--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:00:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1596/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1899.52         -1902.82
2      -1899.43         -1903.18
--------------------------------------
TOTAL    -1899.47         -1903.02
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890343    0.090479    0.361522    1.489467    0.848754   1346.26   1423.63    1.000
r(A<->C){all}   0.171131    0.020523    0.000083    0.451431    0.134471    246.83    255.28    1.001
r(A<->G){all}   0.155231    0.017542    0.000004    0.429716    0.120191    104.95    226.27    1.000
r(A<->T){all}   0.167145    0.018633    0.000009    0.432322    0.131371    230.56    265.86    1.000
r(C<->G){all}   0.185717    0.023860    0.000001    0.498165    0.150542    122.97    182.46    1.000
r(C<->T){all}   0.144735    0.017154    0.000036    0.422077    0.104458    269.66    274.72    1.000
r(G<->T){all}   0.176041    0.021750    0.000083    0.479239    0.140061    157.43    174.03    1.000
pi(A){all}      0.169522    0.000097    0.149535    0.188209    0.169576   1106.67   1181.36    1.000
pi(C){all}      0.299868    0.000146    0.275254    0.322685    0.299516   1161.15   1167.28    1.000
pi(G){all}      0.327130    0.000163    0.300688    0.350755    0.327407   1206.37   1291.03    1.000
pi(T){all}      0.203480    0.000117    0.182224    0.224083    0.203363   1081.20   1177.66    1.000
alpha{1,2}      0.425939    0.241212    0.000111    1.418341    0.251728   1137.93   1150.81    1.000
alpha{3}        0.468755    0.254877    0.000112    1.508745    0.300763   1180.39   1240.01    1.000
pinvar{all}     0.998908    0.000002    0.996374    0.999999    0.999327    969.10   1077.73    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1851.443134
Model 2: PositiveSelection	-1851.442992
Model 0: one-ratio	-1851.442991
Model 7: beta	-1851.443134
Model 8: beta&w>1	-1851.442991


Model 0 vs 1	2.860000004147878E-4

Model 2 vs 1	2.8400000019246363E-4

Model 8 vs 7	2.860000004147878E-4
>C1
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C2
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C3
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C4
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C5
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C6
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=468 

C1              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C2              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C3              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C4              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C5              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C6              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
                **************************************************

C1              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C2              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C3              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C4              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C5              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C6              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
                **************************************************

C1              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C2              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C3              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C4              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C5              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C6              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
                **************************************************

C1              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C2              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C3              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C4              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C5              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C6              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
                **************************************************

C1              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C2              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C3              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C4              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C5              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C6              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
                **************************************************

C1              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C2              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C3              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C4              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C5              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C6              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
                **************************************************

C1              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C2              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C3              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C4              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C5              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C6              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
                **************************************************

C1              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C2              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C3              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C4              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C5              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C6              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
                **************************************************

C1              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C2              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C3              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C4              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C5              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C6              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
                **************************************************

C1              LAFELEEARPWARIQIGD
C2              LAFELEEARPWARIQIGD
C3              LAFELEEARPWARIQIGD
C4              LAFELEEARPWARIQIGD
C5              LAFELEEARPWARIQIGD
C6              LAFELEEARPWARIQIGD
                ******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  468 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  468 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14040]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [14040]--->[14040]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.552 Mb, Max= 31.061 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C2              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C3              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C4              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C5              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
C6              MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
                **************************************************

C1              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C2              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C3              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C4              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C5              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
C6              GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
                **************************************************

C1              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C2              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C3              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C4              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C5              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
C6              NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
                **************************************************

C1              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C2              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C3              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C4              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C5              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
C6              TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
                **************************************************

C1              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C2              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C3              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C4              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C5              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
C6              LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
                **************************************************

C1              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C2              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C3              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C4              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C5              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
C6              GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
                **************************************************

C1              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C2              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C3              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C4              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C5              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
C6              NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
                **************************************************

C1              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C2              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C3              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C4              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C5              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
C6              RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
                **************************************************

C1              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C2              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C3              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C4              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C5              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
C6              DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
                **************************************************

C1              LAFELEEARPWARIQIGD
C2              LAFELEEARPWARIQIGD
C3              LAFELEEARPWARIQIGD
C4              LAFELEEARPWARIQIGD
C5              LAFELEEARPWARIQIGD
C6              LAFELEEARPWARIQIGD
                ******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
C2              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
C3              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
C4              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
C5              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
C6              ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
                **************************************************

C1              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
C2              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
C3              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
C4              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
C5              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
C6              GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
                **************************************************

C1              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
C2              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
C3              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
C4              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
C5              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
C6              TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
                **************************************************

C1              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
C2              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
C3              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
C4              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
C5              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
C6              GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
                **************************************************

C1              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
C2              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
C3              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
C4              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
C5              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
C6              AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
                **************************************************

C1              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
C2              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
C3              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
C4              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
C5              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
C6              ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
                **************************************************

C1              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
C2              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
C3              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
C4              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
C5              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
C6              AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
                **************************************************

C1              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
C2              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
C3              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
C4              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
C5              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
C6              GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
                **************************************************

C1              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
C2              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
C3              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
C4              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
C5              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
C6              CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
                **************************************************

C1              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
C2              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
C3              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
C4              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
C5              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
C6              ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
                **************************************************

C1              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
C2              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
C3              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
C4              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
C5              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
C6              AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
                **************************************************

C1              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
C2              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
C3              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
C4              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
C5              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
C6              CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
                **************************************************

C1              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
C2              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
C3              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
C4              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
C5              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
C6              CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
                **************************************************

C1              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
C2              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
C3              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
C4              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
C5              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
C6              GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
                **************************************************

C1              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
C2              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
C3              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
C4              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
C5              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
C6              GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
                **************************************************

C1              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
C2              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
C3              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
C4              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
C5              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
C6              GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
                **************************************************

C1              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
C2              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
C3              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
C4              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
C5              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
C6              GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
                **************************************************

C1              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
C2              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
C3              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
C4              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
C5              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
C6              AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
                **************************************************

C1              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
C2              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
C3              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
C4              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
C5              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
C6              AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
                **************************************************

C1              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
C2              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
C3              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
C4              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
C5              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
C6              GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
                **************************************************

C1              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
C2              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
C3              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
C4              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
C5              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
C6              TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
                **************************************************

C1              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
C2              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
C3              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
C4              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
C5              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
C6              CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
                **************************************************

C1              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
C2              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
C3              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
C4              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
C5              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
C6              TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
                **************************************************

C1              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
C2              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
C3              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
C4              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
C5              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
C6              AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
                **************************************************

C1              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
C2              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
C3              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
C4              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
C5              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
C6              GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
                **************************************************

C1              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
C2              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
C3              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
C4              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
C5              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
C6              GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
                **************************************************

C1              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
C2              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
C3              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
C4              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
C5              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
C6              TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
                **************************************************

C1              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
C2              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
C3              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
C4              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
C5              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
C6              CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
                **************************************************

C1              CGAC
C2              CGAC
C3              CGAC
C4              CGAC
C5              CGAC
C6              CGAC
                ****



>C1
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C2
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C3
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C4
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C5
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C6
ATGCAACGTGTGCACGCTTTCGGTGACGACGCCCTCGGCGATCTCGACGC
GGTCGGTCTAGCCGACGCTATCCGAGCCGGTTGGGTCAGCAGAGCCGATG
TCATCGAGGCGGCCATTGTGCGGACCGAGGCCGTTAACCCGGCCTTGGGT
GGCTTGGCTTATGAGGCGTTTCAGTGGGCTCGGCAGACCGCGTCGAAAGC
AGGCAGTGGCTTCTTTAGCGGTGTCCCGACCTTCATCAAGGACAACATCG
ATGTCGCTGGACAGCCGACGATGCGTGGCAGCGACGCATGGGTGCCCCGA
AATGCGTTCGACGACGGAGAGTTCACCCGGCTGTATTTGGCCACCGGACC
GGTATCTTTGGGCAAGACGCAGTTGTCAGAATTCGGGTTCAGCGCCTCCG
CTGAACATATGCGTCTAGGGCCGGTTCGCAACCCATGGGACACCGACTAC
ACTGCCGGGGCCTCGTCTTCGGGATCGGGTGCGTTCGTCGCCGCCGGTGT
AGTCCCGATGGCGCACGCCAACGATGGTGGCGGGTCGATTCGTATTCCGG
CCTCCTGCAACGGGCTTGTCGGGCTCAAGCCGTCACGCGGACGATTGCCG
CTGGATTCCGAGCTGCGCCGGCTTCCGGTGGGCATCGTAGTCAACGGCGT
GCTGACCCGCTCGGTGCGGGACACTGCGGCCTTCTATAGAGAGGCTGAGC
GTATTTGGCACAACCCCAAGCTGCCGCCGGTCGGAGACGTCACGCAGCCC
GGTCGGCAACGGCTTCGGATTGCCGTGGTGACGCGTTCGGTTCAGCGCGA
GTGTAGCCCCGAACTACGCGAGCTCACACTGAAGTCGGCTAGGCTGCTCG
AGGAGCTGGGCCATCGCGTCGAACGGGTTGCCGAGCCCCCGGTGCCGCCT
AATTTCCCGGACGATTTCCTGCTGTATTGGGGACTGTTGGCGGCGATGCA
GGTGCGGACCGGCCGGCTCGCGTTCGGCAACACGTTCGACCGCACCAAGC
TGGACAGTTTGACGCTGGGCCTGGATCGCCACGCCAGCCGCAACATGCAC
CGGCTCCCCAAGGCAATCATGCGTTTGCGTAGGCTGCGGCGTCGCACCGC
TGACTTTTTCGCTACCTACGATGTATTACTTACTCCAACGGTCGCTGACG
AGACACCGCGGATAGGGTACCTCACTCCCACCGACTATCAGCAGGTGATG
GACCGGCTGATGGGCTGGGTCGCTTTCACTCCGTTGCAAAACGTCACTGG
GGAGCCGGCGATTTCGCTGCCGTTGGCCCAATCCGCTGATGGTATGCCGG
TGGGCATGATGTTCACCGCTGACTTTGGTCAGGAAGCGCAACTATTGGAA
CTGGCATTTGAACTCGAAGAGGCTCGGCCGTGGGCGCGGATTCAAATTGG
CGAC
>C1
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C2
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C3
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C4
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C5
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD
>C6
MQRVHAFGDDALGDLDAVGLADAIRAGWVSRADVIEAAIVRTEAVNPALG
GLAYEAFQWARQTASKAGSGFFSGVPTFIKDNIDVAGQPTMRGSDAWVPR
NAFDDGEFTRLYLATGPVSLGKTQLSEFGFSASAEHMRLGPVRNPWDTDY
TAGASSSGSGAFVAAGVVPMAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDSELRRLPVGIVVNGVLTRSVRDTAAFYREAERIWHNPKLPPVGDVTQP
GRQRLRIAVVTRSVQRECSPELRELTLKSARLLEELGHRVERVAEPPVPP
NFPDDFLLYWGLLAAMQVRTGRLAFGNTFDRTKLDSLTLGLDRHASRNMH
RLPKAIMRLRRLRRRTADFFATYDVLLTPTVADETPRIGYLTPTDYQQVM
DRLMGWVAFTPLQNVTGEPAISLPLAQSADGMPVGMMFTADFGQEAQLLE
LAFELEEARPWARIQIGD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1404 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856354
      Setting output file names to "/data/7res/ML1596/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 406384402
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5331278406
      Seed = 229316443
      Swapseed = 1579856354
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3142.219305 -- -24.965149
         Chain 2 -- -3142.219123 -- -24.965149
         Chain 3 -- -3142.219305 -- -24.965149
         Chain 4 -- -3142.219305 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3142.219305 -- -24.965149
         Chain 2 -- -3142.219305 -- -24.965149
         Chain 3 -- -3142.219305 -- -24.965149
         Chain 4 -- -3142.218826 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3142.219] (-3142.219) (-3142.219) (-3142.219) * [-3142.219] (-3142.219) (-3142.219) (-3142.219) 
        500 -- [-1917.147] (-1951.745) (-1918.590) (-1938.189) * (-1948.377) [-1919.521] (-1926.889) (-1909.828) -- 0:00:00
       1000 -- (-1908.341) (-1918.124) (-1907.555) [-1906.513] * [-1915.380] (-1915.680) (-1931.912) (-1904.595) -- 0:00:00
       1500 -- (-1906.706) [-1913.106] (-1906.013) (-1904.824) * (-1913.544) (-1910.448) (-1909.730) [-1906.809] -- 0:00:00
       2000 -- (-1910.811) (-1905.328) [-1910.009] (-1901.937) * (-1906.971) (-1912.801) [-1908.859] (-1902.413) -- 0:00:00
       2500 -- [-1908.307] (-1911.420) (-1916.750) (-1909.931) * [-1911.450] (-1911.057) (-1905.944) (-1908.534) -- 0:00:00
       3000 -- (-1912.409) (-1910.912) (-1905.844) [-1912.847] * (-1908.261) [-1909.235] (-1914.327) (-1907.949) -- 0:00:00
       3500 -- (-1905.383) (-1906.720) [-1909.248] (-1909.374) * (-1906.772) [-1910.731] (-1913.930) (-1909.035) -- 0:00:00
       4000 -- (-1908.535) (-1912.263) (-1912.000) [-1912.109] * [-1908.112] (-1913.750) (-1907.948) (-1908.071) -- 0:00:00
       4500 -- (-1908.144) (-1908.130) (-1911.887) [-1906.673] * (-1912.495) (-1905.063) (-1915.286) [-1903.175] -- 0:00:00
       5000 -- (-1910.255) [-1908.861] (-1903.778) (-1910.412) * (-1905.028) (-1908.202) [-1910.045] (-1908.742) -- 0:00:00

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-1906.608) (-1905.210) [-1906.295] (-1911.221) * (-1911.645) (-1914.113) (-1909.158) [-1908.979] -- 0:00:00
       6000 -- (-1907.021) (-1905.976) [-1906.892] (-1910.211) * [-1908.717] (-1913.373) (-1911.674) (-1913.263) -- 0:00:00
       6500 -- (-1909.461) (-1909.545) [-1904.911] (-1912.075) * (-1908.962) [-1905.748] (-1907.822) (-1912.952) -- 0:00:00
       7000 -- [-1907.612] (-1908.571) (-1912.811) (-1913.664) * [-1909.180] (-1910.951) (-1910.976) (-1913.756) -- 0:00:00
       7500 -- (-1904.640) [-1904.732] (-1914.226) (-1907.138) * (-1911.491) (-1913.970) [-1908.462] (-1909.987) -- 0:00:00
       8000 -- [-1907.573] (-1908.594) (-1907.707) (-1910.916) * (-1906.101) [-1909.082] (-1907.635) (-1913.826) -- 0:00:00
       8500 -- (-1909.185) (-1909.489) [-1909.276] (-1910.889) * (-1906.123) (-1907.524) [-1905.445] (-1916.063) -- 0:00:00
       9000 -- [-1914.194] (-1910.441) (-1904.859) (-1910.814) * (-1905.058) [-1917.631] (-1911.023) (-1911.869) -- 0:00:00
       9500 -- (-1908.844) (-1912.909) [-1908.839] (-1922.986) * [-1907.620] (-1914.715) (-1906.939) (-1914.149) -- 0:00:00
      10000 -- (-1915.495) [-1915.160] (-1910.336) (-1915.600) * [-1905.319] (-1906.995) (-1915.956) (-1923.095) -- 0:00:00

      Average standard deviation of split frequencies: 0.081023

      10500 -- (-1907.838) (-1909.158) [-1916.709] (-1912.770) * [-1905.825] (-1907.802) (-1908.325) (-1915.710) -- 0:00:00
      11000 -- (-1913.960) (-1910.071) [-1903.316] (-1907.003) * (-1912.961) (-1911.173) [-1908.215] (-1905.798) -- 0:00:00
      11500 -- (-1909.514) [-1910.987] (-1911.841) (-1913.282) * (-1909.189) (-1904.852) [-1906.531] (-1912.078) -- 0:00:00
      12000 -- [-1908.450] (-1913.882) (-1904.742) (-1914.189) * (-1904.951) [-1913.138] (-1909.930) (-1906.637) -- 0:00:00
      12500 -- (-1911.419) (-1913.569) [-1904.141] (-1913.419) * (-1912.502) (-1902.920) [-1909.233] (-1903.039) -- 0:00:00
      13000 -- (-1914.700) (-1908.846) [-1904.860] (-1915.102) * [-1904.193] (-1908.018) (-1915.663) (-1913.441) -- 0:00:00
      13500 -- (-1912.247) (-1906.600) [-1903.508] (-1906.731) * (-1913.273) (-1908.206) (-1907.011) [-1907.353] -- 0:00:00
      14000 -- (-1910.505) (-1911.580) [-1906.862] (-1911.450) * (-1910.443) (-1916.034) [-1905.054] (-1919.554) -- 0:01:10
      14500 -- (-1914.099) [-1913.439] (-1913.010) (-1909.143) * (-1909.053) [-1907.203] (-1908.528) (-1908.381) -- 0:01:07
      15000 -- (-1909.526) (-1911.282) (-1906.778) [-1907.696] * (-1900.221) (-1917.662) [-1903.817] (-1913.020) -- 0:01:05

      Average standard deviation of split frequencies: 0.071552

      15500 -- (-1916.581) (-1907.062) [-1908.917] (-1905.422) * (-1900.297) (-1908.137) (-1911.330) [-1906.802] -- 0:01:03
      16000 -- (-1908.223) [-1906.990] (-1911.197) (-1909.927) * [-1902.207] (-1915.796) (-1911.091) (-1907.063) -- 0:01:01
      16500 -- (-1912.775) (-1910.840) (-1909.250) [-1912.248] * [-1902.222] (-1913.842) (-1915.816) (-1914.104) -- 0:00:59
      17000 -- (-1912.963) (-1908.770) (-1907.501) [-1906.489] * (-1899.425) (-1911.386) [-1903.343] (-1924.126) -- 0:00:57
      17500 -- (-1914.594) (-1913.744) [-1904.976] (-1908.486) * [-1899.785] (-1908.969) (-1912.333) (-1910.052) -- 0:00:56
      18000 -- (-1906.803) [-1903.228] (-1916.468) (-1913.988) * (-1899.598) [-1908.429] (-1907.232) (-1908.461) -- 0:00:54
      18500 -- (-1916.558) (-1911.442) [-1906.232] (-1909.525) * [-1900.202] (-1907.133) (-1905.491) (-1909.922) -- 0:00:53
      19000 -- (-1908.167) [-1902.595] (-1909.390) (-1908.523) * (-1900.023) (-1904.316) [-1904.510] (-1903.035) -- 0:00:51
      19500 -- (-1921.303) (-1912.572) [-1918.665] (-1915.953) * [-1900.137] (-1904.199) (-1910.129) (-1902.329) -- 0:00:50
      20000 -- [-1917.777] (-1908.600) (-1910.724) (-1905.844) * (-1902.112) (-1918.540) [-1909.472] (-1904.765) -- 0:00:49

      Average standard deviation of split frequencies: 0.061913

      20500 -- [-1908.045] (-1916.155) (-1918.148) (-1913.320) * (-1903.442) [-1912.160] (-1904.372) (-1902.310) -- 0:00:47
      21000 -- (-1909.391) [-1906.949] (-1913.905) (-1908.942) * (-1903.400) (-1910.470) [-1910.871] (-1901.441) -- 0:00:46
      21500 -- (-1914.934) [-1906.464] (-1907.115) (-1907.351) * (-1902.499) (-1908.597) [-1909.218] (-1901.519) -- 0:00:45
      22000 -- [-1914.180] (-1912.593) (-1914.714) (-1916.620) * (-1900.727) [-1906.810] (-1909.042) (-1902.936) -- 0:00:44
      22500 -- [-1912.824] (-1905.274) (-1920.628) (-1913.666) * (-1901.023) [-1911.554] (-1908.053) (-1900.205) -- 0:00:43
      23000 -- (-1914.773) (-1906.597) (-1907.093) [-1910.054] * (-1899.947) (-1910.190) [-1907.785] (-1900.031) -- 0:00:42
      23500 -- [-1903.881] (-1907.309) (-1912.638) (-1914.901) * [-1900.276] (-1906.110) (-1908.956) (-1899.211) -- 0:00:41
      24000 -- (-1911.259) (-1906.359) [-1908.782] (-1911.662) * (-1899.083) (-1909.963) [-1906.669] (-1899.155) -- 0:00:40
      24500 -- [-1911.049] (-1912.952) (-1907.971) (-1913.835) * (-1901.991) (-1915.786) (-1905.685) [-1902.816] -- 0:00:39
      25000 -- [-1901.609] (-1916.643) (-1905.046) (-1908.371) * (-1903.092) [-1905.604] (-1906.068) (-1901.767) -- 0:00:39

      Average standard deviation of split frequencies: 0.049213

      25500 -- (-1906.512) [-1914.361] (-1910.276) (-1911.587) * (-1902.737) [-1905.916] (-1906.014) (-1901.838) -- 0:00:38
      26000 -- (-1912.405) [-1909.428] (-1914.562) (-1918.473) * (-1899.709) (-1908.586) (-1906.545) [-1902.283] -- 0:00:37
      26500 -- (-1911.454) (-1906.366) [-1904.964] (-1911.913) * (-1900.179) [-1907.742] (-1917.546) (-1902.259) -- 0:00:36
      27000 -- [-1912.137] (-1907.734) (-1906.434) (-1910.883) * (-1900.301) (-1911.108) (-1909.818) [-1901.380] -- 0:00:36
      27500 -- (-1907.056) [-1905.354] (-1905.281) (-1915.965) * (-1899.185) (-1909.037) (-1916.588) [-1901.382] -- 0:00:35
      28000 -- [-1911.956] (-1913.780) (-1909.460) (-1910.664) * [-1899.394] (-1908.954) (-1903.263) (-1902.347) -- 0:00:34
      28500 -- (-1905.076) (-1902.664) [-1915.673] (-1904.982) * (-1900.917) (-1906.320) (-1906.425) [-1901.642] -- 0:00:34
      29000 -- (-1910.675) (-1916.755) (-1903.113) [-1910.383] * (-1901.443) [-1908.912] (-1906.277) (-1901.398) -- 0:01:06
      29500 -- [-1905.288] (-1903.742) (-1900.622) (-1908.012) * (-1900.591) (-1926.100) [-1914.295] (-1900.082) -- 0:01:05
      30000 -- (-1912.045) (-1906.549) [-1900.887] (-1908.834) * (-1900.420) [-1908.190] (-1904.000) (-1901.951) -- 0:01:04

      Average standard deviation of split frequencies: 0.040452

      30500 -- (-1918.022) (-1905.200) (-1901.041) [-1916.457] * [-1899.278] (-1909.704) (-1907.994) (-1902.059) -- 0:01:03
      31000 -- (-1908.796) (-1908.977) (-1902.547) [-1905.679] * (-1901.024) (-1909.643) (-1910.054) [-1903.461] -- 0:01:02
      31500 -- [-1903.629] (-1906.991) (-1901.587) (-1920.065) * (-1901.060) (-1909.811) [-1908.783] (-1901.355) -- 0:01:01
      32000 -- (-1905.760) (-1904.788) [-1903.970] (-1915.879) * (-1902.639) (-1910.014) (-1914.542) [-1899.769] -- 0:01:00
      32500 -- [-1908.233] (-1912.106) (-1902.626) (-1906.496) * (-1899.134) (-1903.217) [-1907.884] (-1901.379) -- 0:00:59
      33000 -- [-1905.409] (-1908.122) (-1903.489) (-1911.959) * [-1899.695] (-1914.620) (-1907.509) (-1899.784) -- 0:00:58
      33500 -- (-1907.697) (-1908.555) [-1903.443] (-1907.623) * [-1899.421] (-1912.471) (-1915.813) (-1899.458) -- 0:00:57
      34000 -- (-1905.244) [-1902.687] (-1899.592) (-1912.233) * (-1900.825) (-1908.583) [-1918.927] (-1900.824) -- 0:00:56
      34500 -- (-1910.205) [-1907.670] (-1899.635) (-1907.564) * (-1902.310) [-1910.332] (-1908.170) (-1901.078) -- 0:00:55
      35000 -- (-1905.519) (-1910.222) (-1899.546) [-1904.956] * (-1907.726) [-1910.288] (-1906.280) (-1898.727) -- 0:00:55

      Average standard deviation of split frequencies: 0.040662

      35500 -- (-1913.713) (-1911.073) (-1900.240) [-1906.343] * (-1905.892) (-1906.709) (-1909.847) [-1898.809] -- 0:00:54
      36000 -- (-1908.346) (-1907.328) (-1900.222) [-1909.471] * (-1903.806) [-1903.461] (-1909.857) (-1898.845) -- 0:00:53
      36500 -- (-1907.917) [-1913.258] (-1900.284) (-1907.043) * (-1903.796) [-1914.931] (-1911.617) (-1902.184) -- 0:00:52
      37000 -- (-1912.505) [-1905.436] (-1900.521) (-1913.576) * (-1903.912) [-1904.427] (-1911.094) (-1900.519) -- 0:00:52
      37500 -- (-1905.604) [-1907.060] (-1899.872) (-1909.402) * (-1905.101) (-1909.318) (-1913.922) [-1900.712] -- 0:00:51
      38000 -- (-1908.799) (-1913.141) (-1900.082) [-1907.266] * (-1900.048) (-1905.988) (-1903.980) [-1901.388] -- 0:00:50
      38500 -- (-1898.906) (-1910.111) [-1899.336] (-1913.142) * (-1900.191) (-1909.058) (-1906.977) [-1901.240] -- 0:00:49
      39000 -- [-1900.039] (-1917.286) (-1899.628) (-1902.864) * [-1900.698] (-1906.163) (-1917.595) (-1902.127) -- 0:00:49
      39500 -- (-1900.134) (-1907.390) (-1902.349) [-1906.365] * (-1901.768) [-1904.968] (-1914.039) (-1906.500) -- 0:00:48
      40000 -- [-1899.455] (-1907.128) (-1904.810) (-1910.284) * (-1899.298) [-1913.725] (-1913.060) (-1902.904) -- 0:00:48

      Average standard deviation of split frequencies: 0.040572

      40500 -- (-1900.168) [-1906.383] (-1898.791) (-1911.990) * (-1900.053) [-1907.160] (-1909.709) (-1899.518) -- 0:00:47
      41000 -- [-1900.673] (-1918.986) (-1899.812) (-1907.665) * [-1900.631] (-1909.700) (-1914.552) (-1903.017) -- 0:00:46
      41500 -- (-1902.154) [-1906.550] (-1902.958) (-1913.260) * (-1904.261) (-1915.543) (-1911.155) [-1900.712] -- 0:00:46
      42000 -- [-1900.023] (-1904.586) (-1901.405) (-1908.415) * [-1899.615] (-1914.015) (-1916.209) (-1900.376) -- 0:00:45
      42500 -- [-1902.555] (-1916.640) (-1901.166) (-1907.103) * [-1899.277] (-1918.214) (-1904.103) (-1898.360) -- 0:00:45
      43000 -- (-1899.447) (-1911.401) (-1900.369) [-1907.108] * (-1904.058) (-1910.468) [-1913.944] (-1898.901) -- 0:00:44
      43500 -- (-1898.644) (-1907.028) [-1900.908] (-1905.408) * (-1900.155) (-1909.775) [-1905.917] (-1900.318) -- 0:00:43
      44000 -- (-1900.141) (-1905.947) [-1899.704] (-1916.006) * [-1899.793] (-1915.072) (-1907.100) (-1900.079) -- 0:01:05
      44500 -- [-1900.653] (-1911.297) (-1899.427) (-1910.403) * (-1901.265) (-1908.504) (-1906.443) [-1906.173] -- 0:01:04
      45000 -- (-1900.525) (-1910.990) (-1899.826) [-1905.669] * (-1902.949) (-1909.143) (-1917.940) [-1902.826] -- 0:01:03

      Average standard deviation of split frequencies: 0.039967

      45500 -- (-1904.855) [-1913.894] (-1899.121) (-1909.103) * [-1901.046] (-1914.853) (-1907.484) (-1899.944) -- 0:01:02
      46000 -- (-1907.498) [-1905.525] (-1900.923) (-1901.965) * (-1900.213) (-1913.516) (-1910.772) [-1898.961] -- 0:01:02
      46500 -- [-1898.908] (-1907.338) (-1901.417) (-1900.039) * (-1904.433) (-1912.162) [-1904.016] (-1899.259) -- 0:01:01
      47000 -- [-1901.803] (-1908.643) (-1900.030) (-1900.239) * (-1904.379) (-1919.938) [-1906.436] (-1904.897) -- 0:01:00
      47500 -- [-1900.577] (-1913.507) (-1899.640) (-1901.361) * (-1901.617) (-1911.882) (-1910.391) [-1901.607] -- 0:01:00
      48000 -- (-1900.010) (-1911.240) [-1900.935] (-1901.608) * (-1901.310) (-1911.709) (-1914.902) [-1900.731] -- 0:00:59
      48500 -- (-1901.695) [-1906.802] (-1900.094) (-1902.265) * (-1901.575) (-1911.280) [-1909.350] (-1901.155) -- 0:00:58
      49000 -- (-1902.362) (-1907.614) (-1900.542) [-1900.314] * (-1904.760) (-1906.228) (-1907.408) [-1898.767] -- 0:00:58
      49500 -- (-1904.095) (-1914.953) (-1901.463) [-1902.714] * (-1904.402) [-1906.515] (-1913.376) (-1898.448) -- 0:00:57
      50000 -- (-1902.340) (-1910.390) [-1900.404] (-1902.190) * (-1903.865) [-1907.927] (-1909.342) (-1901.793) -- 0:00:57

      Average standard deviation of split frequencies: 0.038147

      50500 -- (-1900.815) (-1911.969) (-1900.344) [-1899.598] * [-1898.827] (-1908.103) (-1909.463) (-1899.011) -- 0:00:56
      51000 -- (-1900.516) (-1909.273) (-1900.218) [-1899.536] * (-1900.223) (-1910.981) (-1901.237) [-1901.239] -- 0:00:55
      51500 -- [-1899.114] (-1905.649) (-1899.875) (-1899.182) * [-1898.677] (-1909.148) (-1900.789) (-1899.014) -- 0:00:55
      52000 -- [-1900.558] (-1914.113) (-1900.177) (-1899.233) * (-1898.689) (-1908.017) [-1904.176] (-1903.650) -- 0:00:54
      52500 -- (-1900.465) [-1904.656] (-1900.215) (-1899.043) * (-1902.339) (-1913.594) (-1901.853) [-1900.902] -- 0:00:54
      53000 -- (-1900.797) [-1907.974] (-1899.844) (-1900.972) * (-1901.480) [-1910.192] (-1903.457) (-1900.641) -- 0:00:53
      53500 -- (-1900.276) [-1907.561] (-1899.909) (-1899.899) * (-1899.212) (-1919.455) (-1901.079) [-1900.285] -- 0:00:53
      54000 -- (-1899.041) (-1912.184) [-1899.905] (-1899.716) * (-1898.446) (-1907.091) [-1898.869] (-1901.559) -- 0:00:52
      54500 -- (-1899.134) (-1907.294) [-1900.131] (-1900.576) * [-1898.460] (-1914.779) (-1898.671) (-1902.633) -- 0:00:52
      55000 -- (-1899.435) [-1911.554] (-1901.391) (-1899.617) * (-1898.435) (-1909.989) (-1899.063) [-1900.125] -- 0:00:51

      Average standard deviation of split frequencies: 0.038988

      55500 -- [-1902.113] (-1906.910) (-1901.924) (-1900.065) * (-1904.796) (-1910.934) (-1899.566) [-1899.185] -- 0:00:51
      56000 -- [-1898.764] (-1909.602) (-1900.500) (-1903.053) * (-1903.287) (-1913.760) [-1899.001] (-1901.870) -- 0:00:50
      56500 -- (-1899.108) [-1910.804] (-1901.053) (-1904.880) * (-1907.917) (-1905.999) (-1902.658) [-1899.592] -- 0:00:50
      57000 -- (-1900.819) (-1906.667) (-1900.505) [-1901.217] * [-1902.692] (-1903.183) (-1902.615) (-1902.104) -- 0:00:49
      57500 -- (-1898.914) (-1905.748) (-1900.759) [-1899.707] * (-1904.866) (-1913.434) [-1900.046] (-1900.959) -- 0:00:49
      58000 -- (-1901.108) [-1912.952] (-1900.639) (-1901.415) * (-1903.975) (-1909.164) [-1901.239] (-1902.424) -- 0:00:48
      58500 -- (-1903.431) (-1906.608) [-1905.414] (-1898.769) * [-1903.874] (-1904.284) (-1902.236) (-1899.631) -- 0:00:48
      59000 -- (-1903.458) (-1906.566) [-1901.451] (-1900.940) * (-1906.228) (-1902.337) [-1899.769] (-1900.305) -- 0:00:47
      59500 -- (-1902.428) [-1911.961] (-1897.984) (-1901.341) * (-1899.621) (-1898.721) [-1899.084] (-1901.802) -- 0:01:03
      60000 -- [-1900.305] (-1915.761) (-1898.922) (-1901.230) * (-1899.367) [-1899.002] (-1900.402) (-1900.040) -- 0:01:02

      Average standard deviation of split frequencies: 0.036262

      60500 -- (-1900.261) (-1905.521) (-1899.233) [-1898.584] * (-1900.049) [-1899.539] (-1899.895) (-1901.494) -- 0:01:02
      61000 -- (-1900.752) (-1907.466) (-1901.986) [-1900.570] * (-1900.503) [-1898.558] (-1899.610) (-1902.794) -- 0:01:01
      61500 -- (-1902.537) [-1906.008] (-1901.198) (-1899.197) * [-1899.226] (-1898.743) (-1902.402) (-1902.333) -- 0:01:01
      62000 -- (-1903.245) (-1909.850) (-1899.347) [-1899.197] * (-1899.845) (-1898.756) (-1901.620) [-1903.575] -- 0:01:00
      62500 -- [-1902.320] (-1914.296) (-1902.706) (-1899.611) * [-1898.477] (-1900.241) (-1900.786) (-1901.802) -- 0:01:00
      63000 -- [-1899.080] (-1911.399) (-1904.485) (-1898.772) * [-1898.247] (-1900.179) (-1900.435) (-1903.727) -- 0:00:59
      63500 -- (-1899.086) (-1912.245) [-1901.361] (-1899.792) * (-1898.331) (-1900.747) [-1903.761] (-1901.165) -- 0:00:58
      64000 -- (-1899.175) (-1909.363) (-1901.368) [-1899.745] * (-1901.154) [-1900.763] (-1905.004) (-1901.369) -- 0:00:58
      64500 -- (-1901.779) (-1906.778) [-1899.370] (-1898.781) * (-1901.121) (-1901.099) [-1901.702] (-1900.425) -- 0:00:58
      65000 -- (-1901.123) (-1909.352) (-1898.730) [-1898.235] * (-1900.642) [-1902.670] (-1900.210) (-1899.930) -- 0:00:57

      Average standard deviation of split frequencies: 0.034012

      65500 -- (-1900.607) (-1914.721) [-1898.984] (-1898.496) * [-1899.163] (-1898.700) (-1900.088) (-1902.883) -- 0:00:57
      66000 -- [-1900.341] (-1909.824) (-1898.999) (-1898.259) * (-1901.880) (-1902.405) (-1902.576) [-1899.352] -- 0:00:56
      66500 -- (-1900.623) [-1907.050] (-1899.790) (-1901.238) * (-1899.986) (-1899.324) [-1903.381] (-1900.370) -- 0:00:56
      67000 -- [-1900.640] (-1910.042) (-1900.366) (-1899.226) * [-1899.588] (-1903.799) (-1909.622) (-1899.134) -- 0:00:55
      67500 -- (-1901.376) [-1912.590] (-1900.389) (-1900.581) * (-1901.247) (-1902.391) (-1910.386) [-1899.836] -- 0:00:55
      68000 -- [-1899.567] (-1913.591) (-1899.972) (-1900.628) * (-1903.232) [-1901.016] (-1899.515) (-1899.796) -- 0:00:54
      68500 -- [-1900.158] (-1906.273) (-1901.234) (-1901.197) * (-1902.150) [-1899.097] (-1899.934) (-1900.171) -- 0:00:54
      69000 -- (-1901.975) (-1915.393) (-1902.905) [-1901.934] * (-1902.105) (-1899.575) (-1898.471) [-1899.917] -- 0:00:53
      69500 -- (-1903.460) [-1914.110] (-1903.418) (-1903.364) * (-1904.459) (-1899.646) (-1902.984) [-1898.750] -- 0:00:53
      70000 -- [-1900.849] (-1909.137) (-1900.716) (-1900.323) * (-1902.022) [-1899.639] (-1901.221) (-1899.067) -- 0:00:53

      Average standard deviation of split frequencies: 0.031766

      70500 -- (-1901.603) [-1909.481] (-1902.411) (-1900.708) * (-1901.917) [-1900.629] (-1901.221) (-1900.274) -- 0:00:52
      71000 -- (-1900.665) (-1915.896) [-1900.574] (-1902.071) * (-1902.581) [-1898.554] (-1902.057) (-1898.713) -- 0:00:52
      71500 -- [-1900.693] (-1905.677) (-1898.385) (-1903.797) * (-1903.083) (-1898.823) [-1901.819] (-1900.773) -- 0:00:51
      72000 -- [-1899.749] (-1907.762) (-1899.962) (-1900.550) * (-1899.953) [-1900.096] (-1901.819) (-1900.791) -- 0:00:51
      72500 -- (-1900.791) [-1905.858] (-1900.624) (-1900.630) * (-1897.847) [-1900.601] (-1898.689) (-1899.807) -- 0:00:51
      73000 -- (-1901.145) (-1906.515) [-1900.587] (-1904.206) * (-1900.551) (-1902.153) (-1899.947) [-1898.725] -- 0:00:50
      73500 -- (-1898.272) [-1905.620] (-1901.179) (-1904.875) * [-1899.925] (-1901.712) (-1899.963) (-1899.230) -- 0:00:50
      74000 -- (-1898.095) (-1915.934) (-1899.472) [-1900.838] * [-1900.556] (-1901.785) (-1901.657) (-1899.137) -- 0:00:50
      74500 -- [-1899.080] (-1910.922) (-1898.742) (-1900.826) * (-1901.460) (-1906.789) (-1900.435) [-1899.769] -- 0:01:02
      75000 -- (-1899.135) [-1915.495] (-1900.318) (-1902.430) * (-1905.872) (-1903.397) (-1898.975) [-1900.266] -- 0:01:01

      Average standard deviation of split frequencies: 0.028222

      75500 -- (-1900.147) [-1909.888] (-1901.000) (-1901.993) * (-1902.539) (-1902.354) [-1898.694] (-1899.121) -- 0:01:01
      76000 -- (-1899.219) [-1906.656] (-1903.582) (-1901.674) * (-1901.306) [-1899.202] (-1901.283) (-1899.194) -- 0:01:00
      76500 -- (-1900.057) (-1915.998) (-1901.253) [-1900.093] * (-1903.268) (-1899.241) (-1903.483) [-1900.460] -- 0:01:00
      77000 -- (-1899.827) [-1902.942] (-1902.196) (-1900.613) * (-1901.556) (-1900.127) (-1900.873) [-1902.189] -- 0:00:59
      77500 -- (-1897.890) [-1903.088] (-1903.659) (-1906.844) * [-1898.973] (-1899.882) (-1899.851) (-1899.358) -- 0:00:59
      78000 -- [-1900.035] (-1908.572) (-1900.305) (-1902.466) * (-1899.513) (-1900.036) (-1901.718) [-1899.358] -- 0:00:59
      78500 -- [-1898.593] (-1904.238) (-1902.200) (-1901.252) * (-1900.382) (-1899.264) [-1900.942] (-1899.907) -- 0:00:58
      79000 -- [-1897.923] (-1917.653) (-1902.258) (-1901.712) * (-1907.261) (-1899.356) (-1900.296) [-1900.464] -- 0:00:58
      79500 -- (-1898.952) (-1907.075) [-1900.710] (-1899.280) * (-1900.368) (-1899.465) (-1903.430) [-1900.419] -- 0:00:57
      80000 -- (-1902.224) [-1910.181] (-1901.732) (-1899.126) * (-1900.747) [-1900.062] (-1903.580) (-1900.133) -- 0:00:57

      Average standard deviation of split frequencies: 0.026993

      80500 -- (-1900.638) (-1909.323) (-1902.083) [-1900.994] * [-1899.640] (-1901.035) (-1900.932) (-1901.021) -- 0:00:57
      81000 -- (-1900.565) [-1907.916] (-1899.220) (-1900.059) * [-1900.520] (-1898.820) (-1898.590) (-1901.635) -- 0:00:56
      81500 -- (-1902.273) (-1910.780) [-1900.820] (-1903.737) * (-1904.143) [-1901.834] (-1902.219) (-1903.660) -- 0:00:56
      82000 -- [-1899.971] (-1907.342) (-1901.589) (-1901.747) * (-1901.629) (-1904.827) [-1900.920] (-1899.721) -- 0:00:55
      82500 -- (-1899.752) [-1909.672] (-1901.758) (-1901.089) * (-1898.797) (-1900.528) (-1901.603) [-1900.402] -- 0:00:55
      83000 -- [-1901.283] (-1906.924) (-1901.922) (-1901.034) * [-1899.535] (-1905.050) (-1904.537) (-1899.894) -- 0:00:55
      83500 -- (-1900.718) [-1905.870] (-1900.889) (-1900.988) * (-1898.189) (-1900.454) (-1904.555) [-1900.115] -- 0:00:54
      84000 -- (-1900.170) (-1904.605) [-1899.737] (-1899.631) * (-1900.024) (-1901.153) [-1899.644] (-1900.041) -- 0:00:54
      84500 -- [-1900.133] (-1929.313) (-1903.458) (-1900.716) * (-1901.393) (-1900.915) [-1906.012] (-1900.156) -- 0:00:54
      85000 -- (-1899.317) [-1904.490] (-1903.773) (-1899.471) * (-1901.753) (-1899.650) [-1902.439] (-1901.683) -- 0:00:53

      Average standard deviation of split frequencies: 0.027407

      85500 -- [-1899.172] (-1902.437) (-1901.385) (-1899.615) * (-1902.385) [-1899.180] (-1903.455) (-1899.275) -- 0:00:53
      86000 -- (-1900.459) [-1900.787] (-1900.060) (-1902.533) * (-1902.850) [-1899.599] (-1903.634) (-1899.433) -- 0:00:53
      86500 -- (-1900.030) (-1900.127) [-1901.548] (-1900.390) * (-1898.933) (-1898.768) [-1898.553] (-1899.793) -- 0:00:52
      87000 -- (-1899.784) (-1899.467) [-1900.591] (-1898.710) * (-1899.693) [-1899.759] (-1898.347) (-1900.890) -- 0:00:52
      87500 -- (-1900.488) (-1902.933) (-1901.046) [-1898.823] * (-1900.149) (-1900.242) (-1899.788) [-1899.739] -- 0:00:52
      88000 -- [-1900.235] (-1900.445) (-1899.433) (-1898.206) * (-1897.903) (-1899.055) [-1899.506] (-1899.690) -- 0:00:51
      88500 -- (-1903.150) (-1900.582) [-1899.365] (-1898.210) * [-1897.788] (-1898.686) (-1900.833) (-1902.829) -- 0:00:51
      89000 -- (-1902.666) (-1900.200) (-1898.712) [-1898.942] * [-1900.146] (-1898.409) (-1901.778) (-1898.971) -- 0:00:51
      89500 -- (-1899.714) (-1900.478) [-1899.988] (-1900.764) * (-1902.047) [-1898.667] (-1901.635) (-1899.164) -- 0:01:01
      90000 -- [-1899.314] (-1904.589) (-1898.227) (-1899.492) * (-1898.877) [-1898.382] (-1905.713) (-1905.111) -- 0:01:00

      Average standard deviation of split frequencies: 0.024511

      90500 -- [-1898.837] (-1903.998) (-1898.227) (-1898.400) * [-1898.883] (-1900.169) (-1903.981) (-1900.641) -- 0:01:00
      91000 -- (-1903.149) (-1903.158) [-1898.686] (-1898.739) * (-1901.307) (-1899.538) (-1899.874) [-1902.487] -- 0:00:59
      91500 -- [-1903.536] (-1901.065) (-1898.680) (-1900.887) * (-1897.960) (-1899.468) (-1900.085) [-1899.881] -- 0:00:59
      92000 -- (-1903.071) (-1900.618) (-1899.281) [-1898.479] * [-1899.795] (-1899.905) (-1899.449) (-1899.766) -- 0:00:59
      92500 -- (-1902.412) (-1901.860) (-1899.030) [-1901.822] * (-1900.379) (-1901.364) [-1898.801] (-1901.776) -- 0:00:58
      93000 -- [-1901.697] (-1902.177) (-1899.283) (-1901.746) * (-1902.584) (-1900.636) (-1898.544) [-1898.337] -- 0:00:58
      93500 -- [-1903.312] (-1901.847) (-1899.236) (-1901.648) * (-1899.822) (-1899.616) (-1898.565) [-1899.977] -- 0:00:58
      94000 -- (-1901.113) (-1900.681) (-1899.394) [-1903.363] * (-1899.708) (-1899.493) (-1902.178) [-1900.099] -- 0:00:57
      94500 -- [-1899.411] (-1897.934) (-1907.463) (-1903.412) * (-1898.879) (-1899.715) [-1900.241] (-1900.238) -- 0:00:57
      95000 -- (-1898.419) (-1897.943) [-1907.672] (-1901.905) * (-1900.175) [-1898.875] (-1899.473) (-1901.340) -- 0:00:57

      Average standard deviation of split frequencies: 0.022834

      95500 -- [-1898.606] (-1907.849) (-1908.561) (-1901.922) * (-1903.169) [-1901.118] (-1900.158) (-1899.512) -- 0:00:56
      96000 -- [-1898.413] (-1900.853) (-1904.056) (-1902.509) * (-1902.473) (-1899.084) [-1901.783] (-1899.510) -- 0:00:56
      96500 -- (-1899.581) (-1898.393) (-1902.555) [-1901.365] * [-1900.143] (-1899.332) (-1900.457) (-1900.231) -- 0:00:56
      97000 -- (-1899.744) (-1898.268) [-1901.450] (-1898.580) * (-1900.583) [-1898.795] (-1900.815) (-1900.741) -- 0:00:55
      97500 -- (-1899.674) [-1901.525] (-1902.640) (-1899.851) * (-1903.338) (-1898.629) (-1900.960) [-1898.026] -- 0:00:55
      98000 -- (-1899.841) (-1900.483) [-1901.680] (-1899.066) * [-1901.484] (-1904.303) (-1902.469) (-1898.050) -- 0:00:55
      98500 -- (-1900.295) [-1900.395] (-1903.954) (-1902.384) * (-1901.150) (-1905.068) [-1901.407] (-1898.059) -- 0:00:54
      99000 -- (-1900.085) (-1898.896) (-1903.979) [-1899.054] * [-1903.538] (-1903.423) (-1901.254) (-1898.827) -- 0:00:54
      99500 -- (-1901.814) [-1900.613] (-1904.014) (-1898.757) * (-1899.462) (-1904.382) [-1901.512] (-1900.887) -- 0:00:54
      100000 -- (-1901.329) (-1899.186) (-1903.893) [-1898.754] * [-1899.551] (-1902.594) (-1900.891) (-1899.406) -- 0:00:54

      Average standard deviation of split frequencies: 0.021935

      100500 -- (-1900.933) (-1904.863) (-1898.786) [-1898.985] * (-1899.121) [-1903.854] (-1903.177) (-1900.563) -- 0:00:53
      101000 -- (-1899.539) [-1905.578] (-1900.321) (-1899.291) * [-1900.443] (-1903.421) (-1901.571) (-1899.266) -- 0:00:53
      101500 -- (-1902.467) (-1899.710) (-1899.552) [-1901.946] * (-1900.518) [-1899.220] (-1901.427) (-1899.436) -- 0:00:53
      102000 -- [-1900.453] (-1899.029) (-1902.232) (-1900.310) * (-1900.391) [-1901.616] (-1903.217) (-1899.416) -- 0:00:52
      102500 -- (-1899.299) [-1899.170] (-1905.232) (-1899.042) * [-1901.885] (-1900.013) (-1901.485) (-1903.994) -- 0:00:52
      103000 -- [-1899.899] (-1899.571) (-1903.149) (-1901.552) * (-1900.143) (-1901.397) [-1898.722] (-1903.612) -- 0:00:52
      103500 -- (-1898.994) [-1902.457] (-1898.635) (-1899.859) * (-1907.835) (-1899.441) [-1899.562] (-1903.024) -- 0:00:51
      104000 -- [-1899.774] (-1898.865) (-1899.201) (-1901.211) * (-1900.693) [-1898.582] (-1901.707) (-1903.148) -- 0:00:51
      104500 -- (-1899.834) [-1900.992] (-1902.939) (-1899.683) * (-1902.682) (-1899.444) [-1904.120] (-1905.853) -- 0:00:51
      105000 -- (-1898.167) (-1901.434) (-1900.136) [-1899.282] * (-1903.931) (-1900.608) [-1901.965] (-1899.948) -- 0:00:59

      Average standard deviation of split frequencies: 0.022236

      105500 -- [-1900.063] (-1898.524) (-1899.536) (-1899.080) * (-1904.107) (-1901.936) (-1899.599) [-1897.915] -- 0:00:59
      106000 -- [-1900.401] (-1899.312) (-1899.537) (-1899.080) * (-1898.736) (-1899.160) [-1898.920] (-1897.859) -- 0:00:59
      106500 -- (-1899.192) (-1899.638) (-1899.939) [-1898.147] * (-1899.306) (-1899.244) (-1900.595) [-1898.061] -- 0:00:58
      107000 -- (-1898.523) (-1899.256) [-1902.738] (-1898.147) * (-1900.911) (-1899.229) [-1898.351] (-1898.054) -- 0:00:58
      107500 -- (-1898.722) (-1899.859) (-1903.488) [-1898.147] * (-1899.886) (-1901.172) [-1898.241] (-1898.054) -- 0:00:58
      108000 -- (-1900.049) (-1899.886) (-1904.703) [-1898.859] * (-1899.493) (-1901.749) [-1898.204] (-1898.018) -- 0:00:57
      108500 -- (-1898.281) [-1899.080] (-1901.722) (-1899.167) * (-1898.177) (-1901.038) (-1903.838) [-1899.606] -- 0:00:57
      109000 -- (-1898.281) [-1898.251] (-1902.206) (-1899.780) * (-1898.514) (-1903.339) (-1902.677) [-1899.133] -- 0:00:57
      109500 -- [-1898.773] (-1900.696) (-1902.550) (-1902.261) * [-1898.317] (-1901.138) (-1905.452) (-1898.034) -- 0:00:56
      110000 -- (-1898.354) [-1899.437] (-1902.703) (-1903.319) * (-1899.323) (-1899.773) [-1901.271] (-1898.772) -- 0:00:56

      Average standard deviation of split frequencies: 0.019808

      110500 -- [-1899.945] (-1900.110) (-1900.161) (-1899.953) * (-1899.161) (-1904.911) [-1898.383] (-1898.701) -- 0:00:56
      111000 -- [-1900.718] (-1900.538) (-1900.947) (-1901.474) * (-1899.320) (-1899.848) (-1901.935) [-1900.418] -- 0:00:56
      111500 -- (-1901.611) [-1900.417] (-1901.105) (-1901.086) * (-1898.782) [-1899.190] (-1899.561) (-1898.881) -- 0:00:55
      112000 -- [-1899.585] (-1899.370) (-1899.839) (-1899.567) * (-1900.583) (-1899.258) (-1902.727) [-1898.895] -- 0:00:55
      112500 -- (-1898.861) [-1901.689] (-1901.435) (-1901.991) * (-1899.759) (-1898.806) (-1902.482) [-1901.371] -- 0:00:55
      113000 -- [-1901.093] (-1899.317) (-1901.905) (-1904.350) * (-1900.732) [-1898.665] (-1902.299) (-1898.772) -- 0:00:54
      113500 -- (-1902.262) (-1899.225) (-1904.428) [-1901.193] * [-1903.492] (-1899.254) (-1900.913) (-1899.371) -- 0:00:54
      114000 -- (-1901.524) (-1900.673) (-1903.622) [-1900.824] * (-1903.243) (-1900.556) [-1902.099] (-1900.231) -- 0:00:54
      114500 -- (-1903.341) (-1900.719) [-1900.674] (-1900.902) * [-1902.975] (-1900.270) (-1899.979) (-1902.658) -- 0:00:54
      115000 -- (-1903.413) (-1900.634) [-1905.741] (-1902.798) * [-1900.743] (-1901.190) (-1899.400) (-1898.002) -- 0:00:53

      Average standard deviation of split frequencies: 0.020319

      115500 -- [-1903.985] (-1902.108) (-1907.529) (-1899.973) * (-1901.401) [-1900.378] (-1902.657) (-1898.175) -- 0:00:53
      116000 -- (-1906.210) (-1902.008) (-1901.012) [-1899.372] * (-1900.713) [-1900.091] (-1901.896) (-1900.340) -- 0:00:53
      116500 -- (-1899.187) [-1901.465] (-1901.235) (-1901.969) * (-1913.037) [-1902.305] (-1902.404) (-1903.092) -- 0:00:53
      117000 -- (-1898.661) (-1902.118) [-1899.531] (-1900.927) * (-1900.142) (-1902.872) (-1904.069) [-1900.855] -- 0:00:52
      117500 -- (-1899.617) (-1901.006) (-1898.333) [-1900.927] * (-1900.323) (-1900.237) (-1901.212) [-1899.468] -- 0:00:52
      118000 -- (-1899.939) (-1900.935) [-1898.309] (-1900.717) * (-1900.546) (-1899.815) (-1902.617) [-1899.414] -- 0:00:52
      118500 -- [-1899.194] (-1900.701) (-1898.716) (-1898.567) * (-1903.827) [-1899.943] (-1899.749) (-1901.991) -- 0:00:52
      119000 -- [-1899.219] (-1901.098) (-1900.121) (-1899.090) * (-1902.325) (-1899.353) (-1899.747) [-1900.292] -- 0:00:51
      119500 -- (-1900.216) (-1901.162) [-1899.066] (-1899.910) * (-1898.128) (-1900.043) (-1902.736) [-1901.428] -- 0:00:51
      120000 -- (-1903.016) (-1898.711) (-1902.745) [-1898.743] * (-1898.514) (-1900.255) (-1899.449) [-1899.292] -- 0:00:51

      Average standard deviation of split frequencies: 0.021589

      120500 -- (-1903.927) (-1906.227) [-1902.645] (-1900.330) * (-1899.041) [-1899.523] (-1898.368) (-1901.001) -- 0:00:58
      121000 -- [-1902.023] (-1904.832) (-1898.922) (-1899.918) * (-1898.418) (-1898.903) [-1898.104] (-1899.436) -- 0:00:58
      121500 -- [-1901.461] (-1904.904) (-1899.842) (-1898.592) * (-1898.365) [-1898.907] (-1898.286) (-1899.650) -- 0:00:57
      122000 -- (-1903.058) [-1905.058] (-1899.223) (-1898.961) * (-1898.524) [-1899.374] (-1898.897) (-1899.406) -- 0:00:57
      122500 -- (-1903.576) (-1903.612) [-1900.056] (-1901.131) * [-1899.640] (-1898.775) (-1898.525) (-1899.910) -- 0:00:57
      123000 -- (-1899.950) (-1899.906) (-1899.650) [-1899.509] * [-1901.668] (-1899.355) (-1900.201) (-1901.263) -- 0:00:57
      123500 -- (-1900.339) (-1901.965) [-1900.726] (-1898.820) * (-1899.742) (-1900.138) [-1900.852] (-1903.197) -- 0:00:56
      124000 -- [-1900.787] (-1899.498) (-1901.964) (-1898.871) * (-1899.305) (-1900.138) [-1899.462] (-1901.670) -- 0:00:56
      124500 -- (-1900.553) (-1902.893) (-1898.691) [-1898.555] * (-1900.028) [-1901.641] (-1901.695) (-1903.879) -- 0:00:56
      125000 -- [-1900.516] (-1902.754) (-1903.531) (-1900.333) * (-1898.883) (-1900.280) [-1899.129] (-1901.917) -- 0:00:56

      Average standard deviation of split frequencies: 0.023432

      125500 -- (-1901.859) (-1899.232) [-1901.207] (-1901.190) * (-1901.955) (-1902.190) (-1898.830) [-1899.797] -- 0:00:55
      126000 -- [-1901.920] (-1900.054) (-1899.432) (-1898.819) * (-1902.135) (-1901.726) (-1899.136) [-1900.640] -- 0:00:55
      126500 -- (-1900.090) (-1898.936) (-1899.573) [-1898.662] * [-1904.062] (-1902.454) (-1899.136) (-1899.261) -- 0:00:55
      127000 -- [-1899.429] (-1900.614) (-1899.433) (-1901.190) * [-1902.634] (-1902.926) (-1902.823) (-1901.136) -- 0:00:54
      127500 -- [-1902.753] (-1907.749) (-1899.560) (-1905.547) * (-1900.037) (-1904.470) (-1899.691) [-1901.181] -- 0:00:54
      128000 -- (-1900.440) (-1904.207) [-1898.213] (-1903.599) * (-1899.340) [-1898.718] (-1898.920) (-1901.448) -- 0:00:54
      128500 -- (-1899.473) (-1899.096) [-1902.920] (-1901.625) * (-1900.509) (-1899.066) [-1898.920] (-1903.940) -- 0:00:54
      129000 -- (-1899.485) (-1899.939) (-1901.304) [-1903.878] * (-1900.794) (-1899.135) [-1898.579] (-1905.934) -- 0:00:54
      129500 -- [-1899.888] (-1902.240) (-1901.884) (-1900.880) * (-1900.000) [-1898.531] (-1899.256) (-1899.771) -- 0:00:53
      130000 -- (-1898.310) (-1900.623) (-1898.643) [-1901.835] * [-1902.091] (-1898.416) (-1899.439) (-1899.727) -- 0:00:53

      Average standard deviation of split frequencies: 0.025634

      130500 -- [-1899.798] (-1901.127) (-1898.802) (-1900.716) * (-1902.942) [-1901.871] (-1899.760) (-1900.158) -- 0:00:53
      131000 -- (-1899.927) (-1901.138) (-1898.637) [-1900.425] * (-1902.060) (-1899.678) [-1900.769] (-1902.089) -- 0:00:53
      131500 -- (-1904.355) (-1901.484) (-1897.887) [-1901.571] * (-1900.324) (-1898.532) (-1900.539) [-1900.243] -- 0:00:52
      132000 -- (-1900.639) (-1904.191) (-1897.887) [-1898.961] * (-1901.657) [-1899.184] (-1902.506) (-1900.136) -- 0:00:52
      132500 -- (-1900.639) [-1904.607] (-1898.266) (-1898.961) * [-1900.075] (-1902.263) (-1907.480) (-1903.306) -- 0:00:52
      133000 -- (-1903.184) (-1899.952) [-1903.399] (-1899.136) * (-1901.855) [-1901.524] (-1902.431) (-1902.290) -- 0:00:52
      133500 -- [-1899.924] (-1901.252) (-1901.103) (-1905.186) * (-1900.060) [-1900.003] (-1901.631) (-1903.495) -- 0:00:51
      134000 -- (-1899.611) [-1901.422] (-1901.728) (-1903.137) * (-1901.902) (-1903.062) [-1900.224] (-1902.765) -- 0:00:51
      134500 -- [-1902.658] (-1903.261) (-1901.900) (-1901.129) * (-1901.796) (-1903.279) (-1904.466) [-1902.069] -- 0:00:51
      135000 -- (-1899.006) [-1900.889] (-1900.536) (-1903.233) * (-1900.077) (-1903.418) [-1899.000] (-1902.460) -- 0:00:51

      Average standard deviation of split frequencies: 0.020990

      135500 -- [-1899.767] (-1899.862) (-1901.211) (-1901.457) * [-1899.647] (-1904.957) (-1899.341) (-1899.792) -- 0:00:57
      136000 -- [-1898.605] (-1898.903) (-1900.074) (-1900.758) * [-1899.943] (-1898.729) (-1898.995) (-1900.208) -- 0:00:57
      136500 -- (-1899.911) [-1902.142] (-1900.941) (-1898.323) * [-1900.103] (-1905.621) (-1902.142) (-1900.173) -- 0:00:56
      137000 -- [-1901.064] (-1901.261) (-1905.132) (-1898.358) * [-1899.854] (-1901.162) (-1899.512) (-1900.167) -- 0:00:56
      137500 -- (-1899.889) [-1898.640] (-1902.047) (-1899.642) * [-1902.076] (-1903.066) (-1900.341) (-1901.119) -- 0:00:56
      138000 -- [-1899.413] (-1898.655) (-1898.523) (-1898.125) * (-1898.951) (-1902.085) (-1899.745) [-1900.849] -- 0:00:56
      138500 -- (-1899.414) [-1898.398] (-1898.449) (-1902.005) * (-1903.967) (-1900.303) [-1899.159] (-1900.875) -- 0:00:55
      139000 -- (-1900.675) (-1898.758) (-1901.129) [-1903.981] * (-1900.387) (-1900.366) (-1899.265) [-1899.650] -- 0:00:55
      139500 -- [-1900.202] (-1898.349) (-1899.676) (-1902.434) * (-1900.104) (-1900.934) [-1899.539] (-1900.086) -- 0:00:55
      140000 -- (-1900.408) (-1901.755) [-1898.684] (-1901.329) * (-1900.474) [-1902.175] (-1900.480) (-1902.648) -- 0:00:55

      Average standard deviation of split frequencies: 0.019122

      140500 -- (-1901.505) (-1900.003) [-1901.850] (-1901.705) * (-1899.912) (-1901.992) [-1900.005] (-1901.535) -- 0:00:55
      141000 -- (-1903.432) (-1900.582) [-1902.213] (-1901.135) * [-1899.342] (-1901.847) (-1900.145) (-1898.075) -- 0:00:54
      141500 -- (-1904.232) (-1900.997) [-1902.166] (-1899.674) * (-1902.348) (-1901.458) (-1902.874) [-1898.528] -- 0:00:54
      142000 -- [-1902.575] (-1899.999) (-1904.029) (-1899.097) * (-1900.283) [-1901.928] (-1898.383) (-1898.661) -- 0:00:54
      142500 -- (-1902.204) (-1902.314) (-1904.801) [-1901.697] * [-1899.029] (-1900.071) (-1900.758) (-1900.408) -- 0:00:54
      143000 -- [-1900.401] (-1902.121) (-1901.775) (-1902.612) * (-1898.517) (-1899.690) [-1898.451] (-1899.316) -- 0:00:53
      143500 -- (-1899.330) (-1902.270) [-1901.673] (-1899.669) * (-1898.741) [-1898.869] (-1900.220) (-1899.396) -- 0:00:53
      144000 -- [-1899.252] (-1901.774) (-1901.673) (-1898.355) * (-1898.429) [-1898.838] (-1900.157) (-1899.436) -- 0:00:53
      144500 -- (-1899.920) [-1899.565] (-1899.489) (-1900.856) * (-1899.155) (-1899.782) (-1899.999) [-1900.962] -- 0:00:53
      145000 -- (-1900.245) (-1898.279) [-1901.064] (-1900.557) * (-1908.817) (-1899.057) [-1899.309] (-1901.123) -- 0:00:53

      Average standard deviation of split frequencies: 0.018476

      145500 -- (-1900.057) (-1900.332) [-1901.919] (-1900.066) * (-1904.490) (-1899.779) (-1902.183) [-1900.185] -- 0:00:52
      146000 -- (-1900.450) (-1900.610) [-1898.865] (-1903.057) * (-1900.145) (-1899.655) (-1899.401) [-1899.630] -- 0:00:52
      146500 -- (-1902.997) (-1900.549) [-1900.229] (-1905.898) * (-1898.179) (-1899.070) [-1901.177] (-1903.143) -- 0:00:52
      147000 -- (-1907.257) [-1900.645] (-1901.965) (-1903.953) * [-1899.084] (-1899.680) (-1902.166) (-1901.605) -- 0:00:52
      147500 -- (-1902.847) (-1899.337) (-1901.352) [-1900.861] * (-1899.161) (-1900.414) (-1899.838) [-1901.411] -- 0:00:52
      148000 -- (-1901.709) (-1904.095) (-1903.007) [-1899.987] * (-1903.757) (-1900.125) [-1899.050] (-1899.546) -- 0:00:51
      148500 -- (-1901.702) [-1899.590] (-1900.460) (-1899.994) * (-1900.881) (-1902.071) (-1901.833) [-1899.934] -- 0:00:51
      149000 -- [-1901.852] (-1900.345) (-1902.153) (-1899.947) * [-1900.188] (-1899.480) (-1900.807) (-1907.219) -- 0:00:51
      149500 -- (-1902.677) (-1898.581) [-1906.662] (-1900.849) * (-1901.739) [-1899.480] (-1900.041) (-1906.201) -- 0:00:51
      150000 -- (-1908.569) (-1899.113) (-1904.927) [-1898.757] * (-1901.212) (-1900.266) [-1900.852] (-1901.844) -- 0:00:51

      Average standard deviation of split frequencies: 0.017208

      150500 -- (-1907.000) (-1900.199) [-1899.181] (-1898.609) * [-1899.317] (-1900.649) (-1901.286) (-1899.347) -- 0:00:50
      151000 -- (-1902.979) (-1912.835) (-1900.845) [-1901.707] * [-1899.945] (-1900.258) (-1902.407) (-1903.919) -- 0:00:56
      151500 -- (-1900.251) (-1901.502) (-1900.772) [-1901.922] * (-1900.172) (-1900.917) [-1900.262] (-1903.967) -- 0:00:56
      152000 -- (-1901.279) (-1901.557) (-1902.666) [-1900.719] * (-1901.795) [-1903.867] (-1901.326) (-1900.126) -- 0:00:55
      152500 -- (-1902.817) (-1901.375) (-1901.780) [-1900.984] * [-1899.180] (-1900.579) (-1902.211) (-1900.257) -- 0:00:55
      153000 -- (-1902.188) [-1901.351] (-1902.535) (-1901.225) * (-1898.666) [-1901.481] (-1900.141) (-1900.439) -- 0:00:55
      153500 -- (-1901.673) (-1903.784) (-1903.283) [-1902.214] * (-1898.553) (-1899.360) (-1899.007) [-1899.277] -- 0:00:55
      154000 -- (-1906.282) (-1899.259) [-1900.468] (-1900.636) * (-1899.102) (-1900.562) (-1900.043) [-1903.270] -- 0:00:54
      154500 -- [-1899.655] (-1899.265) (-1900.304) (-1901.616) * (-1899.996) [-1902.541] (-1898.221) (-1906.087) -- 0:00:54
      155000 -- (-1898.784) [-1899.124] (-1898.437) (-1900.602) * (-1899.918) (-1902.864) [-1899.556] (-1905.105) -- 0:00:54

      Average standard deviation of split frequencies: 0.016620

      155500 -- (-1900.069) (-1898.604) (-1898.845) [-1899.205] * (-1900.106) [-1900.037] (-1903.306) (-1900.798) -- 0:00:54
      156000 -- (-1901.740) (-1900.727) (-1898.753) [-1900.452] * [-1900.292] (-1900.515) (-1900.871) (-1903.051) -- 0:00:54
      156500 -- (-1904.372) [-1900.892] (-1900.719) (-1898.866) * (-1904.822) (-1901.189) (-1900.080) [-1902.360] -- 0:00:53
      157000 -- (-1908.689) [-1900.940] (-1900.388) (-1898.878) * (-1899.378) (-1900.764) (-1905.945) [-1901.941] -- 0:00:53
      157500 -- [-1904.769] (-1900.037) (-1900.647) (-1898.995) * (-1899.395) (-1902.154) [-1899.664] (-1904.527) -- 0:00:53
      158000 -- (-1901.760) (-1900.038) (-1900.723) [-1898.969] * (-1900.405) (-1899.956) [-1900.157] (-1902.536) -- 0:00:53
      158500 -- (-1900.382) (-1900.997) [-1900.727] (-1900.367) * [-1899.503] (-1901.172) (-1902.257) (-1898.894) -- 0:00:53
      159000 -- (-1903.077) [-1900.494] (-1898.262) (-1899.154) * (-1901.160) (-1899.121) [-1901.964] (-1898.689) -- 0:00:52
      159500 -- (-1900.545) (-1898.653) (-1900.607) [-1898.888] * (-1903.621) (-1899.687) (-1901.584) [-1899.041] -- 0:00:52
      160000 -- (-1902.569) (-1898.512) (-1900.588) [-1898.384] * [-1901.848] (-1899.313) (-1899.588) (-1901.756) -- 0:00:52

      Average standard deviation of split frequencies: 0.016952

      160500 -- (-1901.495) (-1898.405) (-1901.782) [-1902.215] * (-1903.440) (-1901.495) [-1899.225] (-1901.765) -- 0:00:52
      161000 -- (-1909.672) [-1899.285] (-1900.699) (-1900.708) * [-1901.300] (-1899.793) (-1902.115) (-1901.638) -- 0:00:52
      161500 -- (-1912.085) [-1898.732] (-1900.902) (-1898.913) * (-1902.732) [-1899.826] (-1900.876) (-1899.705) -- 0:00:51
      162000 -- (-1899.391) [-1899.667] (-1900.492) (-1903.198) * (-1899.867) (-1900.241) (-1900.138) [-1898.331] -- 0:00:51
      162500 -- (-1900.366) (-1900.038) (-1900.492) [-1901.543] * (-1901.054) [-1901.216] (-1899.532) (-1898.414) -- 0:00:51
      163000 -- (-1902.088) (-1899.838) (-1901.475) [-1902.311] * (-1901.888) [-1901.216] (-1900.551) (-1898.788) -- 0:00:51
      163500 -- (-1899.499) [-1900.192] (-1902.115) (-1904.548) * (-1901.767) (-1900.124) [-1899.385] (-1898.867) -- 0:00:51
      164000 -- (-1899.211) (-1901.449) [-1902.123] (-1901.542) * (-1900.479) [-1900.902] (-1900.516) (-1902.261) -- 0:00:50
      164500 -- [-1898.605] (-1902.599) (-1904.182) (-1903.623) * (-1898.180) (-1899.088) [-1900.373] (-1903.499) -- 0:00:50
      165000 -- (-1898.613) (-1901.253) (-1907.731) [-1898.840] * [-1898.218] (-1903.373) (-1899.009) (-1902.120) -- 0:00:50

      Average standard deviation of split frequencies: 0.015761

      165500 -- (-1904.528) (-1900.593) [-1898.718] (-1899.498) * [-1898.204] (-1900.610) (-1898.333) (-1904.532) -- 0:00:50
      166000 -- (-1908.447) (-1898.800) [-1899.929] (-1899.024) * (-1898.369) (-1898.602) [-1900.265] (-1903.115) -- 0:00:50
      166500 -- (-1901.856) [-1899.864] (-1900.765) (-1898.469) * (-1899.242) (-1899.202) [-1899.102] (-1899.922) -- 0:00:55
      167000 -- (-1899.576) [-1899.871] (-1901.259) (-1898.399) * [-1900.464] (-1900.512) (-1901.249) (-1899.370) -- 0:00:54
      167500 -- (-1901.805) (-1899.769) [-1900.704] (-1898.569) * (-1898.808) [-1899.748] (-1899.281) (-1898.808) -- 0:00:54
      168000 -- (-1900.301) (-1899.723) (-1899.801) [-1899.255] * [-1898.847] (-1899.051) (-1899.520) (-1898.939) -- 0:00:54
      168500 -- [-1899.387] (-1901.083) (-1899.146) (-1900.392) * (-1898.769) (-1899.177) [-1899.405] (-1898.855) -- 0:00:54
      169000 -- (-1899.636) (-1901.397) [-1899.146] (-1901.457) * (-1899.646) (-1900.338) [-1901.965] (-1899.301) -- 0:00:54
      169500 -- [-1899.622] (-1902.216) (-1900.255) (-1900.444) * (-1900.068) (-1900.379) (-1899.535) [-1899.179] -- 0:00:53
      170000 -- (-1898.656) [-1904.108] (-1900.935) (-1900.717) * (-1898.690) (-1900.767) [-1900.478] (-1898.157) -- 0:00:53

      Average standard deviation of split frequencies: 0.018092

      170500 -- (-1899.284) (-1899.634) [-1900.764] (-1900.511) * (-1901.250) [-1899.429] (-1900.305) (-1898.555) -- 0:00:53
      171000 -- (-1901.623) (-1900.837) (-1901.787) [-1899.160] * (-1898.729) [-1899.814] (-1904.234) (-1901.127) -- 0:00:53
      171500 -- (-1898.750) (-1902.970) (-1902.256) [-1899.414] * (-1898.729) (-1900.017) [-1899.206] (-1903.166) -- 0:00:53
      172000 -- (-1898.753) [-1900.239] (-1902.906) (-1900.811) * [-1899.661] (-1902.407) (-1900.243) (-1899.404) -- 0:00:52
      172500 -- (-1899.700) [-1902.664] (-1905.943) (-1903.292) * (-1899.556) (-1901.636) (-1901.561) [-1898.292] -- 0:00:52
      173000 -- (-1898.580) (-1905.396) (-1903.770) [-1904.454] * [-1901.526] (-1901.246) (-1900.340) (-1898.998) -- 0:00:52
      173500 -- (-1900.086) (-1899.249) [-1899.360] (-1900.013) * (-1899.053) (-1899.230) (-1901.678) [-1899.733] -- 0:00:52
      174000 -- (-1898.806) [-1898.882] (-1899.617) (-1900.714) * (-1898.653) (-1899.495) (-1898.844) [-1900.105] -- 0:00:52
      174500 -- (-1901.796) [-1901.449] (-1899.441) (-1907.206) * [-1899.778] (-1902.286) (-1898.125) (-1899.470) -- 0:00:52
      175000 -- (-1898.640) [-1901.708] (-1900.728) (-1900.524) * [-1901.501] (-1899.349) (-1898.487) (-1900.686) -- 0:00:51

      Average standard deviation of split frequencies: 0.017339

      175500 -- (-1900.697) (-1901.155) [-1900.728] (-1904.892) * (-1901.240) (-1899.087) [-1898.524] (-1904.119) -- 0:00:51
      176000 -- (-1898.887) [-1899.060] (-1899.913) (-1899.376) * [-1898.970] (-1899.838) (-1899.055) (-1899.835) -- 0:00:51
      176500 -- (-1899.957) [-1898.867] (-1905.728) (-1901.178) * (-1898.406) (-1900.375) [-1898.967] (-1899.819) -- 0:00:51
      177000 -- (-1901.875) [-1899.233] (-1898.858) (-1902.764) * (-1900.836) (-1902.726) [-1897.871] (-1900.392) -- 0:00:51
      177500 -- (-1900.854) [-1899.451] (-1901.144) (-1902.651) * (-1901.945) (-1899.514) (-1898.063) [-1899.396] -- 0:00:50
      178000 -- (-1901.791) (-1899.178) (-1902.208) [-1901.242] * [-1901.651] (-1900.214) (-1900.836) (-1898.018) -- 0:00:50
      178500 -- [-1898.554] (-1899.414) (-1900.610) (-1900.040) * [-1903.303] (-1902.410) (-1901.122) (-1898.861) -- 0:00:50
      179000 -- (-1899.773) (-1899.182) [-1899.989] (-1899.844) * [-1899.567] (-1900.193) (-1900.126) (-1899.093) -- 0:00:50
      179500 -- [-1901.579] (-1899.165) (-1900.114) (-1899.009) * (-1899.226) (-1901.497) [-1899.295] (-1898.812) -- 0:00:50
      180000 -- [-1903.079] (-1899.640) (-1900.358) (-1900.623) * [-1899.485] (-1899.849) (-1899.876) (-1898.948) -- 0:00:50

      Average standard deviation of split frequencies: 0.017105

      180500 -- (-1898.851) (-1899.355) (-1900.168) [-1901.105] * [-1903.092] (-1899.212) (-1902.590) (-1899.422) -- 0:00:49
      181000 -- (-1899.108) [-1899.929] (-1900.604) (-1899.979) * (-1902.712) [-1899.190] (-1899.348) (-1903.147) -- 0:00:49
      181500 -- (-1898.575) (-1900.162) [-1899.241] (-1898.954) * (-1899.000) (-1900.173) (-1900.667) [-1904.391] -- 0:00:54
      182000 -- [-1899.630] (-1903.925) (-1898.902) (-1899.508) * [-1899.499] (-1900.149) (-1900.303) (-1905.988) -- 0:00:53
      182500 -- (-1899.680) (-1901.012) (-1897.987) [-1899.387] * (-1899.486) (-1899.987) [-1900.182] (-1900.052) -- 0:00:53
      183000 -- (-1902.981) (-1900.130) (-1898.787) [-1899.333] * (-1900.882) (-1901.195) [-1902.807] (-1900.678) -- 0:00:53
      183500 -- (-1900.615) [-1899.448] (-1897.919) (-1901.262) * [-1899.832] (-1899.327) (-1899.970) (-1906.145) -- 0:00:53
      184000 -- (-1903.748) (-1900.207) [-1897.932] (-1900.898) * (-1899.072) (-1899.465) (-1899.033) [-1903.067] -- 0:00:53
      184500 -- (-1903.089) [-1901.024] (-1904.427) (-1900.125) * (-1899.376) (-1903.276) (-1902.169) [-1902.267] -- 0:00:53
      185000 -- [-1902.188] (-1899.224) (-1897.889) (-1899.807) * (-1899.037) (-1900.738) [-1901.538] (-1899.901) -- 0:00:52

      Average standard deviation of split frequencies: 0.015967

      185500 -- [-1903.523] (-1899.975) (-1898.611) (-1898.433) * (-1898.286) (-1908.064) [-1898.459] (-1906.242) -- 0:00:52
      186000 -- (-1900.987) (-1903.021) [-1902.020] (-1900.622) * [-1899.733] (-1900.470) (-1898.977) (-1904.234) -- 0:00:52
      186500 -- [-1900.416] (-1899.988) (-1900.463) (-1902.358) * (-1899.956) (-1899.175) [-1900.770] (-1899.807) -- 0:00:52
      187000 -- (-1905.663) (-1898.999) [-1899.773] (-1903.647) * (-1899.909) [-1899.613] (-1902.624) (-1902.750) -- 0:00:52
      187500 -- (-1906.003) [-1900.640] (-1899.706) (-1899.987) * [-1899.466] (-1900.686) (-1901.986) (-1901.905) -- 0:00:52
      188000 -- (-1908.600) (-1900.649) [-1899.861] (-1899.652) * [-1899.260] (-1902.270) (-1903.797) (-1899.253) -- 0:00:51
      188500 -- [-1904.076] (-1901.992) (-1898.668) (-1898.647) * (-1899.672) (-1900.749) (-1900.517) [-1899.286] -- 0:00:51
      189000 -- (-1900.429) (-1902.922) (-1899.798) [-1898.172] * (-1903.030) (-1900.284) [-1901.397] (-1901.052) -- 0:00:51
      189500 -- [-1906.002] (-1899.759) (-1899.028) (-1902.232) * (-1900.427) (-1900.100) [-1901.114] (-1901.112) -- 0:00:51
      190000 -- (-1899.830) [-1900.385] (-1900.382) (-1900.881) * [-1903.249] (-1900.840) (-1901.106) (-1899.474) -- 0:00:51

      Average standard deviation of split frequencies: 0.016396

      190500 -- (-1899.345) (-1901.209) [-1899.551] (-1902.394) * [-1900.216] (-1901.009) (-1902.696) (-1905.748) -- 0:00:50
      191000 -- (-1900.993) (-1907.026) [-1899.174] (-1902.424) * [-1899.388] (-1901.628) (-1900.540) (-1903.632) -- 0:00:50
      191500 -- (-1900.433) (-1899.474) (-1899.232) [-1900.891] * [-1898.886] (-1902.534) (-1900.914) (-1900.173) -- 0:00:50
      192000 -- (-1898.636) [-1900.138] (-1900.958) (-1899.034) * [-1900.458] (-1901.804) (-1898.706) (-1900.264) -- 0:00:50
      192500 -- (-1899.795) (-1900.275) (-1900.265) [-1899.363] * [-1901.164] (-1902.901) (-1898.717) (-1900.723) -- 0:00:50
      193000 -- (-1902.203) (-1903.990) (-1901.918) [-1900.174] * (-1900.001) (-1901.883) (-1901.901) [-1900.521] -- 0:00:50
      193500 -- [-1900.722] (-1901.647) (-1900.802) (-1899.268) * (-1899.592) (-1904.445) [-1900.082] (-1899.690) -- 0:00:50
      194000 -- (-1902.294) (-1900.710) (-1901.647) [-1899.933] * (-1900.063) (-1900.403) [-1899.325] (-1899.605) -- 0:00:49
      194500 -- (-1901.276) (-1902.148) (-1901.130) [-1900.441] * (-1901.677) (-1902.223) (-1899.506) [-1900.478] -- 0:00:49
      195000 -- [-1898.851] (-1902.082) (-1901.117) (-1898.556) * (-1900.923) [-1903.590] (-1898.424) (-1899.468) -- 0:00:49

      Average standard deviation of split frequencies: 0.017370

      195500 -- (-1898.416) (-1903.146) (-1902.838) [-1898.580] * (-1902.161) [-1899.579] (-1898.282) (-1899.759) -- 0:00:49
      196000 -- (-1898.453) (-1900.818) (-1902.762) [-1898.807] * (-1902.946) [-1898.969] (-1898.528) (-1899.513) -- 0:00:49
      196500 -- (-1898.102) [-1900.027] (-1902.906) (-1900.121) * (-1899.340) [-1899.400] (-1899.825) (-1900.033) -- 0:00:49
      197000 -- [-1898.195] (-1899.637) (-1900.816) (-1901.103) * [-1899.541] (-1902.592) (-1899.919) (-1900.786) -- 0:00:48
      197500 -- [-1898.300] (-1899.461) (-1898.482) (-1900.562) * (-1901.612) [-1902.022] (-1900.796) (-1900.405) -- 0:00:52
      198000 -- (-1899.194) (-1899.359) (-1899.167) [-1898.819] * (-1902.911) (-1901.705) (-1899.879) [-1899.525] -- 0:00:52
      198500 -- (-1900.864) (-1900.421) [-1900.173] (-1905.045) * (-1901.293) [-1899.002] (-1898.737) (-1899.978) -- 0:00:52
      199000 -- [-1901.754] (-1903.583) (-1899.123) (-1902.949) * (-1902.188) (-1899.079) [-1899.892] (-1902.139) -- 0:00:52
      199500 -- (-1899.995) (-1901.881) (-1898.551) [-1900.190] * (-1901.718) [-1901.885] (-1901.352) (-1900.494) -- 0:00:52
      200000 -- (-1899.310) (-1900.958) (-1899.121) [-1901.289] * (-1899.719) (-1901.361) [-1901.144] (-1900.493) -- 0:00:51

      Average standard deviation of split frequencies: 0.017227

      200500 -- (-1901.203) [-1902.807] (-1899.668) (-1901.070) * (-1899.663) (-1900.935) (-1900.695) [-1902.026] -- 0:00:51
      201000 -- (-1902.340) (-1901.963) (-1900.587) [-1901.138] * (-1901.579) (-1901.494) [-1900.292] (-1901.165) -- 0:00:51
      201500 -- (-1900.147) (-1901.094) [-1901.026] (-1900.111) * (-1904.249) (-1899.617) (-1905.117) [-1899.638] -- 0:00:51
      202000 -- [-1900.417] (-1901.507) (-1900.472) (-1900.355) * (-1902.128) (-1900.373) (-1898.458) [-1900.504] -- 0:00:51
      202500 -- [-1900.906] (-1900.887) (-1899.912) (-1899.707) * (-1901.074) (-1899.507) [-1898.337] (-1901.119) -- 0:00:51
      203000 -- (-1902.563) (-1900.862) [-1904.442] (-1902.031) * (-1901.078) [-1900.722] (-1899.675) (-1901.180) -- 0:00:51
      203500 -- [-1906.203] (-1902.283) (-1901.727) (-1900.241) * [-1901.195] (-1900.972) (-1905.169) (-1903.791) -- 0:00:50
      204000 -- (-1901.208) [-1902.384] (-1903.356) (-1899.439) * (-1898.595) [-1899.486] (-1900.851) (-1900.674) -- 0:00:50
      204500 -- (-1901.207) (-1902.852) [-1902.724] (-1900.335) * (-1898.267) (-1899.089) (-1899.657) [-1900.533] -- 0:00:50
      205000 -- [-1902.220] (-1902.459) (-1900.437) (-1900.868) * [-1898.679] (-1899.003) (-1899.414) (-1900.533) -- 0:00:50

      Average standard deviation of split frequencies: 0.016909

      205500 -- (-1901.751) [-1902.323] (-1899.272) (-1900.444) * (-1898.382) (-1900.961) [-1899.076] (-1899.714) -- 0:00:50
      206000 -- (-1902.001) [-1899.741] (-1900.522) (-1901.963) * (-1898.332) [-1900.163] (-1900.577) (-1898.503) -- 0:00:50
      206500 -- (-1900.243) [-1898.878] (-1900.144) (-1899.985) * [-1898.632] (-1899.659) (-1899.485) (-1899.359) -- 0:00:49
      207000 -- (-1901.725) (-1902.109) [-1899.893] (-1900.123) * [-1898.327] (-1899.693) (-1898.769) (-1900.072) -- 0:00:49
      207500 -- (-1901.152) [-1899.678] (-1899.873) (-1900.284) * (-1901.710) (-1900.281) [-1901.261] (-1899.902) -- 0:00:49
      208000 -- (-1906.330) (-1902.250) (-1899.521) [-1899.129] * (-1898.036) (-1900.058) [-1900.551] (-1900.791) -- 0:00:49
      208500 -- [-1901.241] (-1900.510) (-1898.460) (-1898.336) * [-1899.213] (-1900.585) (-1898.323) (-1900.776) -- 0:00:49
      209000 -- (-1901.658) (-1900.567) (-1898.920) [-1897.862] * [-1898.088] (-1900.112) (-1899.641) (-1899.497) -- 0:00:49
      209500 -- [-1903.764] (-1902.180) (-1899.660) (-1897.855) * (-1899.691) (-1899.519) (-1899.317) [-1898.228] -- 0:00:49
      210000 -- (-1909.343) [-1899.408] (-1899.275) (-1898.286) * (-1902.507) (-1899.150) (-1898.364) [-1898.174] -- 0:00:48

      Average standard deviation of split frequencies: 0.016037

      210500 -- [-1904.156] (-1901.229) (-1899.894) (-1898.172) * (-1901.294) (-1902.331) [-1898.364] (-1898.059) -- 0:00:48
      211000 -- [-1901.169] (-1901.377) (-1898.722) (-1900.154) * (-1901.499) [-1902.526] (-1899.676) (-1898.106) -- 0:00:48
      211500 -- (-1900.800) (-1905.066) (-1899.654) [-1900.092] * (-1901.292) [-1903.200] (-1899.653) (-1898.515) -- 0:00:48
      212000 -- (-1900.751) (-1901.418) [-1901.299] (-1899.439) * (-1901.430) (-1901.436) (-1898.595) [-1899.556] -- 0:00:48
      212500 -- (-1900.212) (-1900.926) [-1900.993] (-1900.924) * (-1902.218) [-1899.199] (-1899.487) (-1899.604) -- 0:00:48
      213000 -- [-1899.690] (-1901.460) (-1900.357) (-1904.612) * (-1902.279) (-1901.946) [-1901.353] (-1899.728) -- 0:00:51
      213500 -- (-1898.201) (-1901.200) [-1901.304] (-1900.787) * [-1899.581] (-1899.444) (-1899.718) (-1902.073) -- 0:00:51
      214000 -- (-1898.603) (-1899.588) [-1901.899] (-1899.228) * (-1899.265) (-1903.417) [-1900.579] (-1903.272) -- 0:00:51
      214500 -- (-1901.359) (-1901.201) [-1901.802] (-1898.733) * [-1898.823] (-1902.817) (-1900.694) (-1902.184) -- 0:00:51
      215000 -- (-1900.596) [-1904.264] (-1900.899) (-1901.756) * [-1898.642] (-1898.692) (-1904.449) (-1904.536) -- 0:00:51

      Average standard deviation of split frequencies: 0.016368

      215500 -- (-1900.409) [-1904.858] (-1899.840) (-1902.447) * (-1898.683) (-1898.668) [-1903.234] (-1900.411) -- 0:00:50
      216000 -- (-1900.031) (-1901.492) [-1899.256] (-1903.986) * (-1899.565) (-1900.790) [-1905.239] (-1899.467) -- 0:00:50
      216500 -- (-1901.023) (-1898.773) (-1897.966) [-1901.946] * (-1899.527) [-1902.400] (-1902.475) (-1899.011) -- 0:00:50
      217000 -- (-1900.915) (-1900.194) [-1897.905] (-1898.335) * (-1898.705) (-1905.187) [-1902.057] (-1903.851) -- 0:00:50
      217500 -- [-1901.776] (-1898.940) (-1898.130) (-1898.690) * [-1898.955] (-1902.305) (-1901.705) (-1899.655) -- 0:00:50
      218000 -- [-1902.224] (-1898.987) (-1899.586) (-1899.345) * (-1901.914) [-1899.653] (-1903.919) (-1899.857) -- 0:00:50
      218500 -- [-1901.152] (-1898.326) (-1897.980) (-1898.745) * (-1900.114) (-1900.439) [-1901.439] (-1899.814) -- 0:00:50
      219000 -- (-1901.065) [-1899.408] (-1899.022) (-1898.647) * (-1899.266) [-1901.536] (-1901.280) (-1900.521) -- 0:00:49
      219500 -- (-1900.050) (-1900.788) [-1899.913] (-1898.370) * [-1900.459] (-1899.257) (-1903.554) (-1905.449) -- 0:00:49
      220000 -- (-1900.420) (-1901.218) [-1900.479] (-1898.204) * (-1899.281) (-1901.793) (-1902.213) [-1898.614] -- 0:00:49

      Average standard deviation of split frequencies: 0.016640

      220500 -- (-1899.562) (-1903.862) (-1899.813) [-1898.333] * (-1899.347) (-1900.098) [-1900.788] (-1898.162) -- 0:00:49
      221000 -- [-1899.119] (-1902.236) (-1900.160) (-1898.356) * (-1899.960) [-1900.271] (-1901.722) (-1905.800) -- 0:00:49
      221500 -- (-1898.645) [-1902.235] (-1898.651) (-1898.823) * [-1898.986] (-1900.756) (-1902.286) (-1899.981) -- 0:00:49
      222000 -- (-1899.192) (-1902.691) (-1898.923) [-1898.834] * [-1900.861] (-1899.882) (-1900.351) (-1902.843) -- 0:00:49
      222500 -- (-1899.762) [-1902.439] (-1898.454) (-1900.715) * [-1901.049] (-1899.467) (-1901.786) (-1901.939) -- 0:00:48
      223000 -- (-1898.130) (-1901.064) (-1898.455) [-1899.119] * [-1899.235] (-1903.034) (-1898.365) (-1902.596) -- 0:00:48
      223500 -- (-1899.686) [-1902.020] (-1899.383) (-1898.597) * (-1899.969) (-1906.117) [-1898.974] (-1902.487) -- 0:00:48
      224000 -- (-1900.002) (-1902.597) [-1900.925] (-1903.549) * (-1900.699) (-1902.122) (-1899.056) [-1899.486] -- 0:00:48
      224500 -- (-1902.077) (-1902.564) (-1901.799) [-1902.821] * [-1903.158] (-1898.885) (-1898.936) (-1901.731) -- 0:00:48
      225000 -- (-1900.868) (-1901.078) [-1899.399] (-1901.644) * (-1899.782) [-1898.482] (-1899.104) (-1901.731) -- 0:00:48

      Average standard deviation of split frequencies: 0.015853

      225500 -- (-1900.924) (-1903.783) (-1899.497) [-1907.202] * (-1899.889) (-1899.568) [-1898.600] (-1903.386) -- 0:00:48
      226000 -- (-1898.935) (-1902.549) [-1898.066] (-1908.133) * [-1899.006] (-1900.569) (-1901.359) (-1901.111) -- 0:00:47
      226500 -- [-1899.428] (-1903.774) (-1898.328) (-1907.539) * (-1898.936) (-1902.550) [-1899.784] (-1899.833) -- 0:00:47
      227000 -- (-1899.053) [-1902.192] (-1898.423) (-1904.794) * (-1899.066) [-1898.974] (-1898.122) (-1899.607) -- 0:00:47
      227500 -- (-1899.959) (-1900.913) (-1899.389) [-1904.439] * [-1898.826] (-1899.561) (-1899.438) (-1901.440) -- 0:00:47
      228000 -- [-1899.819] (-1900.439) (-1899.470) (-1899.476) * [-1898.798] (-1899.169) (-1898.900) (-1900.999) -- 0:00:47
      228500 -- (-1902.589) (-1900.964) [-1898.437] (-1899.613) * (-1900.718) [-1901.458] (-1901.622) (-1902.949) -- 0:00:50
      229000 -- (-1903.823) (-1905.042) (-1898.500) [-1901.745] * [-1900.598] (-1899.488) (-1905.875) (-1900.532) -- 0:00:50
      229500 -- (-1905.756) (-1901.395) (-1901.953) [-1898.575] * (-1898.705) (-1899.259) [-1899.090] (-1900.253) -- 0:00:50
      230000 -- (-1902.865) [-1899.818] (-1901.918) (-1898.917) * (-1903.058) (-1898.459) (-1899.260) [-1900.099] -- 0:00:50

      Average standard deviation of split frequencies: 0.017269

      230500 -- (-1903.162) (-1901.278) [-1898.830] (-1900.238) * (-1900.361) (-1898.804) (-1899.969) [-1904.295] -- 0:00:50
      231000 -- (-1901.837) (-1904.369) (-1900.546) [-1899.249] * (-1899.148) [-1900.932] (-1901.029) (-1903.840) -- 0:00:49
      231500 -- [-1898.552] (-1903.173) (-1900.830) (-1899.623) * (-1902.503) [-1899.907] (-1900.815) (-1901.316) -- 0:00:49
      232000 -- [-1898.623] (-1905.859) (-1899.192) (-1898.640) * (-1901.782) (-1899.506) [-1899.141] (-1900.066) -- 0:00:49
      232500 -- (-1898.214) (-1901.910) [-1898.979] (-1899.181) * [-1899.762] (-1899.587) (-1905.047) (-1900.065) -- 0:00:49
      233000 -- (-1901.996) (-1902.032) (-1898.843) [-1900.214] * (-1899.761) (-1899.183) [-1904.974] (-1900.382) -- 0:00:49
      233500 -- (-1901.708) (-1901.884) [-1898.787] (-1899.391) * [-1904.841] (-1902.451) (-1900.033) (-1900.281) -- 0:00:49
      234000 -- (-1902.467) (-1901.800) [-1898.857] (-1899.007) * (-1901.858) [-1901.078] (-1902.810) (-1900.276) -- 0:00:49
      234500 -- [-1900.443] (-1904.300) (-1900.053) (-1899.837) * (-1901.372) (-1900.416) [-1903.157] (-1899.864) -- 0:00:48
      235000 -- (-1899.028) (-1898.667) [-1899.772] (-1901.718) * (-1900.646) [-1900.999] (-1900.448) (-1901.427) -- 0:00:48

      Average standard deviation of split frequencies: 0.017078

      235500 -- (-1898.029) [-1900.559] (-1900.017) (-1900.981) * [-1899.909] (-1901.603) (-1900.631) (-1899.891) -- 0:00:48
      236000 -- (-1898.006) (-1899.308) (-1899.323) [-1900.489] * (-1899.835) (-1899.761) (-1902.957) [-1901.068] -- 0:00:48
      236500 -- [-1897.867] (-1899.811) (-1898.715) (-1899.958) * [-1899.733] (-1900.533) (-1905.547) (-1900.818) -- 0:00:48
      237000 -- (-1899.228) (-1900.621) [-1899.226] (-1899.304) * (-1903.802) [-1900.172] (-1903.565) (-1903.143) -- 0:00:48
      237500 -- (-1901.681) [-1905.295] (-1898.702) (-1900.199) * [-1900.155] (-1899.067) (-1905.150) (-1905.763) -- 0:00:48
      238000 -- (-1902.197) (-1898.852) (-1898.341) [-1901.890] * [-1902.832] (-1900.766) (-1905.937) (-1906.205) -- 0:00:48
      238500 -- (-1902.730) [-1898.811] (-1899.579) (-1901.936) * [-1902.397] (-1903.190) (-1898.180) (-1904.792) -- 0:00:47
      239000 -- (-1899.797) (-1903.865) [-1899.477] (-1900.580) * (-1902.270) (-1906.012) (-1899.110) [-1901.077] -- 0:00:47
      239500 -- (-1898.890) (-1899.168) (-1899.355) [-1899.793] * (-1902.038) (-1905.279) (-1899.159) [-1902.594] -- 0:00:47
      240000 -- (-1901.825) (-1899.594) [-1900.661] (-1902.417) * [-1899.702] (-1902.188) (-1898.498) (-1901.122) -- 0:00:47

      Average standard deviation of split frequencies: 0.016758

      240500 -- (-1900.411) (-1900.920) (-1901.154) [-1901.474] * (-1900.501) [-1901.877] (-1898.498) (-1899.242) -- 0:00:47
      241000 -- (-1902.069) [-1902.446] (-1900.289) (-1903.713) * (-1899.657) (-1902.099) (-1899.275) [-1898.456] -- 0:00:47
      241500 -- (-1904.137) (-1899.756) (-1900.531) [-1900.251] * (-1899.836) (-1898.602) (-1900.099) [-1898.177] -- 0:00:47
      242000 -- (-1901.746) (-1899.077) (-1903.306) [-1901.620] * [-1901.186] (-1900.142) (-1900.268) (-1897.946) -- 0:00:46
      242500 -- [-1902.066] (-1900.257) (-1904.518) (-1899.501) * (-1902.719) (-1903.858) [-1900.335] (-1899.586) -- 0:00:46
      243000 -- (-1900.386) (-1899.452) [-1903.578] (-1899.220) * (-1903.982) (-1905.464) [-1898.351] (-1899.137) -- 0:00:46
      243500 -- [-1900.324] (-1898.823) (-1902.078) (-1901.106) * [-1900.518] (-1902.658) (-1901.067) (-1899.111) -- 0:00:46
      244000 -- (-1899.896) [-1904.565] (-1900.864) (-1899.477) * (-1902.544) (-1903.096) [-1900.805] (-1899.724) -- 0:00:49
      244500 -- [-1899.976] (-1899.967) (-1900.115) (-1899.348) * (-1904.513) [-1899.108] (-1901.939) (-1898.138) -- 0:00:49
      245000 -- [-1900.235] (-1898.533) (-1898.263) (-1902.373) * (-1902.920) (-1899.299) (-1903.217) [-1899.275] -- 0:00:49

      Average standard deviation of split frequencies: 0.015969

      245500 -- (-1899.093) (-1898.542) (-1901.973) [-1902.087] * (-1902.672) (-1900.083) [-1900.731] (-1899.440) -- 0:00:49
      246000 -- (-1898.954) [-1898.697] (-1898.395) (-1898.458) * (-1905.569) (-1899.509) (-1902.816) [-1899.580] -- 0:00:49
      246500 -- (-1898.905) (-1899.066) [-1899.492] (-1898.335) * (-1903.470) (-1900.481) [-1898.038] (-1901.959) -- 0:00:48
      247000 -- [-1898.671] (-1899.478) (-1899.763) (-1898.130) * [-1901.062] (-1900.850) (-1901.075) (-1901.623) -- 0:00:48
      247500 -- (-1899.140) [-1901.684] (-1903.608) (-1899.214) * (-1901.304) [-1900.401] (-1901.801) (-1902.772) -- 0:00:48
      248000 -- [-1899.344] (-1902.709) (-1904.946) (-1900.464) * (-1902.565) (-1902.535) [-1902.098] (-1900.610) -- 0:00:48
      248500 -- (-1900.648) [-1902.460] (-1901.791) (-1899.667) * [-1904.115] (-1902.240) (-1903.833) (-1904.166) -- 0:00:48
      249000 -- [-1901.088] (-1904.210) (-1902.325) (-1899.682) * (-1901.022) [-1899.083] (-1901.665) (-1902.091) -- 0:00:48
      249500 -- (-1901.094) [-1904.850] (-1899.624) (-1900.155) * [-1900.495] (-1900.160) (-1901.907) (-1900.539) -- 0:00:48
      250000 -- [-1902.139] (-1902.013) (-1899.697) (-1899.226) * (-1899.068) (-1901.266) [-1900.288] (-1900.360) -- 0:00:48

      Average standard deviation of split frequencies: 0.015672

      250500 -- (-1902.762) (-1900.529) (-1899.708) [-1899.926] * (-1900.959) [-1899.709] (-1900.327) (-1900.186) -- 0:00:47
      251000 -- (-1902.700) [-1900.165] (-1899.185) (-1901.700) * [-1900.196] (-1899.169) (-1899.638) (-1899.516) -- 0:00:47
      251500 -- (-1903.315) (-1899.960) [-1898.627] (-1900.302) * [-1898.765] (-1899.844) (-1901.517) (-1899.514) -- 0:00:47
      252000 -- [-1902.288] (-1899.890) (-1899.424) (-1900.228) * (-1899.135) (-1901.600) [-1902.344] (-1900.251) -- 0:00:47
      252500 -- (-1901.510) (-1901.284) [-1900.241] (-1902.283) * [-1898.185] (-1905.432) (-1902.454) (-1900.951) -- 0:00:47
      253000 -- (-1900.041) (-1899.844) [-1899.190] (-1900.389) * [-1900.464] (-1906.535) (-1899.179) (-1899.773) -- 0:00:47
      253500 -- (-1902.058) (-1898.876) (-1901.370) [-1900.683] * [-1900.342] (-1903.161) (-1901.427) (-1900.352) -- 0:00:47
      254000 -- (-1899.483) (-1898.876) [-1899.851] (-1901.396) * (-1901.237) (-1901.655) (-1899.188) [-1900.024] -- 0:00:46
      254500 -- [-1899.228] (-1900.647) (-1899.730) (-1904.674) * (-1899.649) (-1900.936) [-1901.721] (-1900.009) -- 0:00:46
      255000 -- (-1899.656) [-1900.411] (-1899.841) (-1901.649) * (-1900.807) (-1899.077) [-1899.226] (-1901.095) -- 0:00:46

      Average standard deviation of split frequencies: 0.016164

      255500 -- (-1899.867) (-1899.159) (-1898.783) [-1902.463] * (-1900.971) [-1898.319] (-1901.975) (-1903.063) -- 0:00:46
      256000 -- (-1900.214) [-1898.768] (-1899.186) (-1902.932) * [-1897.928] (-1899.347) (-1903.096) (-1903.582) -- 0:00:46
      256500 -- (-1900.643) (-1900.717) [-1900.734] (-1901.227) * (-1898.069) (-1899.736) [-1905.835] (-1899.351) -- 0:00:46
      257000 -- (-1899.055) (-1900.738) [-1902.034] (-1906.712) * [-1899.278] (-1901.646) (-1901.898) (-1899.753) -- 0:00:46
      257500 -- [-1899.327] (-1902.127) (-1901.292) (-1901.845) * [-1898.228] (-1900.987) (-1902.422) (-1898.511) -- 0:00:46
      258000 -- (-1901.396) [-1898.682] (-1902.157) (-1901.824) * [-1898.050] (-1900.019) (-1905.494) (-1898.099) -- 0:00:46
      258500 -- [-1898.597] (-1901.399) (-1906.031) (-1901.222) * [-1898.050] (-1900.138) (-1903.592) (-1899.384) -- 0:00:45
      259000 -- (-1900.648) (-1901.093) [-1901.339] (-1905.605) * [-1898.075] (-1900.571) (-1903.094) (-1899.020) -- 0:00:45
      259500 -- (-1899.993) (-1899.829) (-1909.397) [-1903.392] * (-1899.437) (-1900.707) (-1898.823) [-1900.825] -- 0:00:48
      260000 -- (-1899.993) [-1898.876] (-1905.638) (-1904.452) * (-1899.004) [-1899.723] (-1899.772) (-1900.191) -- 0:00:48

      Average standard deviation of split frequencies: 0.016276

      260500 -- (-1900.237) [-1899.791] (-1900.200) (-1901.817) * (-1899.382) (-1899.376) [-1898.792] (-1899.683) -- 0:00:48
      261000 -- [-1899.251] (-1899.706) (-1899.145) (-1901.729) * (-1898.893) (-1900.731) [-1898.614] (-1899.566) -- 0:00:48
      261500 -- (-1901.720) [-1899.417] (-1899.267) (-1902.192) * [-1898.731] (-1904.037) (-1899.262) (-1898.944) -- 0:00:48
      262000 -- [-1899.143] (-1899.344) (-1900.771) (-1900.662) * (-1898.057) (-1901.119) (-1899.265) [-1898.806] -- 0:00:47
      262500 -- (-1900.363) (-1898.983) [-1900.641] (-1902.341) * (-1900.054) (-1902.353) [-1899.092] (-1899.399) -- 0:00:47
      263000 -- (-1902.551) (-1898.823) [-1901.084] (-1902.835) * [-1898.455] (-1900.624) (-1898.945) (-1899.488) -- 0:00:47
      263500 -- (-1899.478) (-1897.948) [-1901.517] (-1898.557) * (-1899.458) (-1900.845) [-1900.219] (-1898.887) -- 0:00:47
      264000 -- (-1902.806) (-1898.812) (-1900.592) [-1898.637] * (-1901.417) (-1905.854) [-1901.224] (-1899.723) -- 0:00:47
      264500 -- (-1900.623) (-1898.659) (-1899.932) [-1901.946] * (-1901.887) [-1907.767] (-1898.899) (-1900.624) -- 0:00:47
      265000 -- (-1900.932) [-1898.770] (-1900.286) (-1903.261) * [-1899.859] (-1905.905) (-1899.043) (-1898.758) -- 0:00:47

      Average standard deviation of split frequencies: 0.016048

      265500 -- (-1899.320) (-1899.017) (-1903.213) [-1903.512] * (-1899.568) (-1901.509) (-1901.049) [-1900.635] -- 0:00:47
      266000 -- [-1898.938] (-1904.006) (-1900.566) (-1903.414) * (-1899.826) (-1900.534) (-1901.198) [-1898.570] -- 0:00:46
      266500 -- (-1898.861) [-1902.063] (-1903.360) (-1905.002) * (-1903.524) (-1900.954) (-1897.856) [-1898.264] -- 0:00:46
      267000 -- [-1898.852] (-1901.245) (-1898.802) (-1903.374) * (-1899.125) [-1900.769] (-1898.486) (-1901.736) -- 0:00:46
      267500 -- (-1903.722) [-1901.305] (-1902.155) (-1902.539) * [-1900.367] (-1901.676) (-1898.326) (-1901.872) -- 0:00:46
      268000 -- (-1902.691) (-1901.230) [-1899.164] (-1902.869) * (-1901.467) (-1902.060) (-1898.832) [-1902.084] -- 0:00:46
      268500 -- [-1900.422] (-1904.265) (-1900.152) (-1904.726) * (-1901.757) (-1900.902) [-1899.319] (-1899.032) -- 0:00:46
      269000 -- [-1900.437] (-1902.581) (-1901.020) (-1901.493) * (-1900.914) (-1901.010) [-1899.485] (-1901.069) -- 0:00:46
      269500 -- (-1901.714) [-1899.037] (-1900.988) (-1900.775) * (-1898.709) [-1903.315] (-1900.486) (-1899.978) -- 0:00:46
      270000 -- (-1901.577) [-1898.844] (-1899.601) (-1900.885) * (-1899.000) (-1899.525) (-1900.663) [-1901.537] -- 0:00:45

      Average standard deviation of split frequencies: 0.016159

      270500 -- (-1901.204) [-1898.791] (-1898.875) (-1900.013) * (-1899.459) [-1899.963] (-1900.945) (-1901.535) -- 0:00:45
      271000 -- (-1901.300) (-1899.097) [-1899.229] (-1899.810) * (-1898.795) (-1899.255) (-1903.307) [-1899.312] -- 0:00:45
      271500 -- (-1902.714) (-1898.699) (-1902.304) [-1900.282] * (-1899.309) (-1901.817) [-1899.488] (-1899.760) -- 0:00:45
      272000 -- [-1900.016] (-1899.999) (-1904.855) (-1899.963) * (-1899.382) (-1900.958) [-1898.276] (-1899.140) -- 0:00:45
      272500 -- (-1900.685) [-1898.676] (-1903.932) (-1900.309) * [-1899.461] (-1902.504) (-1898.276) (-1898.770) -- 0:00:45
      273000 -- [-1900.058] (-1897.967) (-1900.306) (-1900.484) * (-1898.526) (-1901.589) [-1898.617] (-1898.766) -- 0:00:45
      273500 -- (-1899.078) (-1898.669) (-1901.651) [-1899.601] * (-1898.979) [-1899.540] (-1901.826) (-1899.153) -- 0:00:45
      274000 -- (-1901.560) (-1898.055) (-1900.808) [-1899.736] * (-1899.377) (-1901.492) [-1899.105] (-1901.021) -- 0:00:45
      274500 -- (-1902.052) (-1898.874) (-1901.589) [-1899.561] * (-1898.637) (-1899.880) (-1899.195) [-1898.595] -- 0:00:44
      275000 -- [-1900.996] (-1899.606) (-1904.543) (-1898.468) * [-1899.857] (-1899.756) (-1900.309) (-1898.972) -- 0:00:47

      Average standard deviation of split frequencies: 0.016985

      275500 -- [-1898.775] (-1899.398) (-1909.637) (-1899.098) * (-1899.055) [-1899.860] (-1899.745) (-1902.746) -- 0:00:47
      276000 -- [-1901.682] (-1900.230) (-1899.525) (-1901.133) * (-1901.679) [-1900.806] (-1898.861) (-1901.505) -- 0:00:47
      276500 -- (-1900.017) [-1903.228] (-1898.514) (-1900.517) * [-1903.362] (-1899.632) (-1899.887) (-1900.951) -- 0:00:47
      277000 -- [-1899.423] (-1901.753) (-1901.016) (-1900.302) * [-1901.797] (-1902.270) (-1898.140) (-1900.466) -- 0:00:46
      277500 -- [-1901.785] (-1900.719) (-1900.878) (-1901.987) * [-1901.207] (-1900.316) (-1900.801) (-1898.407) -- 0:00:46
      278000 -- (-1903.854) [-1906.196] (-1900.782) (-1900.969) * (-1898.622) (-1900.253) (-1900.212) [-1899.533] -- 0:00:46
      278500 -- [-1903.300] (-1906.950) (-1900.409) (-1902.098) * (-1901.321) [-1899.435] (-1902.034) (-1899.304) -- 0:00:46
      279000 -- [-1898.811] (-1901.586) (-1901.472) (-1906.103) * [-1901.462] (-1899.560) (-1899.964) (-1900.782) -- 0:00:46
      279500 -- (-1899.208) (-1899.584) [-1901.425] (-1906.181) * (-1900.796) (-1901.003) (-1900.490) [-1901.131] -- 0:00:46
      280000 -- (-1898.980) [-1899.949] (-1899.974) (-1907.965) * (-1900.965) (-1901.610) (-1897.980) [-1900.431] -- 0:00:46

      Average standard deviation of split frequencies: 0.016983

      280500 -- [-1898.539] (-1899.783) (-1901.120) (-1901.550) * (-1901.517) (-1900.579) (-1899.369) [-1900.594] -- 0:00:46
      281000 -- (-1900.369) [-1899.015] (-1903.822) (-1902.754) * [-1900.117] (-1899.680) (-1899.805) (-1899.774) -- 0:00:46
      281500 -- (-1898.709) [-1899.394] (-1902.028) (-1900.725) * (-1899.167) (-1899.417) [-1899.398] (-1899.747) -- 0:00:45
      282000 -- (-1899.346) (-1899.493) (-1900.687) [-1898.863] * (-1899.239) [-1902.086] (-1899.347) (-1901.860) -- 0:00:45
      282500 -- (-1902.035) (-1899.978) (-1899.520) [-1900.249] * [-1899.502] (-1900.047) (-1899.472) (-1899.108) -- 0:00:45
      283000 -- (-1902.384) (-1899.673) (-1899.349) [-1903.122] * (-1900.690) [-1900.138] (-1898.687) (-1899.731) -- 0:00:45
      283500 -- (-1901.369) (-1899.008) (-1903.762) [-1899.312] * (-1903.182) [-1900.659] (-1901.591) (-1904.213) -- 0:00:45
      284000 -- (-1901.160) (-1898.696) [-1899.467] (-1898.919) * (-1898.940) (-1902.264) [-1902.024] (-1902.573) -- 0:00:45
      284500 -- (-1900.205) [-1898.445] (-1900.684) (-1903.836) * [-1902.120] (-1901.155) (-1901.512) (-1904.270) -- 0:00:45
      285000 -- (-1901.596) [-1898.234] (-1900.737) (-1903.074) * (-1900.575) [-1902.462] (-1905.634) (-1903.607) -- 0:00:45

      Average standard deviation of split frequencies: 0.016300

      285500 -- [-1902.318] (-1898.234) (-1900.649) (-1899.930) * [-1899.836] (-1902.883) (-1903.766) (-1907.918) -- 0:00:45
      286000 -- (-1899.653) (-1898.294) [-1900.022] (-1900.867) * (-1901.306) (-1898.413) (-1903.835) [-1899.819] -- 0:00:44
      286500 -- (-1900.065) [-1898.961] (-1903.565) (-1898.959) * (-1901.610) [-1897.910] (-1899.883) (-1903.012) -- 0:00:44
      287000 -- (-1900.269) [-1899.341] (-1898.223) (-1898.962) * (-1902.637) [-1899.089] (-1900.248) (-1904.791) -- 0:00:44
      287500 -- (-1900.055) (-1898.263) (-1898.132) [-1899.363] * (-1899.051) (-1907.824) [-1901.010] (-1905.644) -- 0:00:44
      288000 -- (-1899.045) [-1898.253] (-1899.738) (-1899.796) * [-1902.930] (-1900.166) (-1900.243) (-1908.856) -- 0:00:44
      288500 -- (-1898.820) [-1900.280] (-1898.582) (-1899.352) * (-1899.843) (-1899.584) [-1899.769] (-1903.671) -- 0:00:44
      289000 -- [-1899.729] (-1898.818) (-1900.391) (-1900.796) * (-1899.379) [-1899.679] (-1903.061) (-1903.084) -- 0:00:44
      289500 -- (-1899.451) (-1900.001) [-1898.640] (-1900.459) * (-1900.852) (-1900.525) [-1900.839] (-1900.675) -- 0:00:44
      290000 -- [-1900.740] (-1900.602) (-1898.783) (-1901.583) * [-1900.004] (-1898.084) (-1900.829) (-1902.357) -- 0:00:46

      Average standard deviation of split frequencies: 0.014326

      290500 -- (-1901.473) (-1898.593) (-1900.433) [-1902.794] * (-1900.716) (-1898.466) (-1905.252) [-1900.121] -- 0:00:46
      291000 -- (-1901.419) (-1898.361) (-1901.511) [-1898.517] * (-1900.621) (-1898.817) (-1904.478) [-1899.408] -- 0:00:46
      291500 -- (-1901.177) (-1898.693) (-1899.614) [-1898.414] * (-1901.813) [-1902.756] (-1901.914) (-1899.226) -- 0:00:46
      292000 -- [-1899.951] (-1900.019) (-1899.614) (-1899.167) * (-1900.031) (-1899.412) (-1902.921) [-1899.252] -- 0:00:46
      292500 -- [-1899.179] (-1900.019) (-1900.904) (-1898.313) * (-1903.278) (-1898.360) [-1901.142] (-1899.419) -- 0:00:45
      293000 -- (-1899.503) (-1899.116) (-1902.555) [-1899.381] * [-1903.847] (-1903.305) (-1899.020) (-1898.453) -- 0:00:45
      293500 -- (-1899.382) (-1899.106) (-1904.574) [-1899.906] * [-1902.523] (-1898.545) (-1898.563) (-1900.873) -- 0:00:45
      294000 -- (-1899.800) [-1898.463] (-1902.047) (-1899.704) * (-1903.393) [-1898.862] (-1900.289) (-1899.589) -- 0:00:45
      294500 -- [-1899.634] (-1900.124) (-1901.668) (-1899.788) * (-1904.254) (-1900.711) [-1899.065] (-1910.626) -- 0:00:45
      295000 -- (-1901.729) [-1899.649] (-1902.123) (-1900.438) * (-1900.115) [-1900.897] (-1898.129) (-1901.005) -- 0:00:45

      Average standard deviation of split frequencies: 0.013802

      295500 -- (-1900.484) [-1900.015] (-1900.198) (-1900.172) * [-1899.599] (-1902.618) (-1899.076) (-1903.602) -- 0:00:45
      296000 -- (-1902.101) [-1900.633] (-1900.047) (-1899.061) * (-1899.050) (-1902.364) [-1899.524] (-1901.792) -- 0:00:45
      296500 -- (-1899.130) [-1899.440] (-1898.849) (-1899.586) * (-1899.216) (-1901.023) [-1899.032] (-1899.715) -- 0:00:45
      297000 -- (-1899.549) [-1899.930] (-1899.769) (-1899.983) * (-1902.641) (-1902.841) [-1898.254] (-1901.196) -- 0:00:44
      297500 -- [-1899.190] (-1901.130) (-1900.585) (-1900.161) * (-1905.510) (-1900.430) [-1898.579] (-1898.944) -- 0:00:44
      298000 -- [-1898.390] (-1901.008) (-1898.727) (-1900.889) * (-1907.032) (-1902.223) (-1903.749) [-1901.770] -- 0:00:44
      298500 -- [-1899.415] (-1900.024) (-1898.494) (-1900.613) * (-1908.848) (-1903.488) (-1899.539) [-1899.396] -- 0:00:44
      299000 -- (-1899.014) (-1898.954) (-1900.068) [-1900.004] * (-1903.693) (-1902.833) [-1899.633] (-1899.947) -- 0:00:44
      299500 -- (-1903.767) (-1899.506) [-1901.443] (-1900.686) * (-1901.123) [-1901.026] (-1898.969) (-1900.254) -- 0:00:44
      300000 -- (-1899.315) [-1899.236] (-1900.305) (-1900.154) * [-1903.092] (-1902.973) (-1899.033) (-1899.044) -- 0:00:44

      Average standard deviation of split frequencies: 0.012891

      300500 -- (-1899.371) (-1898.389) [-1899.549] (-1899.710) * (-1904.324) (-1902.262) (-1900.210) [-1899.000] -- 0:00:44
      301000 -- [-1898.120] (-1898.389) (-1900.675) (-1898.890) * (-1899.119) (-1899.749) (-1900.261) [-1898.649] -- 0:00:44
      301500 -- (-1898.425) (-1905.650) [-1901.346] (-1902.551) * (-1900.053) (-1902.675) (-1900.863) [-1898.952] -- 0:00:44
      302000 -- (-1900.574) (-1904.364) (-1900.471) [-1902.321] * (-1899.333) [-1901.759] (-1899.828) (-1902.067) -- 0:00:43
      302500 -- (-1899.292) (-1902.245) [-1898.673] (-1901.175) * [-1901.516] (-1900.842) (-1899.638) (-1899.201) -- 0:00:43
      303000 -- (-1901.545) (-1902.675) [-1898.804] (-1899.728) * (-1900.731) (-1902.430) [-1899.549] (-1898.461) -- 0:00:43
      303500 -- (-1899.368) (-1900.967) [-1899.446] (-1902.015) * [-1899.438] (-1899.863) (-1901.050) (-1898.599) -- 0:00:43
      304000 -- (-1899.528) (-1899.878) (-1899.529) [-1899.686] * [-1900.398] (-1899.732) (-1900.510) (-1902.201) -- 0:00:43
      304500 -- (-1903.579) (-1900.960) (-1900.018) [-1903.028] * (-1902.206) (-1900.467) (-1899.583) [-1899.590] -- 0:00:43
      305000 -- (-1904.292) (-1901.537) (-1899.544) [-1900.864] * (-1904.158) (-1900.741) [-1900.787] (-1898.843) -- 0:00:43

      Average standard deviation of split frequencies: 0.012239

      305500 -- (-1901.081) (-1901.331) [-1900.073] (-1900.227) * [-1898.788] (-1899.068) (-1902.643) (-1899.381) -- 0:00:45
      306000 -- [-1899.717] (-1900.487) (-1899.162) (-1900.203) * (-1899.168) (-1900.280) (-1907.177) [-1900.366] -- 0:00:45
      306500 -- [-1900.589] (-1901.096) (-1901.129) (-1902.086) * (-1899.363) (-1900.403) (-1904.947) [-1900.659] -- 0:00:45
      307000 -- [-1900.560] (-1901.011) (-1901.979) (-1900.185) * (-1902.549) [-1901.490] (-1900.454) (-1903.485) -- 0:00:45
      307500 -- (-1898.847) (-1899.183) (-1899.589) [-1902.863] * [-1902.010] (-1898.337) (-1900.367) (-1899.011) -- 0:00:45
      308000 -- (-1899.981) (-1899.208) [-1901.111] (-1902.982) * (-1899.782) (-1898.247) [-1900.069] (-1898.256) -- 0:00:44
      308500 -- (-1900.345) [-1899.337] (-1898.696) (-1902.368) * (-1900.016) [-1898.888] (-1901.043) (-1899.000) -- 0:00:44
      309000 -- (-1898.940) [-1899.226] (-1899.229) (-1901.046) * (-1901.214) [-1899.988] (-1899.446) (-1899.000) -- 0:00:44
      309500 -- (-1898.626) (-1898.900) (-1898.940) [-1900.092] * [-1898.854] (-1901.169) (-1899.446) (-1898.845) -- 0:00:44
      310000 -- [-1905.375] (-1898.042) (-1898.390) (-1900.763) * [-1900.232] (-1899.478) (-1900.916) (-1900.646) -- 0:00:44

      Average standard deviation of split frequencies: 0.011296

      310500 -- (-1899.081) (-1900.136) [-1899.335] (-1901.454) * [-1900.369] (-1899.831) (-1900.883) (-1899.812) -- 0:00:44
      311000 -- (-1899.129) [-1898.792] (-1899.331) (-1903.714) * [-1898.829] (-1899.051) (-1900.783) (-1900.569) -- 0:00:44
      311500 -- (-1906.807) (-1902.245) [-1901.180] (-1902.897) * (-1900.467) (-1899.835) (-1900.086) [-1900.864] -- 0:00:44
      312000 -- (-1902.355) (-1900.117) [-1899.941] (-1902.036) * (-1901.108) (-1899.526) (-1903.144) [-1900.202] -- 0:00:44
      312500 -- (-1900.494) (-1899.671) [-1900.277] (-1902.152) * (-1899.495) [-1903.502] (-1900.520) (-1900.093) -- 0:00:44
      313000 -- (-1899.657) (-1901.276) (-1899.814) [-1900.547] * (-1899.038) (-1899.716) [-1902.681] (-1899.992) -- 0:00:43
      313500 -- (-1898.660) (-1902.803) (-1899.911) [-1899.348] * (-1900.348) (-1905.319) [-1901.989] (-1900.845) -- 0:00:43
      314000 -- (-1898.764) (-1903.454) [-1900.336] (-1902.600) * [-1898.364] (-1902.545) (-1902.804) (-1904.247) -- 0:00:43
      314500 -- (-1899.504) (-1902.562) (-1899.881) [-1902.934] * [-1898.361] (-1902.900) (-1902.671) (-1898.803) -- 0:00:43
      315000 -- (-1900.168) [-1902.216] (-1899.307) (-1903.649) * [-1898.161] (-1902.317) (-1899.169) (-1898.492) -- 0:00:43

      Average standard deviation of split frequencies: 0.011520

      315500 -- (-1899.808) (-1899.731) (-1900.080) [-1900.416] * [-1899.612] (-1901.905) (-1902.036) (-1902.055) -- 0:00:43
      316000 -- (-1900.467) (-1898.992) (-1898.666) [-1898.951] * (-1900.097) (-1899.796) (-1901.802) [-1899.556] -- 0:00:43
      316500 -- (-1899.140) (-1901.597) (-1902.933) [-1902.097] * (-1902.743) (-1898.502) (-1900.239) [-1898.235] -- 0:00:43
      317000 -- (-1899.643) [-1904.340] (-1902.376) (-1899.678) * (-1900.469) (-1899.376) (-1901.668) [-1900.026] -- 0:00:43
      317500 -- (-1900.512) [-1900.336] (-1899.099) (-1900.652) * (-1898.891) [-1899.327] (-1899.530) (-1902.037) -- 0:00:42
      318000 -- (-1899.512) (-1901.133) (-1899.099) [-1899.568] * [-1898.498] (-1899.847) (-1899.885) (-1902.364) -- 0:00:42
      318500 -- (-1898.763) (-1899.463) (-1899.680) [-1904.235] * (-1898.427) (-1899.494) (-1899.529) [-1900.532] -- 0:00:42
      319000 -- (-1902.451) (-1899.165) (-1898.343) [-1901.363] * (-1898.875) [-1901.333] (-1898.816) (-1904.491) -- 0:00:42
      319500 -- [-1900.271] (-1899.908) (-1898.701) (-1902.432) * [-1899.017] (-1906.776) (-1898.886) (-1901.163) -- 0:00:42
      320000 -- (-1901.938) [-1903.237] (-1898.721) (-1902.589) * (-1900.487) (-1910.860) (-1899.430) [-1901.323] -- 0:00:42

      Average standard deviation of split frequencies: 0.010944

      320500 -- (-1900.415) (-1899.777) (-1899.668) [-1901.576] * (-1900.055) (-1903.109) [-1899.823] (-1899.719) -- 0:00:44
      321000 -- (-1900.268) [-1898.544] (-1899.504) (-1902.227) * (-1900.266) [-1898.615] (-1900.584) (-1900.373) -- 0:00:44
      321500 -- [-1900.369] (-1900.050) (-1900.410) (-1903.622) * (-1900.746) (-1902.962) (-1898.398) [-1899.508] -- 0:00:44
      322000 -- (-1900.686) (-1900.050) [-1901.263] (-1903.642) * [-1902.413] (-1900.082) (-1897.795) (-1899.078) -- 0:00:44
      322500 -- [-1899.084] (-1898.591) (-1898.813) (-1902.724) * (-1901.809) (-1899.641) (-1898.507) [-1898.812] -- 0:00:44
      323000 -- (-1899.084) (-1903.454) (-1900.194) [-1899.948] * (-1903.051) [-1901.694] (-1900.705) (-1898.712) -- 0:00:44
      323500 -- [-1899.122] (-1903.786) (-1901.892) (-1899.457) * (-1903.117) [-1901.798] (-1898.380) (-1899.927) -- 0:00:43
      324000 -- [-1899.704] (-1906.415) (-1901.119) (-1898.826) * (-1900.097) [-1901.462] (-1901.051) (-1901.149) -- 0:00:43
      324500 -- [-1901.757] (-1902.138) (-1899.656) (-1898.728) * [-1900.816] (-1898.008) (-1902.870) (-1899.774) -- 0:00:43
      325000 -- (-1899.942) [-1899.422] (-1903.259) (-1900.298) * (-1898.892) (-1898.688) [-1901.318] (-1900.925) -- 0:00:43

      Average standard deviation of split frequencies: 0.010845

      325500 -- (-1901.586) (-1898.410) (-1901.098) [-1898.943] * (-1901.138) (-1899.273) (-1900.087) [-1898.967] -- 0:00:43
      326000 -- (-1899.205) [-1898.955] (-1899.092) (-1899.980) * (-1898.705) (-1900.129) (-1900.226) [-1898.920] -- 0:00:43
      326500 -- (-1898.428) (-1899.750) [-1901.054] (-1899.157) * (-1898.789) (-1899.096) (-1900.007) [-1899.334] -- 0:00:43
      327000 -- (-1899.424) [-1900.159] (-1900.496) (-1898.832) * [-1901.123] (-1898.771) (-1899.312) (-1900.817) -- 0:00:43
      327500 -- [-1898.965] (-1906.384) (-1900.726) (-1900.985) * (-1903.888) (-1903.615) (-1899.924) [-1903.324] -- 0:00:43
      328000 -- (-1899.751) (-1902.204) (-1899.025) [-1898.774] * (-1899.971) [-1902.575] (-1900.216) (-1899.064) -- 0:00:43
      328500 -- (-1900.881) (-1901.480) [-1899.321] (-1899.465) * [-1899.771] (-1902.463) (-1899.927) (-1899.497) -- 0:00:42
      329000 -- (-1902.249) (-1900.013) [-1899.641] (-1901.974) * (-1900.280) (-1902.046) [-1899.981] (-1899.427) -- 0:00:42
      329500 -- (-1900.720) (-1900.956) [-1900.544] (-1898.336) * (-1900.842) (-1904.254) [-1901.053] (-1899.133) -- 0:00:42
      330000 -- (-1899.795) (-1902.800) (-1901.763) [-1900.484] * (-1900.440) (-1901.683) [-1898.906] (-1901.326) -- 0:00:42

      Average standard deviation of split frequencies: 0.011722

      330500 -- [-1897.950] (-1901.050) (-1903.777) (-1898.591) * [-1900.075] (-1899.704) (-1905.963) (-1899.585) -- 0:00:42
      331000 -- (-1899.885) (-1899.300) [-1900.544] (-1899.338) * (-1904.334) [-1899.859] (-1901.009) (-1899.755) -- 0:00:42
      331500 -- [-1901.035] (-1900.785) (-1905.273) (-1902.178) * (-1898.963) (-1899.612) (-1900.327) [-1900.745] -- 0:00:42
      332000 -- [-1900.168] (-1904.933) (-1900.204) (-1901.876) * (-1905.549) (-1900.364) (-1899.384) [-1898.646] -- 0:00:42
      332500 -- (-1899.216) [-1900.235] (-1900.769) (-1899.829) * (-1903.656) (-1903.894) (-1902.786) [-1899.311] -- 0:00:42
      333000 -- (-1900.915) (-1900.413) (-1898.790) [-1901.321] * [-1902.817] (-1904.404) (-1904.155) (-1899.992) -- 0:00:42
      333500 -- (-1901.221) (-1903.201) [-1899.166] (-1898.223) * (-1899.423) (-1899.490) [-1898.470] (-1901.746) -- 0:00:41
      334000 -- (-1899.311) (-1901.074) (-1899.014) [-1898.282] * (-1899.414) [-1900.183] (-1899.737) (-1902.036) -- 0:00:41
      334500 -- (-1899.073) (-1899.969) (-1898.958) [-1898.359] * (-1902.825) (-1900.183) [-1903.449] (-1901.379) -- 0:00:41
      335000 -- (-1899.820) (-1904.038) (-1904.404) [-1898.751] * [-1900.707] (-1899.205) (-1900.171) (-1902.114) -- 0:00:41

      Average standard deviation of split frequencies: 0.012315

      335500 -- [-1898.414] (-1898.448) (-1901.170) (-1899.317) * (-1898.906) (-1899.205) [-1899.155] (-1900.125) -- 0:00:41
      336000 -- (-1899.552) [-1904.339] (-1900.909) (-1900.622) * [-1901.015] (-1903.764) (-1898.709) (-1904.153) -- 0:00:43
      336500 -- (-1898.421) (-1902.967) (-1902.848) [-1903.683] * (-1899.476) [-1901.822] (-1899.727) (-1899.005) -- 0:00:43
      337000 -- (-1899.008) (-1901.279) [-1898.788] (-1902.755) * (-1903.094) (-1903.436) (-1900.636) [-1898.742] -- 0:00:43
      337500 -- (-1900.594) (-1903.352) (-1899.010) [-1901.050] * (-1899.909) (-1900.097) [-1899.422] (-1898.724) -- 0:00:43
      338000 -- (-1899.079) [-1901.013] (-1901.692) (-1902.518) * (-1901.353) (-1900.373) [-1899.725] (-1897.947) -- 0:00:43
      338500 -- [-1900.179] (-1900.985) (-1899.896) (-1904.240) * [-1899.744] (-1903.565) (-1899.689) (-1898.142) -- 0:00:42
      339000 -- (-1899.045) (-1903.110) [-1899.750] (-1901.848) * (-1901.869) (-1899.282) (-1900.117) [-1898.158] -- 0:00:42
      339500 -- (-1899.306) (-1902.976) (-1900.025) [-1901.419] * (-1898.797) (-1901.344) [-1898.323] (-1898.070) -- 0:00:42
      340000 -- (-1899.709) (-1898.666) (-1899.666) [-1900.940] * (-1899.074) (-1900.447) [-1897.946] (-1899.764) -- 0:00:42

      Average standard deviation of split frequencies: 0.011993

      340500 -- (-1901.859) (-1900.058) [-1897.801] (-1900.924) * (-1898.442) [-1900.672] (-1898.479) (-1899.764) -- 0:00:42
      341000 -- (-1899.719) (-1901.659) [-1901.406] (-1898.982) * (-1899.495) (-1899.667) (-1898.310) [-1898.313] -- 0:00:42
      341500 -- (-1901.482) (-1900.023) (-1906.689) [-1901.022] * (-1903.784) (-1899.824) [-1898.991] (-1898.749) -- 0:00:42
      342000 -- (-1899.042) [-1901.717] (-1899.720) (-1899.648) * (-1904.719) (-1899.370) (-1898.349) [-1898.676] -- 0:00:42
      342500 -- (-1899.073) (-1906.298) [-1899.135] (-1899.422) * (-1899.331) (-1901.495) [-1898.618] (-1898.784) -- 0:00:42
      343000 -- (-1898.526) (-1900.741) (-1907.433) [-1899.044] * (-1898.849) (-1900.874) (-1900.898) [-1899.213] -- 0:00:42
      343500 -- (-1903.025) (-1900.169) (-1902.211) [-1900.295] * (-1898.626) (-1900.626) [-1898.571] (-1899.657) -- 0:00:42
      344000 -- (-1903.841) (-1899.706) (-1901.061) [-1898.757] * (-1901.713) (-1899.159) (-1902.018) [-1900.470] -- 0:00:41
      344500 -- (-1903.102) [-1899.999] (-1901.538) (-1899.944) * (-1904.627) (-1901.474) [-1905.070] (-1905.217) -- 0:00:41
      345000 -- (-1900.599) [-1899.714] (-1901.661) (-1898.444) * (-1909.972) (-1899.474) (-1900.582) [-1902.108] -- 0:00:41

      Average standard deviation of split frequencies: 0.012489

      345500 -- (-1900.571) [-1901.048] (-1901.602) (-1898.653) * (-1901.847) (-1900.398) [-1901.105] (-1899.751) -- 0:00:41
      346000 -- (-1902.962) (-1899.457) [-1899.861] (-1900.529) * (-1898.863) [-1900.386] (-1901.631) (-1901.579) -- 0:00:41
      346500 -- [-1905.395] (-1898.594) (-1899.683) (-1899.333) * (-1898.960) (-1900.425) (-1900.691) [-1899.461] -- 0:00:41
      347000 -- (-1900.613) (-1901.413) [-1898.154] (-1898.465) * (-1900.326) (-1901.401) [-1900.104] (-1901.545) -- 0:00:41
      347500 -- [-1899.157] (-1902.571) (-1898.286) (-1899.675) * [-1901.553] (-1899.318) (-1902.176) (-1903.701) -- 0:00:41
      348000 -- (-1899.366) (-1899.315) (-1903.420) [-1898.690] * (-1902.021) (-1899.141) [-1901.493] (-1899.135) -- 0:00:41
      348500 -- (-1900.692) [-1902.780] (-1901.457) (-1898.494) * (-1898.273) (-1899.551) [-1901.185] (-1899.515) -- 0:00:41
      349000 -- (-1904.138) [-1898.553] (-1903.208) (-1898.298) * [-1899.363] (-1898.041) (-1905.785) (-1899.351) -- 0:00:41
      349500 -- [-1906.838] (-1899.690) (-1901.184) (-1900.559) * (-1900.011) (-1897.855) [-1901.935] (-1899.798) -- 0:00:40
      350000 -- (-1901.783) (-1902.123) (-1899.316) [-1899.301] * (-1898.581) (-1898.361) [-1903.118] (-1899.539) -- 0:00:40

      Average standard deviation of split frequencies: 0.012398

      350500 -- (-1904.996) (-1901.771) [-1899.257] (-1899.109) * (-1899.086) [-1900.026] (-1899.273) (-1899.114) -- 0:00:40
      351000 -- (-1899.328) [-1899.725] (-1900.660) (-1900.493) * (-1898.600) [-1899.917] (-1899.484) (-1898.603) -- 0:00:42
      351500 -- (-1899.572) (-1899.648) [-1901.095] (-1900.135) * (-1898.723) (-1899.634) (-1901.535) [-1901.245] -- 0:00:42
      352000 -- (-1899.426) (-1899.334) [-1900.718] (-1900.650) * [-1899.046] (-1900.444) (-1899.315) (-1902.170) -- 0:00:42
      352500 -- (-1902.482) [-1898.755] (-1900.339) (-1902.710) * (-1906.990) [-1903.553] (-1899.367) (-1900.558) -- 0:00:42
      353000 -- (-1899.437) [-1898.402] (-1900.053) (-1901.030) * (-1906.964) [-1899.089] (-1898.893) (-1900.075) -- 0:00:42
      353500 -- (-1899.179) [-1898.114] (-1901.421) (-1904.087) * [-1901.565] (-1898.876) (-1901.539) (-1900.187) -- 0:00:42
      354000 -- (-1899.209) (-1898.147) [-1900.249] (-1901.744) * (-1900.560) (-1899.037) [-1899.945] (-1900.321) -- 0:00:41
      354500 -- [-1899.181] (-1898.252) (-1906.899) (-1903.699) * [-1898.559] (-1899.843) (-1900.636) (-1901.139) -- 0:00:41
      355000 -- (-1900.516) [-1899.262] (-1901.217) (-1899.947) * [-1899.024] (-1900.139) (-1902.770) (-1900.512) -- 0:00:41

      Average standard deviation of split frequencies: 0.012580

      355500 -- (-1899.674) (-1897.919) [-1900.125] (-1902.783) * [-1898.729] (-1899.972) (-1899.438) (-1902.476) -- 0:00:41
      356000 -- (-1901.778) (-1898.013) [-1899.803] (-1900.575) * (-1898.901) [-1899.721] (-1904.725) (-1901.477) -- 0:00:41
      356500 -- (-1901.272) (-1900.065) (-1900.146) [-1900.617] * (-1899.967) [-1899.738] (-1904.697) (-1899.656) -- 0:00:41
      357000 -- (-1899.620) [-1900.491] (-1901.255) (-1899.310) * [-1899.155] (-1898.411) (-1901.258) (-1899.288) -- 0:00:41
      357500 -- (-1902.105) [-1898.722] (-1898.157) (-1901.993) * [-1898.957] (-1898.411) (-1899.623) (-1898.764) -- 0:00:41
      358000 -- (-1901.597) (-1898.916) [-1899.268] (-1899.506) * [-1902.547] (-1901.429) (-1899.416) (-1898.764) -- 0:00:41
      358500 -- (-1899.113) (-1903.915) (-1899.460) [-1899.424] * (-1901.106) (-1901.072) (-1899.919) [-1899.195] -- 0:00:41
      359000 -- (-1903.735) (-1900.432) (-1898.558) [-1899.296] * (-1898.879) (-1900.036) (-1899.725) [-1901.054] -- 0:00:41
      359500 -- (-1900.573) [-1901.361] (-1900.223) (-1899.404) * (-1899.249) (-1900.975) [-1902.538] (-1902.440) -- 0:00:40
      360000 -- (-1900.880) (-1899.914) [-1901.004] (-1898.322) * (-1900.051) (-1900.466) [-1901.192] (-1900.853) -- 0:00:40

      Average standard deviation of split frequencies: 0.011488

      360500 -- (-1900.765) [-1899.108] (-1900.924) (-1898.327) * (-1900.740) (-1903.771) [-1901.652] (-1899.271) -- 0:00:40
      361000 -- (-1900.759) (-1899.720) (-1901.113) [-1898.563] * (-1903.874) (-1902.265) (-1899.844) [-1900.518] -- 0:00:40
      361500 -- [-1902.664] (-1899.027) (-1900.992) (-1898.810) * (-1902.263) (-1901.875) (-1901.387) [-1900.924] -- 0:00:40
      362000 -- (-1900.937) (-1900.317) [-1900.270] (-1898.660) * [-1901.332] (-1902.938) (-1900.357) (-1898.307) -- 0:00:40
      362500 -- (-1901.582) [-1901.121] (-1900.218) (-1899.309) * (-1900.892) (-1902.465) (-1903.982) [-1899.230] -- 0:00:40
      363000 -- (-1898.254) (-1903.912) [-1901.350] (-1899.197) * (-1900.198) [-1898.938] (-1904.639) (-1901.800) -- 0:00:40
      363500 -- (-1901.127) [-1903.822] (-1901.175) (-1900.264) * [-1899.479] (-1901.769) (-1902.869) (-1901.627) -- 0:00:40
      364000 -- (-1899.850) (-1905.279) [-1901.283] (-1899.990) * [-1899.366] (-1899.021) (-1903.091) (-1898.446) -- 0:00:40
      364500 -- [-1899.362] (-1904.379) (-1902.896) (-1900.901) * (-1900.482) [-1898.430] (-1903.684) (-1899.486) -- 0:00:40
      365000 -- [-1899.325] (-1903.475) (-1899.724) (-1900.487) * (-1899.175) [-1897.852] (-1901.692) (-1902.941) -- 0:00:40

      Average standard deviation of split frequencies: 0.012066

      365500 -- [-1899.605] (-1898.894) (-1900.679) (-1900.960) * (-1900.677) (-1900.581) (-1901.395) [-1908.835] -- 0:00:39
      366000 -- (-1901.215) (-1899.891) [-1900.915] (-1901.052) * (-1899.379) [-1905.589] (-1899.039) (-1901.177) -- 0:00:39
      366500 -- (-1900.462) [-1899.528] (-1898.733) (-1900.363) * (-1899.519) (-1906.604) [-1899.705] (-1899.166) -- 0:00:41
      367000 -- [-1901.900] (-1899.392) (-1898.518) (-1900.893) * (-1899.883) (-1905.440) [-1900.308] (-1902.367) -- 0:00:41
      367500 -- (-1900.732) (-1898.897) (-1899.659) [-1901.326] * (-1899.981) (-1905.456) [-1900.236] (-1904.030) -- 0:00:41
      368000 -- [-1901.794] (-1897.958) (-1903.852) (-1901.062) * (-1899.570) [-1901.265] (-1898.780) (-1902.430) -- 0:00:41
      368500 -- (-1898.656) (-1901.254) [-1904.466] (-1899.429) * [-1901.611] (-1901.721) (-1900.244) (-1901.997) -- 0:00:41
      369000 -- [-1899.142] (-1900.332) (-1898.746) (-1900.131) * (-1899.156) (-1901.228) (-1901.924) [-1900.638] -- 0:00:41
      369500 -- [-1898.687] (-1901.159) (-1899.988) (-1903.435) * [-1900.384] (-1901.979) (-1906.621) (-1905.158) -- 0:00:40
      370000 -- [-1901.440] (-1900.158) (-1899.985) (-1901.161) * (-1899.180) (-1904.013) [-1901.922] (-1900.205) -- 0:00:40

      Average standard deviation of split frequencies: 0.012115

      370500 -- [-1901.351] (-1900.101) (-1899.833) (-1900.371) * (-1898.816) (-1901.540) [-1900.875] (-1904.986) -- 0:00:40
      371000 -- (-1902.787) [-1899.914] (-1901.816) (-1899.484) * (-1899.639) (-1905.602) (-1899.618) [-1900.680] -- 0:00:40
      371500 -- (-1903.556) (-1899.914) [-1901.329] (-1904.242) * (-1902.092) (-1901.921) (-1899.604) [-1900.738] -- 0:00:40
      372000 -- (-1902.109) (-1899.398) (-1900.084) [-1901.309] * (-1903.477) (-1900.406) [-1899.886] (-1899.702) -- 0:00:40
      372500 -- [-1901.901] (-1901.861) (-1899.526) (-1900.851) * (-1903.728) (-1902.061) (-1899.489) [-1899.677] -- 0:00:40
      373000 -- (-1901.161) (-1899.701) [-1898.987] (-1900.154) * (-1906.075) (-1903.466) (-1900.542) [-1900.355] -- 0:00:40
      373500 -- (-1901.150) (-1900.042) [-1899.919] (-1898.635) * (-1903.034) (-1900.447) [-1901.484] (-1901.155) -- 0:00:40
      374000 -- (-1901.262) (-1899.924) [-1899.315] (-1900.099) * (-1902.050) [-1902.160] (-1899.563) (-1898.623) -- 0:00:40
      374500 -- (-1900.251) (-1899.644) (-1899.057) [-1899.374] * (-1899.433) (-1901.950) (-1900.282) [-1898.220] -- 0:00:40
      375000 -- (-1898.737) (-1902.885) (-1899.911) [-1901.252] * [-1900.101] (-1899.608) (-1899.039) (-1900.506) -- 0:00:40

      Average standard deviation of split frequencies: 0.011877

      375500 -- (-1901.330) [-1899.751] (-1898.037) (-1902.464) * [-1904.744] (-1900.460) (-1898.839) (-1900.526) -- 0:00:39
      376000 -- (-1900.730) (-1900.279) [-1899.018] (-1902.963) * [-1903.325] (-1899.993) (-1902.197) (-1899.690) -- 0:00:39
      376500 -- (-1898.290) (-1899.829) [-1899.938] (-1898.615) * [-1902.923] (-1899.993) (-1906.453) (-1899.918) -- 0:00:39
      377000 -- (-1898.221) (-1899.085) [-1899.665] (-1898.494) * [-1900.534] (-1900.954) (-1904.477) (-1898.008) -- 0:00:39
      377500 -- (-1900.382) [-1900.571] (-1899.132) (-1899.925) * (-1902.222) (-1901.090) (-1905.702) [-1898.181] -- 0:00:39
      378000 -- (-1901.547) (-1902.885) (-1900.609) [-1900.631] * [-1903.267] (-1899.605) (-1901.503) (-1898.468) -- 0:00:39
      378500 -- (-1898.418) (-1903.581) (-1901.938) [-1898.549] * (-1900.947) (-1899.503) (-1898.875) [-1902.490] -- 0:00:39
      379000 -- (-1898.780) (-1900.183) [-1900.567] (-1899.614) * [-1900.301] (-1900.883) (-1899.576) (-1900.381) -- 0:00:39
      379500 -- (-1902.190) (-1899.642) (-1900.628) [-1899.882] * (-1902.752) [-1904.163] (-1900.022) (-1899.625) -- 0:00:39
      380000 -- (-1902.951) (-1899.625) [-1899.844] (-1898.196) * (-1900.035) [-1899.144] (-1900.634) (-1899.545) -- 0:00:39

      Average standard deviation of split frequencies: 0.012590

      380500 -- (-1901.841) (-1901.834) (-1900.031) [-1899.177] * (-1902.146) [-1899.400] (-1902.574) (-1898.654) -- 0:00:39
      381000 -- (-1902.896) (-1901.327) [-1898.938] (-1898.413) * (-1901.350) [-1898.561] (-1899.654) (-1899.143) -- 0:00:38
      381500 -- (-1899.161) (-1903.793) (-1899.951) [-1898.984] * (-1901.811) [-1899.645] (-1899.193) (-1903.020) -- 0:00:38
      382000 -- (-1899.952) (-1901.749) [-1898.367] (-1903.795) * [-1898.630] (-1900.195) (-1898.738) (-1901.431) -- 0:00:40
      382500 -- (-1899.394) (-1902.085) [-1898.671] (-1901.074) * (-1899.664) (-1900.268) (-1902.359) [-1899.061] -- 0:00:40
      383000 -- (-1899.177) (-1903.542) [-1898.531] (-1898.982) * (-1901.432) [-1899.814] (-1901.443) (-1899.061) -- 0:00:40
      383500 -- (-1900.402) (-1901.812) (-1899.542) [-1899.727] * (-1900.571) (-1900.020) [-1905.518] (-1898.591) -- 0:00:40
      384000 -- (-1900.483) (-1899.632) [-1898.775] (-1902.026) * [-1899.299] (-1899.863) (-1901.864) (-1899.120) -- 0:00:40
      384500 -- [-1901.435] (-1903.014) (-1899.991) (-1901.340) * (-1899.342) (-1898.998) [-1902.342] (-1898.531) -- 0:00:40
      385000 -- [-1898.997] (-1900.530) (-1900.867) (-1902.606) * (-1901.143) (-1898.330) [-1898.527] (-1899.813) -- 0:00:39

      Average standard deviation of split frequencies: 0.011941

      385500 -- (-1900.575) [-1899.406] (-1900.287) (-1899.393) * (-1905.368) (-1898.516) [-1898.964] (-1899.869) -- 0:00:39
      386000 -- (-1900.113) [-1901.609] (-1900.169) (-1898.348) * (-1901.662) [-1899.270] (-1903.463) (-1899.695) -- 0:00:39
      386500 -- (-1901.507) (-1900.964) (-1900.691) [-1899.538] * (-1901.039) (-1899.320) [-1899.040] (-1901.271) -- 0:00:39
      387000 -- (-1900.710) (-1901.643) (-1899.316) [-1901.743] * (-1901.095) (-1898.412) (-1898.885) [-1900.936] -- 0:00:39
      387500 -- [-1899.715] (-1904.436) (-1899.337) (-1901.896) * [-1902.923] (-1898.436) (-1898.765) (-1899.386) -- 0:00:39
      388000 -- (-1899.991) (-1903.309) (-1900.116) [-1899.425] * [-1901.297] (-1899.076) (-1898.920) (-1900.049) -- 0:00:39
      388500 -- (-1900.551) [-1903.726] (-1902.732) (-1900.528) * (-1898.312) (-1898.863) [-1898.958] (-1899.814) -- 0:00:39
      389000 -- (-1900.811) (-1903.399) (-1900.092) [-1899.025] * [-1900.133] (-1898.863) (-1898.670) (-1903.205) -- 0:00:39
      389500 -- [-1899.407] (-1901.408) (-1900.464) (-1899.591) * [-1898.606] (-1899.624) (-1900.046) (-1898.171) -- 0:00:39
      390000 -- (-1899.437) [-1898.863] (-1899.994) (-1899.010) * [-1898.606] (-1898.373) (-1901.308) (-1900.234) -- 0:00:39

      Average standard deviation of split frequencies: 0.011396

      390500 -- (-1902.348) (-1898.671) [-1899.234] (-1901.239) * (-1899.074) [-1898.074] (-1901.366) (-1898.888) -- 0:00:39
      391000 -- (-1909.981) [-1899.565] (-1900.426) (-1900.098) * (-1901.915) (-1898.096) [-1899.095] (-1902.062) -- 0:00:38
      391500 -- (-1907.468) [-1899.496] (-1902.269) (-1899.881) * [-1898.437] (-1898.624) (-1898.242) (-1901.363) -- 0:00:38
      392000 -- (-1907.420) (-1899.538) [-1900.631] (-1899.506) * (-1898.639) [-1898.624] (-1900.755) (-1898.583) -- 0:00:38
      392500 -- (-1911.012) (-1900.049) [-1900.566] (-1898.654) * (-1898.524) (-1898.700) [-1898.460] (-1905.011) -- 0:00:38
      393000 -- (-1904.379) [-1901.333] (-1903.286) (-1898.768) * [-1899.450] (-1899.454) (-1898.673) (-1901.414) -- 0:00:38
      393500 -- (-1901.602) (-1901.597) (-1901.327) [-1900.665] * [-1900.674] (-1898.698) (-1899.130) (-1898.557) -- 0:00:38
      394000 -- [-189