756) * [-1267.661] (-1266.758) (-1270.865) (-1268.858) -- 0:00:55
      191000 -- (-1266.680) (-1268.319) (-1266.818) [-1266.050] * (-1266.327) [-1266.817] (-1266.953) (-1271.163) -- 0:00:55
      191500 -- [-1266.935] (-1268.555) (-1267.882) (-1267.656) * (-1272.132) (-1268.095) [-1266.576] (-1270.265) -- 0:00:54
      192000 -- [-1267.007] (-1266.812) (-1266.806) (-1269.774) * (-1270.513) (-1268.118) (-1266.837) [-1268.466] -- 0:00:54
      192500 -- (-1266.419) (-1268.075) [-1267.039] (-1267.291) * (-1269.638) [-1266.830] (-1266.698) (-1266.349) -- 0:00:54
      193000 -- (-1267.649) (-1268.084) (-1266.446) [-1267.436] * [-1273.596] (-1267.250) (-1267.007) (-1266.953) -- 0:00:54
      193500 -- (-1268.036) (-1266.567) (-1267.497) [-1266.134] * (-1267.228) (-1267.922) (-1269.692) [-1266.895] -- 0:00:54
      194000 -- (-1269.586) [-1267.213] (-1267.623) (-1268.285) * (-1269.942) (-1269.773) (-1269.282) [-1268.704] -- 0:00:54
      194500 -- [-1269.618] (-1266.391) (-1268.414) (-1267.977) * (-1270.469) [-1267.364] (-1270.441) (-1266.655) -- 0:00:53
      195000 -- (-1270.491) [-1267.217] (-1267.799) (-1267.262) * (-1269.586) (-1271.612) [-1268.248] (-1266.755) -- 0:00:53

      Average standard deviation of split frequencies: 0.015513

      195500 -- (-1268.674) [-1268.075] (-1267.220) (-1267.262) * (-1270.430) [-1268.565] (-1266.784) (-1266.468) -- 0:00:53
      196000 -- (-1267.584) (-1267.566) (-1267.626) [-1267.015] * (-1266.973) (-1270.440) [-1267.302] (-1267.260) -- 0:00:53
      196500 -- (-1270.800) [-1266.966] (-1267.707) (-1266.474) * [-1266.432] (-1270.178) (-1267.433) (-1271.973) -- 0:00:53
      197000 -- (-1268.578) (-1267.723) [-1268.814] (-1266.364) * (-1268.474) (-1268.611) [-1267.876] (-1272.067) -- 0:00:52
      197500 -- (-1267.781) (-1266.318) (-1269.072) [-1268.182] * [-1268.468] (-1268.251) (-1269.582) (-1267.540) -- 0:00:52
      198000 -- (-1267.894) [-1266.229] (-1267.570) (-1269.385) * (-1266.930) (-1268.505) (-1271.487) [-1266.776] -- 0:00:52
      198500 -- (-1266.776) (-1266.065) [-1266.360] (-1274.500) * (-1268.067) [-1268.636] (-1272.217) (-1267.147) -- 0:00:52
      199000 -- (-1267.814) (-1275.432) [-1269.111] (-1268.303) * (-1267.220) (-1269.127) (-1269.299) [-1266.171] -- 0:00:52
      199500 -- [-1267.121] (-1268.492) (-1271.078) (-1269.735) * [-1266.946] (-1269.155) (-1269.013) (-1270.690) -- 0:00:52
      200000 -- (-1266.767) (-1267.431) [-1269.485] (-1271.325) * (-1269.728) [-1270.006] (-1269.610) (-1266.483) -- 0:00:51

      Average standard deviation of split frequencies: 0.015270

      200500 -- [-1266.045] (-1267.127) (-1269.476) (-1268.301) * (-1269.665) (-1270.086) [-1267.657] (-1269.675) -- 0:00:51
      201000 -- (-1267.464) [-1266.717] (-1269.427) (-1266.420) * (-1269.185) [-1267.139] (-1266.426) (-1268.102) -- 0:00:51
      201500 -- (-1269.254) (-1268.152) (-1267.443) [-1266.517] * (-1268.975) [-1266.457] (-1270.012) (-1269.273) -- 0:00:51
      202000 -- [-1268.147] (-1267.826) (-1266.497) (-1266.445) * (-1268.656) (-1267.544) [-1267.429] (-1269.056) -- 0:00:51
      202500 -- (-1271.586) (-1267.331) [-1266.707] (-1267.370) * (-1271.244) (-1267.180) [-1266.297] (-1267.608) -- 0:00:51
      203000 -- (-1268.079) (-1267.385) [-1267.066] (-1267.958) * [-1267.314] (-1267.579) (-1267.871) (-1268.686) -- 0:00:54
      203500 -- [-1271.461] (-1270.930) (-1267.158) (-1267.149) * (-1267.778) [-1269.565] (-1268.389) (-1269.762) -- 0:00:54
      204000 -- (-1270.060) (-1268.661) (-1267.156) [-1266.581] * [-1268.918] (-1269.868) (-1268.693) (-1267.094) -- 0:00:54
      204500 -- [-1274.059] (-1267.006) (-1266.882) (-1268.169) * (-1271.513) (-1268.694) (-1269.296) [-1268.552] -- 0:00:54
      205000 -- (-1266.693) (-1268.088) [-1268.661] (-1268.169) * [-1269.661] (-1273.324) (-1267.609) (-1266.735) -- 0:00:54

      Average standard deviation of split frequencies: 0.014874

      205500 -- (-1272.065) (-1267.492) [-1269.094] (-1267.588) * (-1266.225) (-1267.992) [-1267.737] (-1268.566) -- 0:00:54
      206000 -- (-1266.662) (-1267.861) (-1268.495) [-1266.326] * (-1271.731) (-1268.651) [-1266.280] (-1266.429) -- 0:00:53
      206500 -- (-1266.645) (-1266.563) [-1266.316] (-1268.539) * [-1270.653] (-1268.183) (-1267.492) (-1266.650) -- 0:00:53
      207000 -- (-1268.397) (-1266.408) (-1266.776) [-1266.761] * (-1268.902) (-1269.091) (-1269.669) [-1267.853] -- 0:00:53
      207500 -- (-1272.391) (-1266.545) (-1266.667) [-1266.894] * (-1268.125) (-1270.360) [-1267.890] (-1266.359) -- 0:00:53
      208000 -- (-1268.766) (-1266.726) [-1266.663] (-1268.628) * [-1270.226] (-1268.062) (-1271.555) (-1267.000) -- 0:00:53
      208500 -- [-1267.306] (-1266.726) (-1268.670) (-1271.563) * (-1271.602) (-1267.232) (-1268.693) [-1269.733] -- 0:00:53
      209000 -- [-1267.406] (-1266.749) (-1267.760) (-1266.592) * (-1270.537) (-1268.434) [-1268.216] (-1269.126) -- 0:00:52
      209500 -- (-1268.888) [-1266.646] (-1267.086) (-1268.673) * (-1270.045) (-1267.333) (-1271.710) [-1267.887] -- 0:00:52
      210000 -- (-1266.613) (-1266.729) (-1267.021) [-1265.923] * (-1268.036) (-1268.290) (-1268.875) [-1266.942] -- 0:00:52

      Average standard deviation of split frequencies: 0.015664

      210500 -- [-1266.534] (-1267.642) (-1268.512) (-1267.482) * (-1267.976) (-1269.548) (-1268.793) [-1267.585] -- 0:00:52
      211000 -- [-1266.459] (-1266.354) (-1267.411) (-1267.157) * (-1266.663) (-1268.445) (-1267.597) [-1272.541] -- 0:00:52
      211500 -- (-1267.565) (-1271.088) (-1269.415) [-1268.429] * (-1268.396) (-1267.361) (-1267.066) [-1266.729] -- 0:00:52
      212000 -- (-1269.231) (-1268.613) (-1268.502) [-1268.393] * (-1266.828) [-1268.223] (-1272.043) (-1274.639) -- 0:00:52
      212500 -- (-1270.668) [-1268.305] (-1266.907) (-1268.923) * (-1266.763) (-1269.401) [-1268.613] (-1268.460) -- 0:00:51
      213000 -- (-1267.003) (-1270.946) [-1271.222] (-1266.089) * (-1266.924) (-1266.158) [-1266.140] (-1268.137) -- 0:00:51
      213500 -- (-1267.101) (-1269.176) [-1268.526] (-1267.383) * (-1266.804) (-1267.378) [-1267.394] (-1267.651) -- 0:00:51
      214000 -- [-1266.591] (-1266.107) (-1269.367) (-1270.374) * (-1267.560) (-1266.192) [-1266.799] (-1269.484) -- 0:00:51
      214500 -- (-1267.734) (-1266.836) (-1267.748) [-1267.362] * (-1267.747) (-1268.307) [-1267.771] (-1266.496) -- 0:00:51
      215000 -- (-1268.122) [-1267.732] (-1268.769) (-1268.275) * (-1266.858) (-1270.766) [-1267.913] (-1266.183) -- 0:00:51

      Average standard deviation of split frequencies: 0.015162

      215500 -- (-1271.380) [-1267.489] (-1270.607) (-1266.561) * (-1268.931) (-1267.038) [-1266.995] (-1266.573) -- 0:00:50
      216000 -- (-1267.900) (-1266.058) (-1267.488) [-1266.660] * (-1266.503) [-1268.594] (-1266.863) (-1269.232) -- 0:00:50
      216500 -- (-1267.771) (-1267.164) [-1268.035] (-1266.832) * (-1268.041) (-1268.357) (-1269.469) [-1266.608] -- 0:00:50
      217000 -- (-1268.093) (-1267.653) (-1272.386) [-1267.772] * (-1270.963) (-1268.172) [-1267.424] (-1266.552) -- 0:00:50
      217500 -- [-1266.330] (-1270.952) (-1267.700) (-1268.983) * (-1267.809) (-1269.357) [-1268.370] (-1269.645) -- 0:00:50
      218000 -- (-1266.343) (-1270.423) [-1266.699] (-1267.976) * [-1266.729] (-1271.993) (-1270.325) (-1268.405) -- 0:00:53
      218500 -- [-1266.684] (-1268.246) (-1267.476) (-1266.354) * (-1268.314) [-1270.347] (-1268.835) (-1267.740) -- 0:00:53
      219000 -- [-1268.374] (-1267.737) (-1266.660) (-1269.196) * (-1268.200) (-1270.717) (-1270.681) [-1267.737] -- 0:00:53
      219500 -- (-1267.299) (-1268.146) (-1267.048) [-1268.474] * (-1269.944) (-1270.184) [-1267.771] (-1270.742) -- 0:00:53
      220000 -- (-1267.231) (-1267.177) (-1266.651) [-1268.748] * (-1266.613) (-1270.232) (-1266.950) [-1267.153] -- 0:00:53

      Average standard deviation of split frequencies: 0.016236

      220500 -- (-1268.463) [-1267.098] (-1266.239) (-1268.081) * (-1267.039) (-1268.990) [-1268.029] (-1270.537) -- 0:00:53
      221000 -- [-1267.870] (-1266.863) (-1267.139) (-1269.159) * (-1267.442) [-1265.880] (-1268.802) (-1270.538) -- 0:00:52
      221500 -- [-1268.352] (-1268.785) (-1268.987) (-1267.863) * [-1269.728] (-1269.236) (-1269.946) (-1269.179) -- 0:00:52
      222000 -- (-1267.810) (-1267.602) (-1267.585) [-1268.197] * [-1268.372] (-1269.037) (-1267.289) (-1271.983) -- 0:00:52
      222500 -- [-1269.685] (-1266.918) (-1269.212) (-1268.491) * (-1271.229) (-1268.083) [-1266.806] (-1269.571) -- 0:00:52
      223000 -- [-1268.027] (-1270.991) (-1270.117) (-1268.167) * (-1266.981) [-1268.760] (-1269.641) (-1272.472) -- 0:00:52
      223500 -- [-1268.236] (-1272.045) (-1267.118) (-1268.198) * (-1266.398) [-1268.286] (-1268.365) (-1268.691) -- 0:00:52
      224000 -- (-1273.340) [-1268.836] (-1268.599) (-1269.525) * (-1268.677) (-1274.483) [-1267.673] (-1268.959) -- 0:00:51
      224500 -- (-1270.596) [-1268.808] (-1267.764) (-1267.515) * [-1269.216] (-1267.624) (-1266.005) (-1267.864) -- 0:00:51
      225000 -- (-1271.673) (-1267.563) [-1267.724] (-1266.727) * (-1272.712) (-1266.817) (-1269.853) [-1267.689] -- 0:00:51

      Average standard deviation of split frequencies: 0.016061

      225500 -- (-1266.844) (-1270.211) (-1268.412) [-1266.736] * (-1268.610) (-1267.471) (-1266.104) [-1267.929] -- 0:00:51
      226000 -- [-1271.840] (-1266.386) (-1268.073) (-1267.002) * [-1267.147] (-1266.475) (-1266.920) (-1269.108) -- 0:00:51
      226500 -- (-1272.731) [-1267.116] (-1269.650) (-1266.066) * (-1270.958) (-1268.074) [-1267.931] (-1269.542) -- 0:00:51
      227000 -- (-1271.369) (-1267.186) (-1267.163) [-1266.095] * (-1268.181) (-1269.466) [-1266.806] (-1269.282) -- 0:00:51
      227500 -- (-1268.788) [-1267.780] (-1267.691) (-1266.564) * (-1266.556) (-1268.217) [-1270.196] (-1267.570) -- 0:00:50
      228000 -- [-1271.138] (-1267.727) (-1267.258) (-1266.616) * [-1268.389] (-1268.885) (-1268.066) (-1266.719) -- 0:00:50
      228500 -- (-1266.766) [-1270.169] (-1267.752) (-1268.149) * (-1270.113) (-1270.867) (-1271.375) [-1269.381] -- 0:00:50
      229000 -- (-1266.388) [-1269.135] (-1268.439) (-1267.755) * (-1266.777) [-1269.989] (-1266.320) (-1267.427) -- 0:00:50
      229500 -- [-1268.169] (-1266.980) (-1267.398) (-1267.635) * (-1266.496) [-1268.979] (-1267.037) (-1267.469) -- 0:00:50
      230000 -- [-1267.282] (-1267.868) (-1266.263) (-1270.802) * (-1273.401) [-1267.062] (-1267.523) (-1267.938) -- 0:00:50

      Average standard deviation of split frequencies: 0.016554

      230500 -- (-1269.629) (-1268.175) [-1267.480] (-1268.376) * (-1272.359) (-1268.387) (-1268.666) [-1267.035] -- 0:00:50
      231000 -- [-1267.711] (-1270.291) (-1268.000) (-1269.556) * (-1269.811) [-1266.257] (-1269.665) (-1269.500) -- 0:00:49
      231500 -- (-1266.840) (-1270.030) [-1266.267] (-1268.635) * (-1269.508) (-1267.013) [-1270.475] (-1269.128) -- 0:00:49
      232000 -- (-1269.187) (-1266.458) (-1267.451) [-1269.158] * (-1269.588) (-1266.826) [-1270.747] (-1267.991) -- 0:00:49
      232500 -- (-1266.725) (-1266.676) (-1266.132) [-1270.814] * (-1268.148) [-1267.652] (-1269.883) (-1269.500) -- 0:00:49
      233000 -- (-1267.174) [-1268.522] (-1273.147) (-1267.148) * [-1267.051] (-1266.325) (-1267.453) (-1266.144) -- 0:00:49
      233500 -- (-1268.254) (-1267.760) (-1270.926) [-1267.863] * (-1269.743) [-1268.653] (-1267.141) (-1267.103) -- 0:00:52
      234000 -- (-1268.353) (-1267.956) (-1270.843) [-1267.287] * [-1267.792] (-1269.009) (-1266.895) (-1267.782) -- 0:00:52
      234500 -- (-1267.393) (-1268.389) (-1267.176) [-1269.791] * (-1268.540) (-1266.423) [-1267.824] (-1266.737) -- 0:00:52
      235000 -- (-1267.761) (-1268.986) [-1268.020] (-1266.270) * (-1269.479) [-1266.741] (-1267.977) (-1266.505) -- 0:00:52

      Average standard deviation of split frequencies: 0.015081

      235500 -- (-1267.524) [-1271.000] (-1269.804) (-1267.497) * (-1267.653) [-1266.600] (-1274.360) (-1267.668) -- 0:00:51
      236000 -- (-1266.971) (-1269.927) (-1269.162) [-1267.585] * (-1267.222) (-1266.370) [-1273.992] (-1269.555) -- 0:00:51
      236500 -- (-1268.092) (-1269.296) [-1268.906] (-1267.913) * (-1267.222) (-1266.240) [-1269.099] (-1268.519) -- 0:00:51
      237000 -- [-1267.262] (-1268.735) (-1271.024) (-1269.005) * (-1267.087) (-1266.140) (-1268.055) [-1269.121] -- 0:00:51
      237500 -- (-1267.568) (-1268.292) (-1270.725) [-1268.029] * (-1267.548) [-1266.557] (-1268.682) (-1267.743) -- 0:00:51
      238000 -- (-1267.404) [-1266.433] (-1270.449) (-1269.012) * (-1266.417) (-1267.292) [-1267.841] (-1267.129) -- 0:00:51
      238500 -- [-1266.630] (-1266.324) (-1267.373) (-1268.718) * (-1267.081) (-1268.212) (-1268.265) [-1271.085] -- 0:00:51
      239000 -- (-1267.049) [-1266.174] (-1266.376) (-1267.800) * (-1266.270) [-1267.017] (-1272.622) (-1266.917) -- 0:00:50
      239500 -- (-1268.068) (-1268.122) (-1266.282) [-1267.281] * (-1268.821) (-1267.604) [-1275.425] (-1269.002) -- 0:00:50
      240000 -- (-1266.527) (-1268.163) [-1266.206] (-1266.948) * (-1268.240) (-1266.645) [-1271.405] (-1267.781) -- 0:00:50

      Average standard deviation of split frequencies: 0.014536

      240500 -- (-1269.747) (-1270.246) (-1267.163) [-1271.815] * (-1268.135) (-1268.173) [-1270.583] (-1269.159) -- 0:00:50
      241000 -- [-1269.552] (-1268.350) (-1268.412) (-1269.692) * [-1267.042] (-1269.238) (-1270.811) (-1269.119) -- 0:00:50
      241500 -- [-1268.089] (-1267.684) (-1270.172) (-1267.071) * [-1267.876] (-1269.771) (-1270.573) (-1267.587) -- 0:00:50
      242000 -- [-1266.403] (-1267.187) (-1266.445) (-1269.977) * [-1271.018] (-1266.600) (-1268.755) (-1266.719) -- 0:00:50
      242500 -- (-1270.018) (-1268.961) [-1266.989] (-1268.421) * (-1268.523) [-1266.349] (-1266.045) (-1270.477) -- 0:00:49
      243000 -- [-1267.661] (-1267.411) (-1266.092) (-1267.857) * (-1267.875) (-1267.015) [-1268.766] (-1269.924) -- 0:00:49
      243500 -- (-1267.183) (-1266.708) (-1266.625) [-1266.422] * (-1268.019) [-1267.374] (-1267.569) (-1272.781) -- 0:00:49
      244000 -- (-1267.162) (-1266.511) [-1266.951] (-1270.095) * [-1268.282] (-1267.153) (-1269.234) (-1269.765) -- 0:00:49
      244500 -- (-1266.711) (-1271.002) [-1267.696] (-1272.338) * (-1267.958) [-1266.251] (-1268.308) (-1268.114) -- 0:00:49
      245000 -- (-1268.621) [-1269.498] (-1267.108) (-1268.753) * (-1269.326) (-1266.251) [-1267.675] (-1269.547) -- 0:00:49

      Average standard deviation of split frequencies: 0.014322

      245500 -- (-1269.646) [-1270.395] (-1266.052) (-1268.429) * (-1267.451) [-1266.747] (-1269.529) (-1268.015) -- 0:00:49
      246000 -- [-1268.368] (-1270.624) (-1267.476) (-1267.528) * [-1267.585] (-1276.146) (-1271.224) (-1268.076) -- 0:00:49
      246500 -- [-1268.635] (-1272.598) (-1267.873) (-1267.734) * [-1269.648] (-1271.739) (-1268.818) (-1267.286) -- 0:00:48
      247000 -- (-1268.399) (-1271.692) (-1267.323) [-1268.378] * [-1270.382] (-1265.744) (-1266.320) (-1267.012) -- 0:00:48
      247500 -- (-1267.377) [-1267.780] (-1272.798) (-1268.833) * (-1270.964) [-1266.330] (-1266.313) (-1268.074) -- 0:00:48
      248000 -- [-1267.147] (-1266.906) (-1270.060) (-1270.125) * (-1271.013) (-1269.179) [-1268.385] (-1269.971) -- 0:00:48
      248500 -- [-1266.213] (-1266.796) (-1270.620) (-1267.756) * (-1272.501) [-1270.531] (-1266.639) (-1268.215) -- 0:00:51
      249000 -- (-1267.130) [-1267.446] (-1269.863) (-1269.263) * (-1267.380) (-1266.439) (-1266.519) [-1269.780] -- 0:00:51
      249500 -- [-1270.328] (-1267.263) (-1266.055) (-1272.386) * (-1267.102) (-1272.326) (-1269.524) [-1267.131] -- 0:00:51
      250000 -- (-1268.485) [-1266.484] (-1269.879) (-1266.510) * (-1267.354) (-1273.159) [-1269.371] (-1266.302) -- 0:00:51

      Average standard deviation of split frequencies: 0.014253

      250500 -- (-1270.647) (-1272.899) (-1268.981) [-1266.878] * (-1267.291) (-1266.919) (-1267.997) [-1267.792] -- 0:00:50
      251000 -- [-1266.548] (-1274.316) (-1270.307) (-1267.037) * (-1266.875) (-1271.874) [-1267.009] (-1269.056) -- 0:00:50
      251500 -- [-1271.111] (-1272.673) (-1270.483) (-1271.888) * [-1266.157] (-1269.484) (-1267.204) (-1268.591) -- 0:00:50
      252000 -- (-1270.180) (-1273.315) (-1271.867) [-1269.960] * (-1266.157) (-1267.135) [-1266.866] (-1266.531) -- 0:00:50
      252500 -- (-1270.628) (-1269.835) (-1269.559) [-1267.082] * (-1265.992) (-1267.996) [-1265.932] (-1265.938) -- 0:00:50
      253000 -- (-1270.404) [-1269.906] (-1268.493) (-1269.924) * (-1266.270) (-1271.835) (-1269.239) [-1267.101] -- 0:00:50
      253500 -- (-1267.705) (-1267.328) (-1270.691) [-1268.572] * [-1266.283] (-1266.499) (-1267.750) (-1267.756) -- 0:00:50
      254000 -- (-1271.463) (-1267.915) (-1273.713) [-1268.821] * [-1266.790] (-1265.712) (-1271.245) (-1267.855) -- 0:00:49
      254500 -- (-1268.261) (-1268.009) (-1273.041) [-1266.833] * [-1267.547] (-1266.182) (-1272.221) (-1268.176) -- 0:00:49
      255000 -- [-1266.919] (-1267.584) (-1269.271) (-1266.552) * (-1266.895) (-1265.892) (-1268.188) [-1266.901] -- 0:00:49

      Average standard deviation of split frequencies: 0.014344

      255500 -- (-1267.130) [-1266.757] (-1270.303) (-1266.326) * (-1268.755) [-1267.415] (-1268.300) (-1267.953) -- 0:00:49
      256000 -- (-1272.734) [-1267.526] (-1271.669) (-1269.242) * (-1267.861) (-1269.161) [-1266.891] (-1268.335) -- 0:00:49
      256500 -- [-1269.640] (-1268.263) (-1271.645) (-1268.300) * (-1267.153) (-1268.913) (-1271.958) [-1268.211] -- 0:00:49
      257000 -- (-1267.935) (-1269.208) [-1267.499] (-1268.894) * (-1267.169) (-1270.291) (-1270.393) [-1267.038] -- 0:00:49
      257500 -- (-1270.109) [-1270.301] (-1266.325) (-1268.286) * (-1267.427) (-1269.140) [-1268.397] (-1267.736) -- 0:00:49
      258000 -- (-1267.736) (-1267.172) [-1268.314] (-1271.027) * (-1267.491) [-1266.402] (-1267.160) (-1269.865) -- 0:00:48
      258500 -- (-1268.958) (-1267.225) (-1269.485) [-1268.638] * (-1267.241) [-1267.375] (-1266.052) (-1267.872) -- 0:00:48
      259000 -- (-1266.952) (-1267.610) [-1267.850] (-1267.305) * (-1272.037) (-1268.751) (-1266.052) [-1269.125] -- 0:00:48
      259500 -- [-1266.878] (-1267.908) (-1269.921) (-1268.044) * [-1268.923] (-1267.804) (-1267.237) (-1271.785) -- 0:00:48
      260000 -- (-1268.597) (-1266.240) (-1268.885) [-1268.041] * (-1266.591) [-1267.405] (-1268.845) (-1267.976) -- 0:00:48

      Average standard deviation of split frequencies: 0.013516

      260500 -- (-1269.554) (-1266.195) (-1266.960) [-1266.541] * (-1266.879) (-1269.553) [-1266.590] (-1268.076) -- 0:00:48
      261000 -- (-1269.393) (-1267.113) [-1267.608] (-1268.991) * (-1268.724) (-1269.940) (-1270.218) [-1271.012] -- 0:00:48
      261500 -- [-1272.204] (-1271.281) (-1267.910) (-1268.675) * (-1268.562) (-1267.784) (-1269.220) [-1268.882] -- 0:00:48
      262000 -- (-1267.526) (-1270.672) [-1268.297] (-1267.449) * (-1268.969) (-1270.940) [-1268.124] (-1269.641) -- 0:00:47
      262500 -- [-1268.633] (-1268.689) (-1270.178) (-1267.447) * (-1270.892) (-1272.031) [-1269.730] (-1268.700) -- 0:00:47
      263000 -- (-1269.150) (-1268.269) [-1268.782] (-1267.197) * (-1267.914) [-1267.419] (-1269.300) (-1268.846) -- 0:00:47
      263500 -- (-1267.862) [-1267.784] (-1268.213) (-1269.487) * (-1267.482) [-1268.816] (-1267.890) (-1268.031) -- 0:00:50
      264000 -- [-1267.489] (-1268.606) (-1268.598) (-1267.245) * (-1267.477) (-1268.177) (-1267.523) [-1267.879] -- 0:00:50
      264500 -- [-1267.241] (-1268.515) (-1268.262) (-1267.340) * (-1266.431) (-1267.820) (-1266.609) [-1268.778] -- 0:00:50
      265000 -- (-1267.285) [-1267.704] (-1266.807) (-1267.267) * (-1266.287) (-1269.805) [-1265.974] (-1267.228) -- 0:00:49

      Average standard deviation of split frequencies: 0.014355

      265500 -- [-1266.845] (-1267.703) (-1266.874) (-1266.815) * [-1266.296] (-1271.869) (-1266.896) (-1267.660) -- 0:00:49
      266000 -- (-1268.798) [-1266.420] (-1270.739) (-1269.329) * (-1266.574) [-1267.773] (-1269.254) (-1269.384) -- 0:00:49
      266500 -- (-1269.153) (-1266.401) (-1271.383) [-1271.127] * [-1271.293] (-1266.128) (-1269.472) (-1269.072) -- 0:00:49
      267000 -- [-1267.958] (-1266.360) (-1271.380) (-1273.486) * (-1267.326) (-1266.546) (-1268.025) [-1269.267] -- 0:00:49
      267500 -- (-1267.445) [-1266.934] (-1269.490) (-1267.695) * [-1270.373] (-1271.348) (-1267.250) (-1268.760) -- 0:00:49
      268000 -- [-1267.945] (-1268.156) (-1270.717) (-1265.962) * (-1269.656) (-1266.788) [-1267.073] (-1269.938) -- 0:00:49
      268500 -- (-1266.395) [-1267.523] (-1271.776) (-1267.396) * (-1271.359) (-1266.889) (-1268.684) [-1268.368] -- 0:00:49
      269000 -- [-1266.567] (-1272.216) (-1266.207) (-1266.379) * [-1271.867] (-1268.780) (-1268.253) (-1269.158) -- 0:00:48
      269500 -- (-1266.561) (-1268.700) [-1266.657] (-1267.405) * (-1273.001) [-1266.864] (-1274.097) (-1270.470) -- 0:00:48
      270000 -- [-1268.680] (-1269.211) (-1266.916) (-1267.741) * [-1269.143] (-1266.847) (-1269.618) (-1266.278) -- 0:00:48

      Average standard deviation of split frequencies: 0.015191

      270500 -- (-1270.729) (-1273.289) (-1267.590) [-1268.060] * (-1273.304) [-1267.740] (-1270.195) (-1267.150) -- 0:00:48
      271000 -- (-1266.211) (-1271.576) [-1267.042] (-1266.094) * [-1271.054] (-1271.660) (-1271.714) (-1267.081) -- 0:00:48
      271500 -- (-1267.277) (-1269.177) (-1267.615) [-1267.645] * (-1267.662) [-1268.100] (-1269.751) (-1268.154) -- 0:00:48
      272000 -- (-1267.264) (-1272.347) (-1268.095) [-1270.682] * (-1271.461) [-1266.248] (-1268.025) (-1268.114) -- 0:00:48
      272500 -- (-1266.831) (-1267.450) [-1267.176] (-1269.566) * [-1268.735] (-1266.150) (-1267.332) (-1267.372) -- 0:00:48
      273000 -- [-1268.015] (-1270.450) (-1267.713) (-1270.459) * (-1266.412) [-1266.839] (-1268.178) (-1267.895) -- 0:00:47
      273500 -- (-1267.522) [-1268.855] (-1267.411) (-1270.192) * [-1269.817] (-1266.856) (-1268.121) (-1267.735) -- 0:00:47
      274000 -- [-1266.990] (-1267.073) (-1267.352) (-1269.244) * [-1272.614] (-1267.340) (-1266.675) (-1268.608) -- 0:00:47
      274500 -- (-1266.889) [-1268.447] (-1267.009) (-1267.532) * (-1269.168) (-1267.726) (-1266.278) [-1267.677] -- 0:00:47
      275000 -- (-1266.219) (-1271.599) [-1266.357] (-1268.733) * (-1267.636) (-1268.584) (-1267.800) [-1267.152] -- 0:00:47

      Average standard deviation of split frequencies: 0.013463

      275500 -- (-1269.925) [-1270.834] (-1270.046) (-1266.797) * (-1268.745) (-1269.380) (-1268.725) [-1266.863] -- 0:00:47
      276000 -- (-1267.793) (-1267.683) (-1271.113) [-1266.487] * [-1268.102] (-1269.247) (-1266.588) (-1267.969) -- 0:00:47
      276500 -- [-1266.203] (-1267.484) (-1268.296) (-1271.394) * (-1266.949) (-1267.361) [-1267.174] (-1267.202) -- 0:00:47
      277000 -- (-1267.341) (-1267.365) (-1267.513) [-1269.521] * (-1268.760) (-1269.336) (-1267.763) [-1266.487] -- 0:00:46
      277500 -- (-1271.642) (-1270.497) (-1267.926) [-1267.085] * (-1268.714) (-1268.446) (-1267.012) [-1266.990] -- 0:00:46
      278000 -- (-1269.243) (-1268.615) [-1268.380] (-1266.216) * [-1267.738] (-1269.603) (-1272.085) (-1267.767) -- 0:00:46
      278500 -- (-1268.878) [-1268.699] (-1267.651) (-1266.216) * [-1267.734] (-1268.546) (-1267.928) (-1268.579) -- 0:00:46
      279000 -- (-1266.372) (-1267.069) (-1266.142) [-1267.791] * (-1267.775) (-1267.568) [-1266.065] (-1267.323) -- 0:00:49
      279500 -- (-1266.715) [-1266.654] (-1267.384) (-1267.352) * (-1266.232) [-1269.979] (-1265.814) (-1267.040) -- 0:00:48
      280000 -- (-1267.837) (-1269.628) [-1267.619] (-1270.315) * (-1270.295) (-1278.418) [-1266.230] (-1266.263) -- 0:00:48

      Average standard deviation of split frequencies: 0.013338

      280500 -- (-1267.758) (-1268.739) [-1267.056] (-1271.396) * (-1274.813) [-1271.383] (-1267.329) (-1266.188) -- 0:00:48
      281000 -- (-1266.726) (-1269.703) [-1268.532] (-1269.808) * (-1270.650) [-1268.565] (-1266.081) (-1265.952) -- 0:00:48
      281500 -- [-1266.663] (-1267.388) (-1268.793) (-1270.710) * (-1268.927) (-1267.042) (-1267.124) [-1269.594] -- 0:00:48
      282000 -- (-1267.065) (-1267.820) (-1268.367) [-1270.362] * (-1269.709) (-1268.278) [-1267.535] (-1269.844) -- 0:00:48
      282500 -- (-1268.941) (-1266.531) [-1268.364] (-1268.947) * (-1267.465) [-1269.393] (-1266.702) (-1268.795) -- 0:00:48
      283000 -- (-1268.756) (-1267.852) (-1266.070) [-1272.982] * [-1267.597] (-1268.932) (-1270.408) (-1266.189) -- 0:00:48
      283500 -- (-1271.641) (-1266.556) [-1267.373] (-1267.724) * (-1266.700) (-1267.262) (-1266.714) [-1270.043] -- 0:00:48
      284000 -- (-1268.646) [-1268.322] (-1270.615) (-1268.362) * (-1268.778) [-1266.960] (-1267.883) (-1268.375) -- 0:00:47
      284500 -- (-1267.322) (-1267.514) [-1270.043] (-1268.955) * (-1267.552) [-1267.982] (-1268.465) (-1269.846) -- 0:00:47
      285000 -- (-1268.587) (-1271.880) [-1268.279] (-1268.188) * (-1269.248) (-1272.636) [-1266.741] (-1268.500) -- 0:00:47

      Average standard deviation of split frequencies: 0.013533

      285500 -- (-1273.664) [-1267.197] (-1270.684) (-1267.391) * (-1268.121) (-1270.121) (-1268.948) [-1267.787] -- 0:00:47
      286000 -- (-1267.069) (-1266.276) (-1270.219) [-1267.292] * (-1267.304) [-1270.959] (-1268.592) (-1267.204) -- 0:00:47
      286500 -- [-1267.230] (-1268.971) (-1267.320) (-1269.825) * (-1266.480) [-1267.805] (-1267.749) (-1269.710) -- 0:00:47
      287000 -- (-1268.723) (-1271.282) (-1266.913) [-1267.900] * (-1269.880) (-1267.029) (-1268.361) [-1266.424] -- 0:00:47
      287500 -- (-1271.255) [-1267.440] (-1266.599) (-1268.003) * [-1269.200] (-1268.211) (-1269.842) (-1266.274) -- 0:00:47
      288000 -- (-1271.075) [-1269.583] (-1266.292) (-1267.550) * [-1267.916] (-1266.104) (-1268.803) (-1269.917) -- 0:00:46
      288500 -- (-1266.381) (-1270.566) [-1269.359] (-1267.846) * (-1266.535) (-1267.295) [-1270.566] (-1269.889) -- 0:00:46
      289000 -- (-1268.002) (-1273.938) (-1268.927) [-1269.285] * (-1266.649) [-1266.391] (-1269.785) (-1269.150) -- 0:00:46
      289500 -- [-1267.182] (-1270.300) (-1267.239) (-1270.011) * [-1270.261] (-1268.760) (-1268.609) (-1268.328) -- 0:00:46
      290000 -- [-1267.944] (-1269.521) (-1268.515) (-1270.134) * (-1269.826) (-1267.192) (-1267.354) [-1267.382] -- 0:00:46

      Average standard deviation of split frequencies: 0.013070

      290500 -- (-1268.129) (-1269.389) [-1269.556] (-1266.636) * [-1267.677] (-1268.226) (-1268.619) (-1266.377) -- 0:00:46
      291000 -- (-1267.464) (-1268.191) [-1270.277] (-1266.646) * (-1267.438) (-1269.631) [-1268.825] (-1266.525) -- 0:00:46
      291500 -- (-1270.170) (-1266.732) (-1270.468) [-1268.030] * (-1275.277) [-1267.817] (-1269.550) (-1268.093) -- 0:00:46
      292000 -- [-1269.459] (-1268.609) (-1270.039) (-1269.984) * (-1267.779) [-1266.640] (-1269.559) (-1266.415) -- 0:00:46
      292500 -- (-1268.592) (-1269.852) (-1266.955) [-1269.760] * [-1268.704] (-1267.514) (-1269.631) (-1266.144) -- 0:00:45
      293000 -- (-1269.071) [-1268.655] (-1267.563) (-1269.275) * [-1268.194] (-1271.002) (-1268.914) (-1265.987) -- 0:00:45
      293500 -- [-1269.289] (-1269.420) (-1268.524) (-1266.867) * [-1268.905] (-1268.176) (-1268.109) (-1268.133) -- 0:00:45
      294000 -- (-1267.878) [-1271.361] (-1267.455) (-1269.177) * (-1270.734) [-1267.689] (-1265.930) (-1268.266) -- 0:00:45
      294500 -- (-1268.839) (-1269.268) [-1267.343] (-1267.702) * (-1272.618) [-1267.381] (-1266.962) (-1268.234) -- 0:00:47
      295000 -- (-1270.389) (-1267.357) (-1269.905) [-1267.762] * (-1267.374) (-1265.775) (-1268.274) [-1272.278] -- 0:00:47

      Average standard deviation of split frequencies: 0.013636

      295500 -- (-1266.656) [-1267.719] (-1266.774) (-1271.569) * (-1270.326) [-1268.274] (-1268.201) (-1267.334) -- 0:00:47
      296000 -- (-1269.472) [-1267.742] (-1267.726) (-1268.068) * (-1267.968) (-1266.726) [-1267.334] (-1267.277) -- 0:00:47
      296500 -- [-1266.768] (-1269.531) (-1267.559) (-1269.104) * (-1267.831) [-1268.174] (-1267.664) (-1268.581) -- 0:00:47
      297000 -- (-1268.175) (-1267.288) (-1268.274) [-1266.665] * (-1267.764) (-1266.656) [-1267.516] (-1266.412) -- 0:00:47
      297500 -- (-1272.239) (-1268.644) (-1267.543) [-1266.400] * (-1268.268) (-1267.344) [-1266.347] (-1267.246) -- 0:00:47
      298000 -- (-1273.518) (-1271.107) (-1269.976) [-1266.633] * (-1270.590) [-1266.939] (-1266.512) (-1267.076) -- 0:00:47
      298500 -- (-1271.508) (-1270.273) (-1269.318) [-1266.906] * (-1268.833) (-1268.370) (-1267.061) [-1268.491] -- 0:00:47
      299000 -- (-1267.856) (-1268.962) (-1268.336) [-1269.756] * [-1267.243] (-1267.774) (-1267.573) (-1267.818) -- 0:00:46
      299500 -- (-1268.975) (-1268.367) (-1270.566) [-1268.069] * (-1266.972) (-1267.356) (-1270.193) [-1270.600] -- 0:00:46
      300000 -- (-1269.257) (-1267.912) [-1268.104] (-1270.397) * (-1270.256) [-1267.701] (-1270.137) (-1271.181) -- 0:00:46

      Average standard deviation of split frequencies: 0.014013

      300500 -- (-1267.446) [-1267.906] (-1267.345) (-1268.271) * (-1268.759) (-1266.574) (-1270.136) [-1269.245] -- 0:00:46
      301000 -- [-1268.750] (-1266.906) (-1266.583) (-1269.475) * (-1270.149) [-1268.084] (-1269.678) (-1265.825) -- 0:00:46
      301500 -- (-1269.290) (-1267.424) (-1265.989) [-1269.874] * (-1269.167) [-1266.896] (-1269.377) (-1267.507) -- 0:00:46
      302000 -- (-1268.782) (-1268.953) (-1270.181) [-1269.401] * [-1266.960] (-1268.326) (-1269.411) (-1269.675) -- 0:00:46
      302500 -- (-1267.689) (-1268.993) (-1268.128) [-1270.842] * (-1268.580) (-1270.065) (-1269.999) [-1270.760] -- 0:00:46
      303000 -- (-1270.395) [-1268.189] (-1266.808) (-1272.411) * (-1267.383) (-1268.394) [-1269.203] (-1270.623) -- 0:00:46
      303500 -- (-1269.787) (-1275.382) [-1269.675] (-1267.712) * [-1266.112] (-1268.723) (-1268.073) (-1271.146) -- 0:00:45
      304000 -- (-1269.301) (-1276.476) [-1270.525] (-1267.202) * [-1267.126] (-1267.425) (-1268.715) (-1267.256) -- 0:00:45
      304500 -- (-1272.494) (-1271.287) [-1268.823] (-1268.545) * (-1266.896) [-1268.119] (-1268.288) (-1268.128) -- 0:00:45
      305000 -- (-1267.890) (-1271.398) [-1267.830] (-1271.160) * (-1266.029) [-1269.045] (-1266.380) (-1267.390) -- 0:00:45

      Average standard deviation of split frequencies: 0.014351

      305500 -- [-1267.372] (-1268.836) (-1267.834) (-1265.985) * (-1266.084) (-1267.294) [-1266.633] (-1271.613) -- 0:00:45
      306000 -- (-1266.967) (-1267.442) (-1268.727) [-1265.852] * (-1267.801) [-1268.701] (-1267.601) (-1269.757) -- 0:00:45
      306500 -- [-1266.981] (-1266.806) (-1267.004) (-1266.913) * (-1268.172) (-1267.589) [-1266.168] (-1271.029) -- 0:00:45
      307000 -- (-1266.998) (-1266.682) (-1272.419) [-1266.773] * [-1266.828] (-1267.485) (-1267.713) (-1267.930) -- 0:00:45
      307500 -- (-1267.595) (-1266.587) (-1268.121) [-1266.815] * (-1266.556) (-1268.268) (-1268.143) [-1267.966] -- 0:00:45
      308000 -- (-1268.152) [-1266.867] (-1269.364) (-1267.111) * [-1266.544] (-1267.217) (-1266.840) (-1266.528) -- 0:00:44
      308500 -- (-1269.052) (-1266.401) (-1270.124) [-1270.492] * [-1266.781] (-1269.450) (-1271.039) (-1269.034) -- 0:00:44
      309000 -- (-1269.659) (-1267.920) (-1268.181) [-1267.688] * (-1270.091) (-1266.560) [-1270.241] (-1272.592) -- 0:00:44
      309500 -- (-1270.487) [-1268.601] (-1271.970) (-1269.600) * (-1272.421) (-1267.744) [-1268.475] (-1271.245) -- 0:00:44
      310000 -- (-1271.052) (-1266.776) [-1272.157] (-1269.397) * (-1270.291) (-1270.812) (-1267.771) [-1271.878] -- 0:00:46

      Average standard deviation of split frequencies: 0.014460

      310500 -- [-1269.439] (-1269.657) (-1268.643) (-1267.547) * (-1268.365) [-1270.669] (-1269.445) (-1273.091) -- 0:00:46
      311000 -- (-1272.185) (-1268.276) [-1268.119] (-1268.313) * (-1266.479) [-1266.117] (-1267.276) (-1267.061) -- 0:00:46
      311500 -- (-1270.641) (-1268.275) (-1268.946) [-1268.777] * [-1267.024] (-1266.193) (-1268.165) (-1268.421) -- 0:00:46
      312000 -- [-1267.274] (-1268.343) (-1267.567) (-1266.817) * (-1266.263) (-1266.813) [-1267.870] (-1267.396) -- 0:00:46
      312500 -- (-1269.775) (-1267.771) [-1268.291] (-1268.722) * (-1269.722) (-1270.480) [-1266.676] (-1266.498) -- 0:00:46
      313000 -- (-1272.535) (-1272.160) (-1267.046) [-1268.767] * (-1268.355) [-1267.591] (-1267.250) (-1266.748) -- 0:00:46
      313500 -- (-1273.337) [-1268.382] (-1266.909) (-1266.986) * (-1266.602) [-1267.271] (-1266.601) (-1267.187) -- 0:00:45
      314000 -- (-1272.784) [-1268.311] (-1267.464) (-1269.257) * (-1265.918) (-1266.935) (-1266.535) [-1269.427] -- 0:00:45
      314500 -- (-1269.797) [-1268.621] (-1270.090) (-1267.092) * (-1266.087) (-1268.801) [-1266.541] (-1267.759) -- 0:00:45
      315000 -- (-1268.943) [-1270.665] (-1269.066) (-1266.391) * (-1267.425) [-1267.176] (-1268.549) (-1267.885) -- 0:00:45

      Average standard deviation of split frequencies: 0.014503

      315500 -- [-1268.227] (-1273.419) (-1268.746) (-1270.321) * [-1266.822] (-1267.497) (-1267.426) (-1266.676) -- 0:00:45
      316000 -- [-1267.412] (-1268.449) (-1268.156) (-1269.939) * (-1269.629) [-1267.485] (-1267.426) (-1269.900) -- 0:00:45
      316500 -- (-1272.015) (-1268.994) [-1269.955] (-1268.331) * (-1268.629) [-1267.973] (-1268.476) (-1267.259) -- 0:00:45
      317000 -- (-1267.484) (-1270.287) (-1266.399) [-1271.810] * (-1270.685) (-1269.285) [-1268.463] (-1267.267) -- 0:00:45
      317500 -- (-1267.464) [-1267.178] (-1266.885) (-1268.813) * (-1272.114) (-1266.871) (-1267.051) [-1278.328] -- 0:00:45
      318000 -- [-1269.243] (-1269.097) (-1267.141) (-1266.574) * [-1266.514] (-1268.671) (-1267.498) (-1268.343) -- 0:00:45
      318500 -- [-1268.758] (-1267.743) (-1267.378) (-1265.974) * (-1270.550) [-1271.344] (-1265.844) (-1268.385) -- 0:00:44
      319000 -- (-1267.761) (-1265.930) (-1271.089) [-1266.291] * [-1267.747] (-1267.702) (-1267.386) (-1269.807) -- 0:00:44
      319500 -- (-1269.342) (-1268.808) (-1267.884) [-1268.680] * (-1271.305) (-1266.677) [-1266.139] (-1272.014) -- 0:00:44
      320000 -- [-1272.468] (-1272.024) (-1267.589) (-1269.121) * (-1270.484) (-1266.314) [-1266.751] (-1271.184) -- 0:00:44

      Average standard deviation of split frequencies: 0.014864

      320500 -- [-1268.736] (-1269.975) (-1269.505) (-1268.258) * (-1267.680) (-1268.228) [-1267.705] (-1268.803) -- 0:00:44
      321000 -- (-1266.602) (-1272.529) (-1266.420) [-1268.000] * (-1267.510) (-1267.430) (-1268.598) [-1270.141] -- 0:00:44
      321500 -- [-1267.552] (-1274.243) (-1266.507) (-1268.405) * (-1270.131) (-1266.811) (-1268.283) [-1269.978] -- 0:00:44
      322000 -- (-1266.409) (-1267.039) [-1268.749] (-1269.020) * (-1270.832) (-1267.837) (-1270.335) [-1270.948] -- 0:00:44
      322500 -- (-1266.359) [-1266.761] (-1273.150) (-1272.994) * [-1267.359] (-1272.767) (-1268.177) (-1270.054) -- 0:00:44
      323000 -- (-1269.089) [-1266.812] (-1268.744) (-1266.404) * (-1271.949) (-1275.091) (-1267.594) [-1266.794] -- 0:00:44
      323500 -- (-1269.523) (-1267.004) (-1269.474) [-1266.765] * (-1271.538) (-1274.407) (-1271.199) [-1269.978] -- 0:00:43
      324000 -- (-1268.968) [-1267.731] (-1269.755) (-1266.621) * (-1272.446) (-1270.459) [-1268.020] (-1269.390) -- 0:00:43
      324500 -- [-1268.810] (-1268.386) (-1266.955) (-1267.631) * [-1269.735] (-1273.734) (-1269.405) (-1269.303) -- 0:00:43
      325000 -- (-1267.916) (-1265.902) [-1267.068] (-1267.458) * (-1269.329) (-1267.369) (-1269.590) [-1270.090] -- 0:00:43

      Average standard deviation of split frequencies: 0.014384

      325500 -- (-1268.394) (-1266.547) (-1267.519) [-1267.175] * (-1267.494) (-1268.726) [-1274.357] (-1267.082) -- 0:00:43
      326000 -- (-1267.633) (-1267.893) (-1269.796) [-1270.578] * (-1270.231) [-1267.334] (-1271.308) (-1269.797) -- 0:00:45
      326500 -- (-1273.059) (-1267.193) [-1270.049] (-1270.703) * [-1268.598] (-1269.909) (-1267.811) (-1268.749) -- 0:00:45
      327000 -- (-1266.729) [-1267.913] (-1271.317) (-1271.006) * (-1269.327) (-1266.829) (-1269.328) [-1266.561] -- 0:00:45
      327500 -- (-1266.660) (-1269.237) (-1271.137) [-1267.453] * (-1266.572) (-1269.550) (-1270.609) [-1266.367] -- 0:00:45
      328000 -- (-1267.854) [-1267.327] (-1269.438) (-1267.789) * [-1266.816] (-1267.354) (-1267.022) (-1268.624) -- 0:00:45
      328500 -- (-1269.698) (-1269.323) [-1267.513] (-1267.590) * (-1266.816) [-1270.107] (-1266.586) (-1268.091) -- 0:00:44
      329000 -- (-1271.090) (-1269.130) (-1268.339) [-1267.590] * (-1266.380) (-1270.287) (-1269.221) [-1269.039] -- 0:00:44
      329500 -- (-1268.337) (-1271.705) (-1267.928) [-1266.937] * (-1266.367) (-1267.317) [-1266.055] (-1269.636) -- 0:00:44
      330000 -- (-1269.418) (-1271.657) [-1266.287] (-1269.121) * [-1269.632] (-1270.075) (-1268.279) (-1271.141) -- 0:00:44

      Average standard deviation of split frequencies: 0.013956

      330500 -- (-1266.806) (-1268.975) [-1266.828] (-1269.636) * (-1271.416) [-1270.426] (-1267.052) (-1269.771) -- 0:00:44
      331000 -- (-1267.254) [-1269.553] (-1266.904) (-1266.745) * [-1272.722] (-1265.957) (-1271.110) (-1268.627) -- 0:00:44
      331500 -- (-1271.495) (-1269.125) [-1266.704] (-1266.757) * [-1275.737] (-1269.872) (-1269.215) (-1269.068) -- 0:00:44
      332000 -- (-1272.265) (-1268.359) (-1267.502) [-1267.589] * (-1272.226) [-1268.856] (-1269.062) (-1271.786) -- 0:00:44
      332500 -- [-1266.122] (-1266.931) (-1267.235) (-1268.302) * (-1268.513) [-1269.221] (-1270.329) (-1270.244) -- 0:00:44
      333000 -- (-1266.550) (-1267.244) (-1275.794) [-1267.070] * [-1271.921] (-1266.390) (-1268.631) (-1267.077) -- 0:00:44
      333500 -- [-1268.066] (-1267.421) (-1277.644) (-1268.997) * (-1274.226) [-1266.251] (-1272.312) (-1267.697) -- 0:00:43
      334000 -- (-1268.934) (-1277.290) [-1272.353] (-1267.263) * (-1270.135) [-1270.448] (-1276.359) (-1267.141) -- 0:00:43
      334500 -- (-1270.888) (-1270.431) (-1269.074) [-1267.467] * (-1267.299) (-1267.713) (-1276.724) [-1267.176] -- 0:00:43
      335000 -- (-1268.036) (-1271.386) (-1268.945) [-1266.629] * (-1271.087) (-1266.230) (-1267.670) [-1268.047] -- 0:00:43

      Average standard deviation of split frequencies: 0.015121

      335500 -- (-1274.994) (-1269.740) (-1266.519) [-1268.083] * (-1268.926) (-1267.691) [-1267.294] (-1267.398) -- 0:00:43
      336000 -- (-1272.296) (-1266.036) (-1268.173) [-1270.249] * [-1267.223] (-1267.673) (-1272.007) (-1267.081) -- 0:00:43
      336500 -- (-1268.982) (-1267.354) [-1269.053] (-1270.222) * [-1266.957] (-1272.190) (-1274.404) (-1266.793) -- 0:00:43
      337000 -- (-1269.802) [-1267.930] (-1267.590) (-1269.308) * (-1266.184) (-1272.736) (-1273.669) [-1267.463] -- 0:00:43
      337500 -- (-1267.685) [-1268.157] (-1266.438) (-1268.798) * (-1266.746) (-1268.662) (-1271.078) [-1266.343] -- 0:00:43
      338000 -- [-1267.627] (-1272.687) (-1270.824) (-1266.956) * [-1268.004] (-1270.710) (-1270.017) (-1271.336) -- 0:00:43
      338500 -- [-1270.271] (-1266.542) (-1271.015) (-1268.103) * (-1272.353) [-1267.717] (-1271.720) (-1266.790) -- 0:00:42
      339000 -- (-1268.373) (-1266.306) [-1268.816] (-1267.069) * (-1269.274) (-1271.173) [-1270.751] (-1270.266) -- 0:00:42
      339500 -- [-1268.029] (-1268.679) (-1271.229) (-1268.159) * (-1267.970) (-1271.041) [-1268.502] (-1267.251) -- 0:00:42
      340000 -- [-1267.913] (-1268.002) (-1266.981) (-1267.478) * (-1268.196) (-1267.297) [-1271.807] (-1267.424) -- 0:00:42

      Average standard deviation of split frequencies: 0.014837

      340500 -- (-1268.195) (-1267.559) [-1268.745] (-1268.869) * (-1267.734) (-1267.649) [-1268.687] (-1267.475) -- 0:00:42
      341000 -- [-1268.129] (-1267.340) (-1267.209) (-1267.704) * (-1267.011) (-1266.362) [-1271.779] (-1267.079) -- 0:00:42
      341500 -- (-1268.397) (-1267.341) [-1269.099] (-1267.494) * (-1265.991) [-1268.051] (-1267.823) (-1269.602) -- 0:00:42
      342000 -- (-1266.810) (-1271.070) (-1268.299) [-1265.940] * [-1267.791] (-1266.733) (-1269.072) (-1267.816) -- 0:00:44
      342500 -- [-1267.486] (-1267.790) (-1272.749) (-1267.611) * (-1268.502) [-1267.704] (-1267.158) (-1266.983) -- 0:00:44
      343000 -- (-1268.114) (-1268.800) (-1271.894) [-1266.368] * (-1267.617) [-1267.748] (-1266.196) (-1267.836) -- 0:00:44
      343500 -- (-1269.596) (-1267.671) [-1269.533] (-1266.125) * (-1275.105) [-1267.543] (-1267.040) (-1268.911) -- 0:00:43
      344000 -- (-1269.057) (-1267.655) [-1272.046] (-1267.812) * (-1268.726) (-1267.761) (-1267.040) [-1270.301] -- 0:00:43
      344500 -- (-1269.927) [-1270.589] (-1267.363) (-1270.876) * (-1268.598) (-1268.476) [-1266.608] (-1271.757) -- 0:00:43
      345000 -- (-1270.707) [-1271.619] (-1268.975) (-1269.609) * (-1271.160) (-1268.383) [-1267.777] (-1268.006) -- 0:00:43

      Average standard deviation of split frequencies: 0.014987

      345500 -- [-1267.432] (-1268.448) (-1269.028) (-1267.779) * [-1268.775] (-1269.087) (-1266.739) (-1268.773) -- 0:00:43
      346000 -- (-1268.969) [-1269.784] (-1267.697) (-1266.497) * (-1269.785) (-1269.323) (-1266.462) [-1266.163] -- 0:00:43
      346500 -- (-1270.907) [-1268.519] (-1270.216) (-1266.821) * [-1266.257] (-1268.718) (-1267.935) (-1269.376) -- 0:00:43
      347000 -- (-1268.256) (-1270.512) [-1272.294] (-1267.679) * (-1272.172) [-1267.095] (-1268.292) (-1266.389) -- 0:00:43
      347500 -- (-1270.106) [-1268.672] (-1268.436) (-1268.260) * (-1269.115) [-1266.910] (-1270.630) (-1266.389) -- 0:00:43
      348000 -- (-1267.879) [-1269.518] (-1273.846) (-1268.699) * (-1266.761) (-1268.884) (-1268.591) [-1267.215] -- 0:00:43
      348500 -- [-1269.194] (-1270.861) (-1271.717) (-1270.430) * (-1269.049) [-1267.166] (-1269.831) (-1268.239) -- 0:00:42
      349000 -- (-1266.252) (-1267.896) [-1268.725] (-1267.654) * (-1267.600) (-1267.700) [-1267.104] (-1268.218) -- 0:00:42
      349500 -- [-1265.925] (-1269.156) (-1272.012) (-1270.055) * [-1269.557] (-1266.744) (-1272.052) (-1268.218) -- 0:00:42
      350000 -- (-1266.658) [-1269.218] (-1268.065) (-1271.207) * (-1269.584) (-1266.902) [-1268.846] (-1266.523) -- 0:00:42

      Average standard deviation of split frequencies: 0.015141

      350500 -- [-1268.763] (-1267.357) (-1268.326) (-1271.933) * [-1267.909] (-1267.068) (-1268.977) (-1269.647) -- 0:00:42
      351000 -- [-1266.551] (-1266.862) (-1268.101) (-1267.560) * (-1269.539) [-1269.750] (-1268.428) (-1270.490) -- 0:00:42
      351500 -- (-1267.726) [-1266.911] (-1270.259) (-1270.552) * (-1269.261) (-1272.682) [-1268.185] (-1267.820) -- 0:00:42
      352000 -- (-1267.477) (-1269.875) (-1268.959) [-1269.835] * [-1270.071] (-1268.337) (-1267.944) (-1269.146) -- 0:00:42
      352500 -- (-1266.656) [-1266.321] (-1270.052) (-1268.659) * (-1266.434) (-1272.482) (-1267.021) [-1267.920] -- 0:00:42
      353000 -- (-1267.297) (-1267.821) (-1272.234) [-1267.810] * (-1272.323) (-1268.312) (-1266.833) [-1267.367] -- 0:00:42
      353500 -- [-1267.010] (-1269.675) (-1269.158) (-1267.662) * (-1267.900) [-1268.972] (-1266.493) (-1272.805) -- 0:00:42
      354000 -- (-1268.325) (-1268.471) [-1268.893] (-1268.772) * (-1267.855) (-1274.582) [-1268.391] (-1271.990) -- 0:00:41
      354500 -- [-1270.639] (-1267.527) (-1270.258) (-1268.572) * (-1267.160) (-1269.540) (-1266.888) [-1269.377] -- 0:00:41
      355000 -- (-1269.605) (-1267.288) (-1267.210) [-1267.942] * (-1268.053) [-1268.488] (-1267.465) (-1269.743) -- 0:00:41

      Average standard deviation of split frequencies: 0.015669

      355500 -- (-1266.226) (-1268.696) [-1267.451] (-1270.579) * (-1269.371) (-1268.321) (-1267.606) [-1269.019] -- 0:00:41
      356000 -- (-1267.046) [-1267.019] (-1267.377) (-1267.592) * [-1268.040] (-1268.021) (-1266.324) (-1267.396) -- 0:00:41
      356500 -- (-1267.379) (-1267.573) [-1267.076] (-1268.402) * (-1270.604) (-1267.391) (-1267.614) [-1266.829] -- 0:00:41
      357000 -- [-1266.289] (-1266.430) (-1269.639) (-1268.384) * (-1268.301) (-1269.508) (-1267.378) [-1267.051] -- 0:00:41
      357500 -- (-1266.401) (-1269.184) [-1269.432] (-1267.971) * (-1267.510) [-1268.044] (-1266.390) (-1274.540) -- 0:00:41
      358000 -- (-1266.748) (-1267.531) [-1266.932] (-1268.058) * (-1266.790) (-1266.687) (-1267.347) [-1269.473] -- 0:00:43
      358500 -- (-1266.554) (-1267.562) [-1267.016] (-1269.421) * [-1266.180] (-1267.901) (-1266.521) (-1267.558) -- 0:00:42
      359000 -- (-1265.977) [-1268.219] (-1268.193) (-1267.725) * (-1266.205) (-1268.106) [-1266.384] (-1268.671) -- 0:00:42
      359500 -- (-1266.564) (-1266.838) [-1267.674] (-1267.908) * (-1267.526) (-1267.581) (-1266.186) [-1267.376] -- 0:00:42
      360000 -- [-1265.837] (-1266.366) (-1270.346) (-1267.148) * [-1267.925] (-1267.375) (-1266.242) (-1269.385) -- 0:00:42

      Average standard deviation of split frequencies: 0.016193

      360500 -- (-1269.413) (-1269.932) [-1266.838] (-1267.835) * (-1268.323) [-1266.260] (-1266.233) (-1267.775) -- 0:00:42
      361000 -- (-1267.415) (-1267.552) (-1267.090) [-1267.848] * (-1267.771) (-1267.652) [-1266.553] (-1267.023) -- 0:00:42
      361500 -- (-1267.184) (-1266.906) [-1268.217] (-1269.178) * (-1270.670) (-1267.191) [-1266.156] (-1268.855) -- 0:00:42
      362000 -- (-1266.624) (-1268.688) [-1267.860] (-1267.169) * (-1266.586) (-1268.116) [-1266.500] (-1267.508) -- 0:00:42
      362500 -- [-1266.868] (-1267.495) (-1267.059) (-1267.726) * (-1266.520) (-1269.376) (-1269.029) [-1271.021] -- 0:00:42
      363000 -- (-1266.937) (-1272.106) (-1267.452) [-1267.484] * (-1270.397) (-1267.249) (-1268.729) [-1269.535] -- 0:00:42
      363500 -- (-1268.281) (-1272.206) [-1268.513] (-1267.721) * [-1266.559] (-1267.402) (-1267.942) (-1267.280) -- 0:00:42
      364000 -- (-1269.559) (-1271.153) [-1268.208] (-1266.945) * [-1266.737] (-1268.804) (-1270.452) (-1267.790) -- 0:00:41
      364500 -- (-1267.650) [-1268.935] (-1269.881) (-1267.035) * (-1267.176) (-1268.571) [-1271.440] (-1269.502) -- 0:00:41
      365000 -- (-1266.851) [-1270.845] (-1269.732) (-1266.238) * [-1267.335] (-1267.363) (-1266.655) (-1273.108) -- 0:00:41

      Average standard deviation of split frequencies: 0.017245

      365500 -- (-1266.052) [-1270.763] (-1270.048) (-1267.507) * (-1268.912) (-1267.776) (-1268.346) [-1267.797] -- 0:00:41
      366000 -- [-1267.177] (-1268.083) (-1270.624) (-1267.533) * (-1267.557) (-1267.778) [-1269.666] (-1267.355) -- 0:00:41
      366500 -- (-1270.242) (-1267.069) [-1267.400] (-1273.374) * [-1267.552] (-1269.242) (-1269.415) (-1270.429) -- 0:00:41
      367000 -- [-1270.130] (-1267.922) (-1267.142) (-1271.122) * (-1267.992) (-1270.013) [-1272.809] (-1271.023) -- 0:00:41
      367500 -- (-1265.867) [-1266.381] (-1267.565) (-1268.950) * (-1268.702) (-1267.753) [-1268.423] (-1269.437) -- 0:00:41
      368000 -- (-1270.190) (-1269.929) (-1269.835) [-1268.555] * (-1269.922) [-1267.267] (-1267.599) (-1267.735) -- 0:00:41
      368500 -- [-1269.598] (-1271.278) (-1270.135) (-1272.454) * (-1270.289) (-1267.698) (-1267.561) [-1268.501] -- 0:00:41
      369000 -- (-1272.524) (-1270.577) [-1268.277] (-1273.161) * [-1269.545] (-1271.307) (-1266.939) (-1269.709) -- 0:00:41
      369500 -- (-1266.818) [-1267.189] (-1272.733) (-1272.180) * [-1270.465] (-1269.720) (-1266.812) (-1268.746) -- 0:00:40
      370000 -- (-1267.503) [-1267.202] (-1272.951) (-1269.183) * (-1271.083) (-1266.903) [-1266.844] (-1266.741) -- 0:00:40

      Average standard deviation of split frequencies: 0.016250

      370500 -- [-1268.361] (-1267.596) (-1268.803) (-1267.366) * (-1272.601) (-1266.955) [-1268.026] (-1266.282) -- 0:00:40
      371000 -- (-1267.915) (-1266.935) (-1273.923) [-1268.502] * (-1269.906) (-1266.822) [-1268.924] (-1268.160) -- 0:00:40
      371500 -- (-1269.789) (-1267.284) (-1269.203) [-1270.368] * (-1267.205) (-1271.789) (-1269.215) [-1267.590] -- 0:00:40
      372000 -- (-1271.793) (-1267.539) [-1267.328] (-1270.202) * (-1266.506) [-1267.841] (-1266.592) (-1269.826) -- 0:00:40
      372500 -- [-1267.484] (-1267.655) (-1268.328) (-1268.940) * (-1269.757) (-1267.639) [-1268.959] (-1268.351) -- 0:00:40
      373000 -- [-1268.122] (-1266.719) (-1267.871) (-1267.911) * (-1269.467) (-1268.014) [-1268.916] (-1267.609) -- 0:00:40
      373500 -- (-1267.111) (-1273.808) (-1268.482) [-1268.007] * [-1269.938] (-1275.092) (-1268.860) (-1268.751) -- 0:00:40
      374000 -- (-1267.457) (-1266.994) [-1268.367] (-1267.658) * (-1270.495) (-1277.001) (-1269.274) [-1268.775] -- 0:00:41
      374500 -- (-1266.444) (-1268.700) (-1267.409) [-1267.714] * (-1267.375) (-1279.457) (-1273.989) [-1268.874] -- 0:00:41
      375000 -- [-1266.196] (-1270.311) (-1266.428) (-1269.495) * (-1267.743) (-1268.862) (-1270.512) [-1269.667] -- 0:00:41

      Average standard deviation of split frequencies: 0.016090

      375500 -- [-1266.843] (-1269.956) (-1268.992) (-1267.848) * [-1266.145] (-1269.821) (-1269.275) (-1269.206) -- 0:00:41
      376000 -- (-1267.396) [-1267.305] (-1266.881) (-1270.254) * [-1267.589] (-1267.995) (-1269.000) (-1267.329) -- 0:00:41
      376500 -- (-1268.765) [-1267.820] (-1269.596) (-1267.736) * (-1268.595) (-1268.618) [-1269.156] (-1269.387) -- 0:00:41
      377000 -- (-1269.490) (-1266.181) (-1270.214) [-1267.018] * [-1269.089] (-1267.686) (-1271.007) (-1267.434) -- 0:00:41
      377500 -- [-1266.345] (-1266.250) (-1269.116) (-1266.662) * (-1270.007) (-1268.444) (-1266.377) [-1267.446] -- 0:00:41
      378000 -- (-1267.976) (-1268.503) (-1268.110) [-1266.602] * (-1268.115) (-1270.053) (-1270.272) [-1267.920] -- 0:00:41
      378500 -- (-1274.281) (-1272.570) (-1267.806) [-1267.144] * (-1267.422) (-1269.052) [-1268.158] (-1267.681) -- 0:00:41
      379000 -- [-1272.998] (-1270.458) (-1268.374) (-1269.215) * (-1267.741) (-1269.409) [-1267.584] (-1274.590) -- 0:00:40
      379500 -- (-1268.369) (-1268.147) (-1268.145) [-1267.142] * (-1269.041) [-1266.641] (-1267.890) (-1272.891) -- 0:00:40
      380000 -- (-1276.213) (-1266.382) (-1267.521) [-1267.800] * (-1273.340) (-1272.791) [-1267.986] (-1273.537) -- 0:00:40

      Average standard deviation of split frequencies: 0.015961

      380500 -- (-1278.681) [-1267.877] (-1270.024) (-1267.260) * (-1268.612) (-1272.389) [-1267.381] (-1271.748) -- 0:00:40
      381000 -- (-1267.398) (-1266.538) [-1268.566] (-1267.294) * [-1269.153] (-1268.790) (-1271.519) (-1267.420) -- 0:00:40
      381500 -- (-1269.405) (-1273.304) (-1271.389) [-1267.875] * (-1269.646) (-1268.702) [-1268.791] (-1268.142) -- 0:00:40
      382000 -- (-1268.265) [-1267.492] (-1267.863) (-1267.283) * (-1273.631) (-1267.302) (-1268.777) [-1271.138] -- 0:00:40
      382500 -- [-1266.338] (-1267.892) (-1267.010) (-1267.712) * [-1270.127] (-1267.578) (-1267.557) (-1270.342) -- 0:00:40
      383000 -- (-1266.351) [-1269.264] (-1266.949) (-1266.633) * (-1271.621) [-1267.562] (-1266.735) (-1272.680) -- 0:00:40
      383500 -- (-1266.264) (-1267.781) [-1268.520] (-1268.373) * (-1269.809) (-1267.393) (-1266.732) [-1269.562] -- 0:00:40
      384000 -- (-1266.618) [-1269.452] (-1268.829) (-1266.616) * (-1267.792) (-1267.349) [-1266.342] (-1269.105) -- 0:00:40
      384500 -- (-1270.978) [-1267.412] (-1275.280) (-1266.775) * (-1269.329) (-1268.305) (-1266.842) [-1269.668] -- 0:00:40
      385000 -- (-1269.779) (-1267.758) (-1273.670) [-1266.827] * [-1265.908] (-1271.212) (-1268.874) (-1267.481) -- 0:00:39

      Average standard deviation of split frequencies: 0.015266

      385500 -- (-1268.583) (-1267.692) [-1267.070] (-1266.584) * (-1267.533) (-1268.179) [-1268.158] (-1269.981) -- 0:00:39
      386000 -- [-1268.138] (-1267.464) (-1269.050) (-1269.486) * (-1268.386) (-1266.395) [-1270.172] (-1271.379) -- 0:00:39
      386500 -- (-1267.767) (-1269.691) (-1267.071) [-1268.456] * (-1270.255) [-1266.382] (-1267.567) (-1267.535) -- 0:00:39
      387000 -- (-1269.382) (-1270.566) (-1266.300) [-1268.501] * (-1270.664) (-1265.869) (-1266.657) [-1267.216] -- 0:00:39
      387500 -- (-1265.924) (-1266.986) (-1266.995) [-1267.678] * (-1270.218) (-1267.603) [-1269.628] (-1267.754) -- 0:00:39
      388000 -- (-1267.003) (-1268.149) [-1266.593] (-1272.302) * [-1267.561] (-1267.673) (-1270.995) (-1270.341) -- 0:00:39
      388500 -- (-1266.716) (-1271.063) [-1268.589] (-1268.597) * [-1268.373] (-1268.334) (-1268.999) (-1271.475) -- 0:00:39
      389000 -- (-1275.282) (-1268.322) [-1268.836] (-1267.186) * (-1267.042) (-1267.353) [-1269.210] (-1267.671) -- 0:00:39
      389500 -- (-1270.670) (-1269.660) [-1274.692] (-1269.156) * (-1267.223) (-1267.012) [-1270.740] (-1269.156) -- 0:00:39
      390000 -- (-1268.601) (-1268.782) [-1270.726] (-1269.735) * (-1268.124) [-1270.259] (-1270.891) (-1267.576) -- 0:00:40

      Average standard deviation of split frequencies: 0.015284

      390500 -- [-1268.819] (-1270.567) (-1268.028) (-1269.358) * (-1268.226) [-1269.543] (-1266.367) (-1270.392) -- 0:00:40
      391000 -- (-1268.525) (-1269.479) [-1267.892] (-1267.119) * (-1268.947) (-1269.703) [-1267.828] (-1269.224) -- 0:00:40
      391500 -- (-1274.328) (-1266.561) [-1266.609] (-1269.746) * (-1268.813) (-1267.896) (-1269.377) [-1267.370] -- 0:00:40
      392000 -- (-1266.603) (-1266.967) (-1267.714) [-1268.630] * (-1269.245) [-1267.493] (-1267.185) (-1268.152) -- 0:00:40
      392500 -- (-1268.217) (-1267.767) (-1270.657) [-1267.952] * [-1266.934] (-1268.425) (-1270.972) (-1266.828) -- 0:00:40
      393000 -- (-1269.333) [-1267.715] (-1270.289) (-1267.693) * (-1268.131) (-1267.557) [-1267.681] (-1266.200) -- 0:00:40
      393500 -- [-1268.229] (-1268.245) (-1267.915) (-1270.953) * (-1267.864) [-1267.565] (-1268.074) (-1266.591) -- 0:00:40
      394000 -- [-1268.167] (-1267.088) (-1267.787) (-1271.564) * (-1267.106) (-1269.031) [-1266.086] (-1267.108) -- 0:00:39
      394500 -- [-1267.604] (-1271.158) (-1267.746) (-1266.753) * [-1269.141] (-1269.060) (-1266.785) (-1270.622) -- 0:00:39
      395000 -- [-1267.214] (-1271.608) (-1269.750) (-1266.837) * (-1269.239) [-1268.696] (-1268.476) (-1274.632) -- 0:00:39

      Average standard deviation of split frequencies: 0.015145

      395500 -- [-1267.033] (-1270.186) (-1271.594) (-1266.507) * (-1268.364) (-1271.008) (-1267.162) [-1266.786] -- 0:00:39
      396000 -- (-1268.453) (-1266.950) [-1267.386] (-1267.481) * (-1268.078) (-1271.366) [-1269.111] (-1266.786) -- 0:00:39
      396500 -- (-1268.513) [-1269.818] (-1266.933) (-1269.253) * (-1269.697) (-1266.801) [-1268.388] (-1269.124) -- 0:00:39
      397000 -- (-1267.284) (-1269.731) [-1267.695] (-1271.370) * (-1270.675) (-1268.310) [-1268.996] (-1267.325) -- 0:00:39
      397500 -- (-1266.534) (-1269.475) [-1267.897] (-1271.977) * (-1268.378) [-1266.760] (-1268.282) (-1268.631) -- 0:00:39
      398000 -- (-1267.950) (-1267.101) (-1268.633) [-1266.607] * (-1270.989) (-1266.803) [-1268.591] (-1269.975) -- 0:00:39
      398500 -- (-1267.428) (-1273.216) (-1268.856) [-1270.390] * (-1269.445) [-1266.650] (-1269.025) (-1268.750) -- 0:00:39
      399000 -- [-1266.658] (-1274.670) (-1267.069) (-1266.716) * (-1269.621) (-1269.161) [-1268.508] (-1268.512) -- 0:00:39
      399500 -- [-1266.915] (-1268.570) (-1267.515) (-1270.316) * (-1269.555) (-1268.147) (-1269.693) [-1270.049] -- 0:00:39
      400000 -- (-1266.359) (-1270.799) [-1268.474] (-1269.180) * (-1267.771) [-1267.312] (-1269.808) (-1268.751) -- 0:00:39

      Average standard deviation of split frequencies: 0.014511

      400500 -- (-1268.760) (-1269.914) [-1266.924] (-1267.848) * (-1269.862) [-1267.296] (-1268.999) (-1270.757) -- 0:00:38
      401000 -- (-1270.581) (-1267.122) (-1266.676) [-1266.037] * (-1272.576) (-1268.414) (-1267.056) [-1269.210] -- 0:00:38
      401500 -- (-1268.609) (-1271.438) [-1268.649] (-1267.905) * (-1269.122) [-1266.533] (-1269.448) (-1268.777) -- 0:00:38
      402000 -- (-1267.990) (-1271.008) (-1266.408) [-1267.007] * [-1267.857] (-1267.394) (-1270.320) (-1271.247) -- 0:00:38
      402500 -- (-1267.967) [-1267.163] (-1270.063) (-1267.307) * (-1269.622) [-1267.534] (-1266.438) (-1268.075) -- 0:00:38
      403000 -- (-1270.583) (-1269.626) (-1268.282) [-1267.075] * (-1272.051) [-1267.218] (-1269.388) (-1268.185) -- 0:00:38
      403500 -- (-1270.929) [-1268.773] (-1268.687) (-1271.089) * (-1270.863) (-1267.301) [-1268.068] (-1268.473) -- 0:00:38
      404000 -- [-1266.828] (-1267.592) (-1266.593) (-1271.005) * (-1270.239) (-1266.566) [-1268.659] (-1268.050) -- 0:00:38
      404500 -- (-1268.515) (-1268.760) [-1267.415] (-1270.694) * (-1267.443) (-1266.973) (-1270.671) [-1268.131] -- 0:00:38
      405000 -- (-1274.063) [-1268.024] (-1268.300) (-1269.893) * (-1267.533) [-1268.735] (-1266.867) (-1267.982) -- 0:00:38

      Average standard deviation of split frequencies: 0.013998

      405500 -- (-1270.358) (-1269.790) (-1267.307) [-1268.786] * (-1267.478) (-1269.886) [-1267.075] (-1266.281) -- 0:00:38
      406000 -- (-1269.718) (-1269.934) (-1267.976) [-1270.643] * (-1269.287) (-1267.749) [-1267.411] (-1267.241) -- 0:00:39
      406500 -- (-1268.214) (-1268.772) (-1267.450) [-1266.479] * [-1268.191] (-1266.422) (-1269.210) (-1267.263) -- 0:00:39
      407000 -- (-1267.975) [-1272.473] (-1268.027) (-1268.900) * (-1271.794) (-1267.028) (-1268.695) [-1267.335] -- 0:00:39
      407500 -- (-1267.468) (-1271.570) (-1268.342) [-1267.481] * (-1274.595) (-1266.146) [-1270.526] (-1270.243) -- 0:00:39
      408000 -- [-1267.105] (-1270.683) (-1266.669) (-1268.062) * (-1270.424) (-1267.076) (-1273.254) [-1269.885] -- 0:00:39
      408500 -- (-1267.623) (-1270.012) (-1269.723) [-1268.200] * (-1268.457) [-1267.519] (-1267.590) (-1270.729) -- 0:00:39
      409000 -- (-1268.478) (-1269.508) [-1269.367] (-1268.320) * (-1268.400) (-1267.970) [-1269.130] (-1267.945) -- 0:00:39
      409500 -- [-1270.846] (-1271.294) (-1267.940) (-1267.906) * (-1268.291) (-1268.035) [-1269.802] (-1268.140) -- 0:00:38
      410000 -- (-1269.252) (-1269.503) (-1267.311) [-1271.245] * (-1266.190) [-1268.381] (-1271.436) (-1267.860) -- 0:00:38

      Average standard deviation of split frequencies: 0.014604

      410500 -- [-1268.843] (-1269.392) (-1266.948) (-1270.956) * [-1267.963] (-1266.829) (-1273.457) (-1268.883) -- 0:00:38
      411000 -- [-1266.742] (-1267.097) (-1267.472) (-1269.748) * (-1266.748) (-1268.041) (-1269.496) [-1269.139] -- 0:00:38
      411500 -- (-1267.801) (-1268.749) [-1268.518] (-1270.252) * (-1267.111) (-1269.706) (-1273.040) [-1267.076] -- 0:00:38
      412000 -- (-1267.752) (-1266.913) [-1268.713] (-1268.685) * (-1267.649) (-1267.110) (-1267.200) [-1270.802] -- 0:00:38
      412500 -- (-1267.675) [-1267.854] (-1267.675) (-1269.009) * [-1267.359] (-1267.822) (-1268.175) (-1273.334) -- 0:00:38
      413000 -- [-1268.868] (-1268.710) (-1269.647) (-1269.638) * (-1266.788) [-1266.416] (-1270.984) (-1270.935) -- 0:00:38
      413500 -- (-1266.636) (-1269.718) (-1269.980) [-1268.027] * (-1269.042) (-1268.872) (-1269.172) [-1271.391] -- 0:00:38
      414000 -- (-1266.169) (-1269.035) [-1268.124] (-1268.135) * (-1267.014) [-1267.791] (-1268.830) (-1269.135) -- 0:00:38
      414500 -- (-1267.753) (-1267.681) (-1273.159) [-1267.303] * (-1266.595) (-1268.100) [-1266.306] (-1266.461) -- 0:00:38
      415000 -- (-1269.018) [-1266.763] (-1270.876) (-1267.871) * [-1268.755] (-1271.324) (-1270.385) (-1266.644) -- 0:00:38

      Average standard deviation of split frequencies: 0.014605

      415500 -- (-1277.346) (-1268.452) (-1267.684) [-1266.171] * (-1266.282) [-1267.594] (-1270.089) (-1269.370) -- 0:00:37
      416000 -- [-1267.685] (-1270.918) (-1267.180) (-1266.603) * (-1273.020) [-1266.887] (-1266.930) (-1267.748) -- 0:00:37
      416500 -- [-1268.503] (-1270.711) (-1270.664) (-1270.179) * [-1267.975] (-1269.741) (-1267.799) (-1267.464) -- 0:00:37
      417000 -- [-1268.424] (-1268.656) (-1272.442) (-1268.092) * (-1267.339) [-1268.627] (-1268.310) (-1266.656) -- 0:00:37
      417500 -- (-1269.344) (-1268.857) [-1267.869] (-1266.551) * (-1268.723) [-1267.796] (-1267.938) (-1268.775) -- 0:00:37
      418000 -- (-1269.315) (-1266.413) (-1275.427) [-1266.198] * [-1269.076] (-1267.150) (-1277.998) (-1268.366) -- 0:00:37
      418500 -- [-1268.840] (-1268.829) (-1274.575) (-1269.765) * [-1266.734] (-1268.754) (-1268.166) (-1268.514) -- 0:00:37
      419000 -- (-1267.578) (-1271.954) [-1271.715] (-1268.858) * (-1267.721) (-1266.206) [-1267.287] (-1267.686) -- 0:00:37
      419500 -- [-1266.831] (-1268.558) (-1270.503) (-1269.405) * (-1268.251) (-1267.770) [-1268.605] (-1269.161) -- 0:00:37
      420000 -- (-1266.986) [-1266.381] (-1271.268) (-1273.412) * (-1268.392) (-1267.146) [-1267.274] (-1268.830) -- 0:00:37

      Average standard deviation of split frequencies: 0.013510

      420500 -- (-1266.709) [-1266.632] (-1269.276) (-1269.195) * [-1270.030] (-1274.077) (-1270.193) (-1267.374) -- 0:00:37
      421000 -- [-1266.743] (-1268.024) (-1266.755) (-1266.814) * (-1274.557) [-1267.156] (-1268.511) (-1274.884) -- 0:00:37
      421500 -- (-1267.596) [-1267.037] (-1267.288) (-1267.089) * (-1270.643) (-1267.037) (-1266.595) [-1267.737] -- 0:00:37
      422000 -- [-1266.970] (-1267.539) (-1268.637) (-1267.718) * (-1273.604) (-1266.240) (-1268.526) [-1266.291] -- 0:00:38
      422500 -- (-1268.534) (-1269.861) [-1269.145] (-1268.776) * [-1268.869] (-1266.417) (-1266.593) (-1270.086) -- 0:00:38
      423000 -- (-1267.940) [-1266.973] (-1268.476) (-1266.882) * (-1268.778) (-1269.413) [-1267.800] (-1269.097) -- 0:00:38
      423500 -- (-1269.012) (-1267.760) (-1270.150) [-1267.244] * (-1271.821) (-1267.299) [-1267.791] (-1270.741) -- 0:00:38
      424000 -- (-1270.317) (-1267.111) [-1268.471] (-1267.020) * [-1270.113] (-1266.733) (-1266.373) (-1267.451) -- 0:00:38
      424500 -- (-1267.356) (-1271.104) (-1267.307) [-1268.067] * (-1269.491) (-1267.288) [-1266.052] (-1267.105) -- 0:00:37
      425000 -- (-1267.537) [-1271.106] (-1268.249) (-1267.125) * (-1267.600) [-1267.526] (-1266.308) (-1269.894) -- 0:00:37

      Average standard deviation of split frequencies: 0.013340

      425500 -- (-1267.114) (-1267.230) (-1269.045) [-1266.724] * [-1267.099] (-1265.938) (-1266.301) (-1269.349) -- 0:00:37
      426000 -- (-1269.326) (-1269.093) (-1268.819) [-1267.152] * (-1269.107) (-1267.383) [-1266.381] (-1267.473) -- 0:00:37
      426500 -- (-1267.777) (-1270.304) [-1273.274] (-1266.717) * (-1268.752) (-1270.939) (-1266.456) [-1267.094] -- 0:00:37
      427000 -- (-1271.957) (-1267.171) (-1269.339) [-1266.948] * (-1266.717) (-1268.118) [-1267.675] (-1267.798) -- 0:00:37
      427500 -- [-1268.092] (-1266.483) (-1266.711) (-1269.373) * (-1271.659) [-1266.104] (-1267.506) (-1266.204) -- 0:00:37
      428000 -- (-1274.412) (-1267.096) (-1267.135) [-1267.459] * [-1267.788] (-1266.435) (-1266.652) (-1269.346) -- 0:00:37
      428500 -- [-1272.261] (-1267.193) (-1266.587) (-1268.772) * [-1269.454] (-1269.076) (-1266.808) (-1268.867) -- 0:00:37
      429000 -- (-1267.417) (-1270.626) [-1267.111] (-1272.956) * (-1269.677) (-1271.229) (-1268.917) [-1267.207] -- 0:00:37
      429500 -- (-1268.060) (-1268.407) [-1266.858] (-1269.708) * (-1266.760) [-1268.724] (-1267.842) (-1267.535) -- 0:00:37
      430000 -- (-1268.696) (-1273.213) (-1268.152) [-1266.153] * (-1274.038) [-1268.311] (-1268.086) (-1266.765) -- 0:00:37

      Average standard deviation of split frequencies: 0.013650

      430500 -- (-1268.664) (-1269.404) (-1277.196) [-1267.339] * (-1274.716) [-1269.794] (-1266.911) (-1268.986) -- 0:00:37
      431000 -- (-1267.972) (-1268.284) (-1268.644) [-1267.283] * [-1269.824] (-1268.041) (-1266.376) (-1271.249) -- 0:00:36
      431500 -- (-1269.657) (-1269.510) (-1269.253) [-1267.740] * (-1266.126) (-1267.837) [-1267.744] (-1271.234) -- 0:00:36
      432000 -- (-1270.943) [-1269.616] (-1268.341) (-1267.206) * (-1268.910) (-1266.513) [-1266.963] (-1268.866) -- 0:00:36
      432500 -- (-1270.315) (-1268.636) [-1267.497] (-1267.460) * (-1268.192) [-1268.035] (-1267.164) (-1270.608) -- 0:00:36
      433000 -- [-1266.730] (-1268.435) (-1269.187) (-1269.341) * (-1267.542) (-1269.575) (-1268.651) [-1269.149] -- 0:00:36
      433500 -- (-1266.952) (-1268.836) [-1274.075] (-1271.483) * (-1269.731) [-1267.299] (-1267.462) (-1274.007) -- 0:00:36
      434000 -- (-1266.348) [-1268.641] (-1270.998) (-1269.935) * (-1268.421) [-1266.862] (-1267.200) (-1274.172) -- 0:00:36
      434500 -- [-1266.443] (-1268.402) (-1268.393) (-1267.110) * [-1268.086] (-1267.300) (-1272.466) (-1268.634) -- 0:00:36
      435000 -- [-1273.333] (-1271.922) (-1269.880) (-1267.869) * [-1267.549] (-1268.127) (-1268.780) (-1267.335) -- 0:00:36

      Average standard deviation of split frequencies: 0.013102

      435500 -- (-1267.321) (-1270.729) (-1266.824) [-1268.092] * (-1267.913) (-1268.662) [-1269.041] (-1270.679) -- 0:00:36
      436000 -- (-1266.659) (-1271.342) [-1266.668] (-1268.494) * (-1267.739) [-1267.646] (-1270.289) (-1269.371) -- 0:00:36
      436500 -- [-1267.600] (-1266.280) (-1269.457) (-1268.215) * (-1267.891) (-1269.019) [-1268.098] (-1268.958) -- 0:00:36
      437000 -- (-1269.698) [-1267.427] (-1268.251) (-1269.696) * (-1270.018) (-1271.749) [-1269.657] (-1270.547) -- 0:00:36
      437500 -- (-1269.193) (-1271.651) [-1267.303] (-1266.126) * (-1267.968) (-1273.629) (-1270.482) [-1269.440] -- 0:00:36
      438000 -- (-1266.580) (-1274.900) (-1268.249) [-1266.662] * [-1268.316] (-1270.832) (-1269.389) (-1266.592) -- 0:00:37
      438500 -- (-1268.152) [-1267.368] (-1268.130) (-1267.428) * (-1267.177) (-1268.465) (-1268.490) [-1268.646] -- 0:00:37
      439000 -- (-1270.030) [-1268.284] (-1265.775) (-1267.227) * (-1266.552) (-1273.421) (-1268.547) [-1271.513] -- 0:00:37
      439500 -- [-1267.946] (-1269.834) (-1268.027) (-1267.129) * (-1267.334) (-1269.045) [-1267.974] (-1267.042) -- 0:00:36
      440000 -- (-1267.741) [-1267.984] (-1271.417) (-1268.001) * (-1266.573) (-1269.065) (-1267.337) [-1266.571] -- 0:00:36

      Average standard deviation of split frequencies: 0.013340

      440500 -- (-1266.757) [-1269.793] (-1269.664) (-1267.722) * (-1269.938) (-1266.899) (-1270.823) [-1270.103] -- 0:00:36
      441000 -- (-1269.050) (-1267.477) (-1265.902) [-1267.935] * (-1269.929) (-1266.070) (-1270.153) [-1268.020] -- 0:00:36
      441500 -- (-1266.613) (-1269.843) [-1266.963] (-1268.407) * (-1267.915) (-1267.099) (-1268.757) [-1270.327] -- 0:00:36
      442000 -- (-1266.575) (-1266.835) (-1271.419) [-1269.243] * [-1266.114] (-1269.402) (-1267.993) (-1270.127) -- 0:00:36
      442500 -- (-1270.831) (-1266.656) [-1268.713] (-1268.501) * (-1265.917) (-1266.434) [-1268.077] (-1268.123) -- 0:00:36
      443000 -- (-1267.182) (-1267.720) [-1268.906] (-1266.031) * (-1266.391) (-1266.454) (-1272.868) [-1268.875] -- 0:00:36
      443500 -- (-1267.287) [-1268.181] (-1269.245) (-1267.448) * (-1267.045) [-1267.695] (-1267.667) (-1266.995) -- 0:00:36
      444000 -- [-1270.006] (-1268.443) (-1269.831) (-1269.002) * (-1266.426) (-1266.732) [-1266.175] (-1266.995) -- 0:00:36
      444500 -- [-1268.190] (-1270.266) (-1270.833) (-1270.841) * (-1267.524) [-1270.952] (-1268.042) (-1267.614) -- 0:00:36
      445000 -- (-1268.046) (-1268.457) (-1268.450) [-1269.632] * (-1268.359) (-1270.714) [-1267.084] (-1269.603) -- 0:00:36

      Average standard deviation of split frequencies: 0.013989

      445500 -- (-1266.324) (-1266.421) [-1267.382] (-1266.720) * (-1269.625) [-1268.859] (-1267.216) (-1270.571) -- 0:00:36
      446000 -- (-1266.079) (-1271.024) (-1268.790) [-1266.535] * [-1268.448] (-1267.048) (-1267.154) (-1268.149) -- 0:00:36
      446500 -- (-1267.234) [-1268.355] (-1267.834) (-1266.608) * [-1270.416] (-1266.900) (-1269.018) (-1266.862) -- 0:00:35
      447000 -- (-1268.526) (-1266.901) [-1269.419] (-1270.855) * (-1269.568) (-1269.570) (-1270.263) [-1267.978] -- 0:00:35
      447500 -- (-1268.858) (-1267.361) [-1267.145] (-1269.928) * [-1266.913] (-1270.899) (-1267.499) (-1268.411) -- 0:00:35
      448000 -- (-1266.547) (-1268.388) (-1267.104) [-1269.008] * (-1268.610) (-1271.133) [-1268.986] (-1267.564) -- 0:00:35
      448500 -- [-1266.189] (-1268.326) (-1267.457) (-1266.770) * [-1267.727] (-1267.054) (-1267.122) (-1266.630) -- 0:00:35
      449000 -- (-1267.836) [-1267.845] (-1267.912) (-1268.228) * (-1268.709) (-1268.797) (-1270.167) [-1268.360] -- 0:00:35
      449500 -- (-1267.419) (-1268.358) [-1266.387] (-1267.002) * (-1266.434) [-1268.369] (-1269.386) (-1268.168) -- 0:00:35
      450000 -- (-1267.948) (-1272.410) [-1268.514] (-1266.664) * [-1266.024] (-1270.544) (-1268.040) (-1267.045) -- 0:00:35

      Average standard deviation of split frequencies: 0.013714

      450500 -- (-1267.059) [-1270.129] (-1268.626) (-1268.836) * (-1268.029) (-1277.515) (-1269.470) [-1267.743] -- 0:00:35
      451000 -- (-1266.812) (-1267.627) (-1266.926) [-1268.010] * (-1270.413) (-1269.039) (-1271.059) [-1268.837] -- 0:00:35
      451500 -- (-1271.543) (-1268.577) [-1268.715] (-1267.944) * [-1268.708] (-1268.730) (-1273.957) (-1268.173) -- 0:00:35
      452000 -- (-1267.767) (-1267.787) (-1271.301) [-1267.351] * (-1268.858) (-1266.707) (-1270.397) [-1268.852] -- 0:00:35
      452500 -- [-1266.952] (-1267.655) (-1267.844) (-1268.765) * (-1268.250) (-1267.616) [-1267.365] (-1269.016) -- 0:00:35
      453000 -- (-1266.952) (-1267.711) (-1269.631) [-1267.679] * (-1269.093) (-1270.855) (-1272.633) [-1267.302] -- 0:00:35
      453500 -- (-1268.073) (-1269.680) [-1265.728] (-1274.125) * (-1273.254) (-1271.485) (-1267.661) [-1267.697] -- 0:00:34
      454000 -- [-1266.343] (-1274.087) (-1269.465) (-1272.525) * [-1268.759] (-1267.985) (-1271.295) (-1267.799) -- 0:00:36
      454500 -- [-1268.010] (-1268.153) (-1267.161) (-1267.749) * (-1277.812) (-1267.907) (-1271.766) [-1271.213] -- 0:00:36
      455000 -- (-1268.238) (-1267.693) (-1266.955) [-1268.664] * (-1270.432) [-1267.241] (-1270.165) (-1270.684) -- 0:00:35

      Average standard deviation of split frequencies: 0.013561

      455500 -- [-1270.691] (-1266.506) (-1266.163) (-1266.646) * (-1268.068) [-1267.066] (-1267.127) (-1269.873) -- 0:00:35
      456000 -- (-1271.365) (-1268.249) (-1265.977) [-1266.471] * [-1266.029] (-1268.469) (-1270.989) (-1268.484) -- 0:00:35
      456500 -- (-1269.491) (-1268.396) (-1267.186) [-1269.835] * (-1266.629) (-1267.083) (-1267.156) [-1267.038] -- 0:00:35
      457000 -- (-1270.430) (-1268.603) [-1267.908] (-1267.747) * [-1266.734] (-1266.720) (-1267.951) (-1268.869) -- 0:00:35
      457500 -- (-1271.931) (-1268.318) [-1269.177] (-1269.717) * (-1266.559) (-1266.515) (-1268.637) [-1270.509] -- 0:00:35
      458000 -- (-1268.715) (-1269.110) [-1269.371] (-1268.573) * [-1267.443] (-1268.498) (-1268.158) (-1267.177) -- 0:00:35
      458500 -- (-1269.443) (-1268.300) [-1269.359] (-1268.079) * (-1269.855) [-1266.398] (-1269.413) (-1270.948) -- 0:00:35
      459000 -- (-1267.934) [-1266.952] (-1272.156) (-1270.058) * (-1269.837) (-1268.368) (-1270.179) [-1273.849] -- 0:00:35
      459500 -- (-1266.072) (-1269.845) [-1268.522] (-1266.608) * (-1266.327) (-1269.139) (-1274.034) [-1267.369] -- 0:00:35
      460000 -- [-1269.339] (-1268.315) (-1267.673) (-1268.217) * (-1267.785) [-1268.955] (-1272.786) (-1267.242) -- 0:00:35

      Average standard deviation of split frequencies: 0.013423

      460500 -- (-1271.396) (-1269.583) [-1267.869] (-1267.151) * (-1267.450) (-1269.225) [-1270.125] (-1267.522) -- 0:00:35
      461000 -- (-1270.885) (-1270.370) [-1268.714] (-1267.546) * (-1267.205) (-1267.352) (-1276.154) [-1267.272] -- 0:00:35
      461500 -- (-1266.042) (-1270.321) (-1266.526) [-1268.365] * (-1267.040) (-1267.165) (-1266.792) [-1269.573] -- 0:00:35
      462000 -- (-1267.223) [-1271.344] (-1269.123) (-1270.416) * (-1265.900) (-1266.199) (-1269.430) [-1271.260] -- 0:00:34
      462500 -- [-1268.391] (-1266.582) (-1268.368) (-1267.258) * (-1267.099) (-1266.294) [-1266.962] (-1269.592) -- 0:00:34
      463000 -- (-1266.278) (-1267.830) (-1267.896) [-1265.875] * (-1266.138) (-1267.476) (-1268.531) [-1269.251] -- 0:00:34
      463500 -- (-1268.132) [-1266.614] (-1267.242) (-1266.145) * (-1268.525) (-1267.378) [-1268.652] (-1269.080) -- 0:00:34
      464000 -- (-1269.178) (-1266.750) (-1267.857) [-1267.479] * (-1269.302) (-1270.071) (-1269.863) [-1271.593] -- 0:00:34
      464500 -- [-1267.066] (-1268.829) (-1268.486) (-1268.166) * [-1267.387] (-1269.034) (-1267.098) (-1268.330) -- 0:00:34
      465000 -- [-1267.743] (-1268.817) (-1271.842) (-1269.127) * (-1272.400) (-1273.316) [-1270.353] (-1267.550) -- 0:00:34

      Average standard deviation of split frequencies: 0.013746

      465500 -- [-1272.249] (-1267.902) (-1269.906) (-1268.751) * (-1268.868) (-1270.231) (-1269.055) [-1270.172] -- 0:00:34
      466000 -- (-1269.261) (-1270.897) (-1268.089) [-1267.729] * [-1267.617] (-1267.548) (-1274.017) (-1268.920) -- 0:00:34
      466500 -- (-1268.597) (-1269.281) [-1267.174] (-1267.376) * (-1273.107) [-1272.492] (-1269.333) (-1268.738) -- 0:00:34
      467000 -- (-1268.267) (-1272.077) (-1267.468) [-1268.966] * (-1272.327) (-1269.769) (-1271.868) [-1270.746] -- 0:00:34
      467500 -- (-1269.186) (-1268.644) [-1271.871] (-1268.718) * (-1273.206) [-1269.624] (-1268.653) (-1268.983) -- 0:00:34
      468000 -- [-1269.103] (-1266.669) (-1273.787) (-1267.981) * (-1267.398) [-1268.916] (-1267.512) (-1268.593) -- 0:00:34
      468500 -- [-1268.429] (-1266.683) (-1270.801) (-1270.047) * [-1267.613] (-1269.970) (-1266.491) (-1268.102) -- 0:00:34
      469000 -- [-1266.045] (-1267.517) (-1268.874) (-1273.104) * (-1267.226) (-1268.365) [-1268.489] (-1268.066) -- 0:00:33
      469500 -- [-1270.454] (-1272.390) (-1268.723) (-1268.226) * (-1270.704) (-1268.200) [-1267.718] (-1267.499) -- 0:00:33
      470000 -- (-1266.331) (-1266.875) (-1267.623) [-1272.863] * (-1269.100) (-1267.275) [-1268.738] (-1267.340) -- 0:00:33

      Average standard deviation of split frequencies: 0.014375

      470500 -- [-1266.670] (-1266.200) (-1267.993) (-1269.758) * [-1269.267] (-1268.166) (-1269.151) (-1272.876) -- 0:00:34
      471000 -- (-1266.739) [-1266.278] (-1269.942) (-1266.788) * (-1268.512) (-1267.111) (-1269.301) [-1268.544] -- 0:00:34
      471500 -- [-1266.709] (-1269.867) (-1267.350) (-1266.816) * (-1267.279) (-1268.524) [-1266.602] (-1269.165) -- 0:00:34
      472000 -- (-1267.411) (-1269.061) (-1267.953) [-1267.200] * (-1268.374) (-1273.486) (-1269.870) [-1267.401] -- 0:00:34
      472500 -- (-1266.317) (-1267.373) [-1270.542] (-1267.033) * [-1271.189] (-1270.410) (-1269.342) (-1268.654) -- 0:00:34
      473000 -- [-1266.896] (-1273.603) (-1270.005) (-1268.479) * (-1270.206) (-1269.213) [-1268.565] (-1270.255) -- 0:00:34
      473500 -- [-1266.672] (-1267.978) (-1266.789) (-1270.514) * [-1266.521] (-1267.546) (-1271.902) (-1269.367) -- 0:00:34
      474000 -- [-1266.667] (-1267.464) (-1267.191) (-1266.197) * (-1266.329) [-1267.098] (-1271.234) (-1270.208) -- 0:00:34
      474500 -- [-1267.473] (-1268.850) (-1267.687) (-1266.818) * (-1268.899) (-1267.280) (-1266.410) [-1269.812] -- 0:00:34
      475000 -- [-1269.696] (-1268.795) (-1273.550) (-1267.437) * [-1268.954] (-1268.662) (-1267.182) (-1267.135) -- 0:00:34

      Average standard deviation of split frequencies: 0.014447

      475500 -- [-1270.514] (-1267.031) (-1267.222) (-1269.805) * [-1269.824] (-1268.231) (-1269.184) (-1267.135) -- 0:00:34
      476000 -- (-1270.968) [-1268.655] (-1268.752) (-1268.561) * (-1272.583) [-1269.816] (-1266.617) (-1267.272) -- 0:00:34
      476500 -- (-1267.816) (-1266.686) (-1269.973) [-1271.118] * (-1267.145) (-1269.875) [-1267.057] (-1270.369) -- 0:00:34
      477000 -- [-1268.129] (-1267.336) (-1270.611) (-1270.584) * (-1266.780) (-1267.710) [-1271.873] (-1270.310) -- 0:00:33
      477500 -- [-1269.712] (-1266.750) (-1267.311) (-1271.067) * [-1266.471] (-1267.931) (-1269.013) (-1269.507) -- 0:00:33
      478000 -- [-1268.694] (-1266.267) (-1267.617) (-1268.516) * [-1266.293] (-1273.974) (-1266.407) (-1267.390) -- 0:00:33
      478500 -- (-1268.799) (-1267.679) (-1266.907) [-1268.555] * (-1267.025) (-1268.848) (-1267.384) [-1267.798] -- 0:00:33
      479000 -- (-1272.166) [-1268.241] (-1267.539) (-1267.080) * (-1267.665) (-1270.153) [-1270.104] (-1268.734) -- 0:00:33
      479500 -- (-1267.341) [-1267.486] (-1267.489) (-1266.913) * [-1268.209] (-1270.740) (-1269.306) (-1267.660) -- 0:00:33
      480000 -- (-1267.994) (-1269.893) [-1268.651] (-1266.487) * (-1267.074) (-1266.524) (-1268.660) [-1268.277] -- 0:00:33

      Average standard deviation of split frequencies: 0.014365

      480500 -- (-1267.835) (-1269.405) [-1268.504] (-1268.715) * (-1266.749) [-1266.476] (-1266.416) (-1269.671) -- 0:00:33
      481000 -- (-1267.476) (-1267.444) [-1268.878] (-1267.182) * (-1266.786) (-1268.063) [-1266.301] (-1269.991) -- 0:00:33
      481500 -- (-1267.478) [-1267.823] (-1273.148) (-1266.524) * (-1268.851) [-1267.977] (-1268.568) (-1267.376) -- 0:00:33
      482000 -- (-1267.635) (-1267.168) [-1267.112] (-1269.118) * [-1269.522] (-1268.521) (-1267.535) (-1269.022) -- 0:00:33
      482500 -- (-1268.372) [-1266.635] (-1267.143) (-1267.400) * (-1268.609) (-1270.982) (-1268.680) [-1267.889] -- 0:00:33
      483000 -- (-1268.758) [-1266.905] (-1268.513) (-1268.543) * (-1269.224) (-1270.624) (-1267.512) [-1267.476] -- 0:00:33
      483500 -- (-1266.014) (-1266.440) (-1267.716) [-1270.606] * [-1268.899] (-1267.044) (-1266.700) (-1267.371) -- 0:00:33
      484000 -- (-1267.323) (-1268.666) [-1268.592] (-1270.482) * (-1266.953) (-1270.064) [-1268.735] (-1268.695) -- 0:00:33
      484500 -- (-1272.627) [-1266.252] (-1271.106) (-1268.078) * (-1267.120) [-1267.427] (-1267.760) (-1270.064) -- 0:00:32
      485000 -- (-1268.513) [-1266.200] (-1273.021) (-1269.448) * (-1272.154) [-1271.072] (-1270.433) (-1269.051) -- 0:00:32

      Average standard deviation of split frequencies: 0.014892

      485500 -- [-1268.551] (-1269.142) (-1269.048) (-1271.033) * (-1269.102) (-1269.337) [-1267.993] (-1267.123) -- 0:00:32
      486000 -- (-1269.004) [-1267.311] (-1269.001) (-1268.253) * [-1267.535] (-1268.839) (-1269.288) (-1274.982) -- 0:00:32
      486500 -- [-1270.643] (-1267.723) (-1267.805) (-1270.561) * (-1270.244) [-1268.554] (-1269.252) (-1268.825) -- 0:00:33
      487000 -- (-1270.090) [-1269.156] (-1267.833) (-1268.163) * (-1268.909) [-1270.530] (-1269.823) (-1269.419) -- 0:00:33
      487500 -- (-1267.249) [-1271.069] (-1268.556) (-1270.462) * [-1267.306] (-1270.155) (-1271.593) (-1269.718) -- 0:00:33
      488000 -- [-1268.515] (-1269.565) (-1269.826) (-1268.814) * (-1267.566) (-1269.957) (-1271.499) [-1271.504] -- 0:00:33
      488500 -- (-1273.201) [-1267.710] (-1267.961) (-1270.442) * (-1271.894) (-1270.968) [-1268.242] (-1269.819) -- 0:00:33
      489000 -- (-1272.069) [-1267.317] (-1268.353) (-1269.582) * (-1266.630) [-1272.015] (-1267.249) (-1266.441) -- 0:00:33
      489500 -- (-1270.769) (-1267.599) (-1269.187) [-1268.070] * (-1266.433) [-1266.703] (-1267.512) (-1270.358) -- 0:00:33
      490000 -- (-1269.858) [-1268.047] (-1267.980) (-1268.511) * (-1266.430) (-1267.356) (-1267.075) [-1270.161] -- 0:00:33

      Average standard deviation of split frequencies: 0.014242

      490500 -- (-1268.964) (-1267.930) (-1267.929) [-1267.640] * (-1268.436) (-1272.449) [-1267.325] (-1267.133) -- 0:00:33
      491000 -- [-1267.211] (-1267.439) (-1271.294) (-1267.908) * (-1266.335) (-1267.195) (-1266.293) [-1266.211] -- 0:00:33
      491500 -- (-1269.566) (-1268.902) [-1266.771] (-1272.603) * (-1266.335) (-1268.975) [-1270.923] (-1266.599) -- 0:00:33
      492000 -- (-1271.491) [-1268.954] (-1267.350) (-1271.274) * [-1268.761] (-1267.754) (-1267.705) (-1266.811) -- 0:00:33
      492500 -- [-1266.474] (-1268.588) (-1270.339) (-1267.396) * (-1267.535) (-1267.116) (-1267.850) [-1267.775] -- 0:00:32
      493000 -- [-1267.631] (-1268.070) (-1269.287) (-1269.598) * (-1268.456) (-1266.647) [-1266.169] (-1267.497) -- 0:00:32
      493500 -- (-1267.652) (-1268.034) [-1272.361] (-1267.352) * (-1268.951) (-1268.629) [-1267.273] (-1269.598) -- 0:00:32
      494000 -- (-1269.596) (-1268.390) [-1269.618] (-1268.626) * (-1268.019) (-1268.627) (-1267.739) [-1270.433] -- 0:00:32
      494500 -- (-1267.939) [-1267.472] (-1269.975) (-1266.630) * [-1266.532] (-1269.897) (-1268.280) (-1273.283) -- 0:00:32
      495000 -- (-1267.037) (-1267.612) [-1270.490] (-1269.740) * (-1267.666) [-1271.997] (-1267.322) (-1270.398) -- 0:00:32

      Average standard deviation of split frequencies: 0.014200

      495500 -- [-1266.763] (-1268.040) (-1267.964) (-1270.376) * (-1267.549) [-1272.080] (-1270.125) (-1268.040) -- 0:00:32
      496000 -- (-1267.014) (-1267.523) (-1266.649) [-1266.322] * (-1267.704) [-1269.432] (-1266.558) (-1269.877) -- 0:00:32
      496500 -- (-1268.180) [-1266.310] (-1266.181) (-1266.697) * [-1268.621] (-1267.471) (-1266.564) (-1268.328) -- 0:00:32
      497000 -- [-1266.419] (-1268.543) (-1270.476) (-1269.882) * (-1270.147) (-1268.785) (-1266.463) [-1266.377] -- 0:00:32
      497500 -- [-1271.572] (-1273.152) (-1271.254) (-1269.791) * (-1268.469) (-1266.940) [-1266.079] (-1267.728) -- 0:00:32
      498000 -- [-1268.124] (-1269.068) (-1271.449) (-1266.056) * (-1267.775) (-1267.052) [-1266.419] (