--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:02:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1601/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -498.34          -503.24
2       -498.32          -501.93
--------------------------------------
TOTAL     -498.33          -502.78
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888159    0.091511    0.360387    1.507989    0.846695   1250.57   1375.78    1.000
r(A<->C){all}   0.158117    0.019518    0.000036    0.430564    0.119452    159.46    181.65    1.000
r(A<->G){all}   0.160248    0.018713    0.000084    0.434343    0.124168    178.59    289.32    1.001
r(A<->T){all}   0.167585    0.019467    0.000106    0.438838    0.131672    207.47    226.47    1.001
r(C<->G){all}   0.171949    0.020159    0.000015    0.469343    0.133989    353.35    354.18    1.000
r(C<->T){all}   0.178545    0.021979    0.000511    0.474935    0.138798    135.05    138.28    1.008
r(G<->T){all}   0.163556    0.019291    0.000054    0.443488    0.125110    188.51    212.18    1.009
pi(A){all}      0.174719    0.000373    0.137815    0.214599    0.174025   1282.00   1290.20    1.001
pi(C){all}      0.297434    0.000557    0.251474    0.345225    0.298029   1255.92   1316.84    1.000
pi(G){all}      0.268970    0.000540    0.224531    0.315153    0.268440   1303.54   1380.83    1.000
pi(T){all}      0.258877    0.000527    0.216353    0.306348    0.258117   1325.35   1340.74    1.000
alpha{1,2}      0.400447    0.225700    0.000204    1.349713    0.230246   1292.43   1381.88    1.001
alpha{3}        0.455155    0.232612    0.000259    1.418819    0.299917   1129.68   1156.68    1.000
pinvar{all}     0.995459    0.000032    0.985288    0.999992    0.997331   1250.63   1265.94    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-482.661467
Model 2: PositiveSelection	-482.661466
Model 0: one-ratio	-482.661465
Model 7: beta	-482.661467
Model 8: beta&w>1	-482.661467


Model 0 vs 1	3.999999989900971E-6

Model 2 vs 1	1.9999999949504854E-6

Model 8 vs 7	0.0
>C1
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C2
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C3
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C4
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C5
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C6
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=121 

C1              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C2              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C3              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C4              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C5              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C6              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
                **************************************************

C1              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C2              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C3              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C4              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C5              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C6              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
                **************************************************

C1              RDDDLVTSVPPCGRASVVHRS
C2              RDDDLVTSVPPCGRASVVHRS
C3              RDDDLVTSVPPCGRASVVHRS
C4              RDDDLVTSVPPCGRASVVHRS
C5              RDDDLVTSVPPCGRASVVHRS
C6              RDDDLVTSVPPCGRASVVHRS
                *********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  121 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  121 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3630]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3630]--->[3630]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.459 Mb, Max= 30.649 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C2              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C3              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C4              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C5              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C6              VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
                **************************************************

C1              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C2              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C3              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C4              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C5              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C6              PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
                **************************************************

C1              RDDDLVTSVPPCGRASVVHRS
C2              RDDDLVTSVPPCGRASVVHRS
C3              RDDDLVTSVPPCGRASVVHRS
C4              RDDDLVTSVPPCGRASVVHRS
C5              RDDDLVTSVPPCGRASVVHRS
C6              RDDDLVTSVPPCGRASVVHRS
                *********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C2              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C3              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C4              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C5              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C6              GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
                **************************************************

C1              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C2              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C3              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C4              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C5              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C6              GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
                **************************************************

C1              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C2              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C3              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C4              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C5              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C6              TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
                **************************************************

C1              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C2              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C3              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C4              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C5              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C6              CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
                **************************************************

C1              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C2              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C3              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C4              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C5              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C6              GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
                **************************************************

C1              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C2              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C3              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C4              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C5              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C6              TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
                **************************************************

C1              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C2              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C3              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C4              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C5              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C6              CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
                **************************************************

C1              GGTCCACCGGTCC
C2              GGTCCACCGGTCC
C3              GGTCCACCGGTCC
C4              GGTCCACCGGTCC
C5              GGTCCACCGGTCC
C6              GGTCCACCGGTCC
                *************



>C1
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C2
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C3
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C4
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C5
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C6
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C1
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C2
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C3
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C4
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C5
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C6
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 363 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856451
      Setting output file names to "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 948280401
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5166904393
      Seed = 358619291
      Swapseed = 1579856451
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -812.411402 -- -24.965149
         Chain 2 -- -812.411402 -- -24.965149
         Chain 3 -- -812.411278 -- -24.965149
         Chain 4 -- -812.411402 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -812.411402 -- -24.965149
         Chain 2 -- -812.411402 -- -24.965149
         Chain 3 -- -812.411402 -- -24.965149
         Chain 4 -- -812.411402 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-812.411] (-812.411) (-812.411) (-812.411) * [-812.411] (-812.411) (-812.411) (-812.411) 
        500 -- (-507.305) (-513.283) (-509.452) [-512.544] * (-510.330) [-504.084] (-509.514) (-510.148) -- 0:00:00
       1000 -- (-510.039) (-511.688) [-509.521] (-510.225) * [-504.933] (-513.099) (-509.806) (-506.831) -- 0:00:00
       1500 -- (-510.024) (-510.056) (-506.373) [-501.483] * (-507.786) (-505.717) [-504.248] (-510.105) -- 0:00:00
       2000 -- (-508.596) (-506.765) (-510.745) [-508.045] * (-513.403) (-508.930) (-513.802) [-505.195] -- 0:00:00
       2500 -- (-505.878) [-507.457] (-507.900) (-504.310) * (-513.554) (-505.642) (-510.787) [-509.414] -- 0:00:00
       3000 -- (-526.161) (-509.595) (-508.883) [-504.972] * (-510.440) (-505.327) (-511.009) [-505.405] -- 0:00:00
       3500 -- (-509.570) (-504.601) [-503.834] (-506.709) * (-507.895) (-516.809) [-503.285] (-507.415) -- 0:00:00
       4000 -- (-506.790) (-509.206) [-501.062] (-518.792) * (-511.708) (-507.994) (-507.147) [-503.005] -- 0:00:00
       4500 -- (-513.494) (-515.041) [-506.077] (-509.121) * (-510.328) (-513.547) (-503.796) [-505.608] -- 0:00:00
       5000 -- (-512.415) [-505.591] (-509.786) (-508.452) * (-505.128) (-508.567) [-504.870] (-519.892) -- 0:00:00

      Average standard deviation of split frequencies: 0.102479

       5500 -- [-515.560] (-508.395) (-509.441) (-504.693) * (-508.571) [-509.762] (-505.046) (-507.831) -- 0:00:00
       6000 -- (-510.128) (-505.214) (-504.788) [-503.610] * (-499.223) (-521.229) [-503.572] (-509.370) -- 0:00:00
       6500 -- [-504.885] (-518.201) (-515.776) (-503.507) * (-504.729) (-508.282) [-506.431] (-509.562) -- 0:00:00
       7000 -- [-515.025] (-506.210) (-506.538) (-510.148) * (-518.853) [-505.500] (-507.004) (-509.199) -- 0:00:00
       7500 -- (-521.954) (-508.918) [-506.498] (-515.117) * (-507.414) (-510.592) (-505.234) [-503.859] -- 0:00:00
       8000 -- (-513.113) (-505.028) [-502.838] (-509.154) * (-517.624) [-506.123] (-510.830) (-513.393) -- 0:00:00
       8500 -- (-516.965) (-515.638) (-514.320) [-506.371] * (-512.750) (-510.838) [-502.864] (-508.710) -- 0:00:00
       9000 -- (-508.323) (-507.505) (-509.159) [-504.939] * [-520.247] (-517.135) (-502.576) (-511.250) -- 0:00:00
       9500 -- [-507.820] (-505.662) (-509.524) (-511.059) * (-505.785) (-511.512) (-509.566) [-505.579] -- 0:00:00
      10000 -- (-512.481) (-504.580) (-515.262) [-505.008] * (-509.389) [-505.784] (-520.786) (-509.067) -- 0:00:00

      Average standard deviation of split frequencies: 0.072318

      10500 -- (-506.731) [-505.114] (-511.870) (-519.094) * (-508.787) (-509.414) (-506.875) [-502.359] -- 0:00:00
      11000 -- (-503.534) [-501.730] (-511.183) (-504.614) * (-514.933) (-510.102) [-507.740] (-505.039) -- 0:01:29
      11500 -- (-505.555) (-511.973) [-503.966] (-501.319) * (-507.325) (-506.075) (-506.857) [-507.290] -- 0:01:25
      12000 -- (-506.324) (-512.619) [-508.130] (-500.703) * (-507.154) (-505.982) [-510.769] (-511.115) -- 0:01:22
      12500 -- (-505.105) (-507.578) (-504.812) [-499.081] * (-507.950) (-515.601) (-509.256) [-502.003] -- 0:01:19
      13000 -- (-509.034) (-511.219) (-509.495) [-498.809] * (-506.487) [-503.459] (-509.074) (-510.255) -- 0:01:15
      13500 -- (-506.144) (-509.519) [-503.476] (-499.355) * (-514.232) (-505.307) [-502.815] (-511.229) -- 0:01:13
      14000 -- [-506.027] (-512.578) (-505.921) (-498.420) * [-510.707] (-502.013) (-513.383) (-510.969) -- 0:01:10
      14500 -- (-509.546) (-511.182) [-509.396] (-498.888) * [-508.614] (-516.889) (-504.023) (-508.737) -- 0:01:07
      15000 -- (-511.898) [-512.308] (-505.791) (-500.275) * (-510.361) (-511.453) [-505.442] (-507.726) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-509.415) [-505.053] (-508.079) (-501.162) * (-506.477) [-503.447] (-510.470) (-512.720) -- 0:01:03
      16000 -- (-514.398) [-505.471] (-505.938) (-497.663) * [-504.170] (-503.103) (-512.806) (-520.660) -- 0:01:01
      16500 -- (-512.664) [-510.202] (-513.851) (-497.661) * (-516.835) [-506.568] (-509.326) (-505.388) -- 0:00:59
      17000 -- [-508.860] (-510.261) (-514.981) (-497.724) * (-506.870) (-508.939) (-510.415) [-498.373] -- 0:00:57
      17500 -- (-506.781) (-511.795) [-510.690] (-499.743) * (-505.050) (-504.623) (-504.419) [-498.256] -- 0:00:56
      18000 -- (-511.010) [-509.400] (-505.044) (-498.367) * (-513.305) [-503.138] (-510.620) (-500.837) -- 0:00:54
      18500 -- (-512.146) (-514.202) [-507.442] (-498.119) * (-507.953) [-508.750] (-509.714) (-500.025) -- 0:00:53
      19000 -- (-509.612) (-508.210) [-507.593] (-497.950) * [-510.462] (-507.672) (-511.304) (-499.504) -- 0:00:51
      19500 -- [-506.278] (-507.217) (-505.937) (-498.103) * (-504.429) (-509.566) (-507.023) [-500.648] -- 0:00:50
      20000 -- (-511.263) (-506.653) [-504.229] (-499.001) * (-506.759) (-512.283) (-507.045) [-502.402] -- 0:00:49

      Average standard deviation of split frequencies: 0.050689

      20500 -- [-504.764] (-501.439) (-510.324) (-497.703) * [-510.727] (-509.410) (-510.635) (-500.960) -- 0:00:47
      21000 -- (-513.551) (-501.383) [-505.948] (-500.077) * [-503.144] (-509.066) (-507.409) (-499.526) -- 0:00:46
      21500 -- (-507.069) (-504.661) (-505.971) [-498.051] * (-506.197) (-506.429) (-510.942) [-498.525] -- 0:00:45
      22000 -- (-506.374) (-514.028) (-510.205) [-498.187] * (-507.393) (-504.344) (-504.785) [-497.787] -- 0:00:44
      22500 -- (-507.626) (-507.159) [-508.687] (-498.600) * [-510.495] (-518.001) (-508.936) (-498.572) -- 0:00:43
      23000 -- (-514.491) (-504.802) [-500.370] (-500.327) * [-507.190] (-505.664) (-512.962) (-499.033) -- 0:00:42
      23500 -- (-510.762) (-511.466) (-511.135) [-501.425] * (-507.195) (-505.477) (-515.386) [-499.989] -- 0:00:41
      24000 -- [-501.802] (-516.342) (-511.930) (-497.779) * (-507.013) (-505.804) (-512.896) [-497.603] -- 0:00:40
      24500 -- (-510.852) [-508.539] (-517.304) (-497.202) * (-510.252) [-507.639] (-513.876) (-501.809) -- 0:00:39
      25000 -- [-505.223] (-519.613) (-514.987) (-497.356) * [-511.279] (-507.857) (-501.034) (-498.391) -- 0:00:39

      Average standard deviation of split frequencies: 0.044032

      25500 -- (-503.020) (-512.628) [-509.140] (-498.667) * [-502.102] (-510.093) (-498.561) (-497.611) -- 0:00:38
      26000 -- [-505.994] (-515.111) (-509.637) (-498.749) * (-512.364) (-509.510) [-500.649] (-498.856) -- 0:00:37
      26500 -- (-508.117) (-510.037) (-504.706) [-497.770] * (-505.818) [-507.449] (-500.765) (-500.609) -- 0:00:36
      27000 -- (-510.331) [-508.167] (-519.338) (-501.054) * (-507.358) [-503.019] (-498.996) (-500.053) -- 0:00:36
      27500 -- (-506.353) (-524.850) [-507.490] (-500.503) * (-517.480) (-502.568) (-501.467) [-501.557] -- 0:01:10
      28000 -- [-504.048] (-516.855) (-516.094) (-499.552) * (-509.773) [-509.332] (-502.235) (-498.420) -- 0:01:09
      28500 -- (-507.390) (-498.468) (-511.888) [-503.979] * [-505.442] (-508.137) (-500.337) (-498.505) -- 0:01:08
      29000 -- (-507.782) [-496.953] (-503.718) (-497.314) * (-508.347) [-503.271] (-505.378) (-500.555) -- 0:01:06
      29500 -- (-503.217) [-497.388] (-509.630) (-498.219) * (-507.630) [-510.629] (-500.795) (-499.052) -- 0:01:05
      30000 -- (-507.317) (-497.485) [-503.855] (-498.370) * (-508.855) (-512.877) [-497.204] (-498.471) -- 0:01:04

      Average standard deviation of split frequencies: 0.034085

      30500 -- (-508.630) (-497.321) (-520.048) [-502.651] * (-504.637) (-516.795) [-499.232] (-497.510) -- 0:01:03
      31000 -- [-508.166] (-498.840) (-506.913) (-497.585) * (-506.063) (-504.598) (-497.906) [-503.106] -- 0:01:02
      31500 -- (-510.494) (-502.504) [-505.811] (-499.309) * (-510.879) (-507.537) [-501.178] (-502.391) -- 0:01:01
      32000 -- (-510.654) (-498.588) [-503.047] (-500.710) * (-508.105) [-503.547] (-500.859) (-498.512) -- 0:01:00
      32500 -- (-506.167) [-501.871] (-506.641) (-499.753) * (-513.665) (-505.503) [-498.556] (-500.233) -- 0:00:59
      33000 -- (-508.159) (-499.459) [-506.560] (-499.803) * (-523.447) (-504.543) [-497.130] (-504.578) -- 0:00:58
      33500 -- (-505.817) (-497.601) [-507.514] (-503.611) * (-509.096) (-504.162) (-501.533) [-502.443] -- 0:00:57
      34000 -- [-507.636] (-499.319) (-508.992) (-497.678) * [-506.729] (-505.961) (-498.930) (-501.664) -- 0:00:56
      34500 -- (-504.704) [-498.192] (-507.209) (-499.574) * (-506.675) (-507.577) (-498.467) [-497.937] -- 0:00:55
      35000 -- [-507.490] (-502.881) (-519.995) (-497.937) * (-509.706) (-514.056) [-499.561] (-500.148) -- 0:00:55

      Average standard deviation of split frequencies: 0.029307

      35500 -- (-509.312) (-501.421) (-516.310) [-499.685] * (-512.285) (-514.419) [-499.219] (-498.216) -- 0:00:54
      36000 -- [-504.550] (-500.804) (-501.079) (-503.968) * (-513.313) [-506.787] (-499.279) (-502.673) -- 0:00:53
      36500 -- (-507.726) (-500.253) [-500.063] (-499.135) * (-510.293) (-511.434) (-501.571) [-499.027] -- 0:00:52
      37000 -- (-518.288) (-497.444) [-498.308] (-497.134) * (-507.774) (-509.099) [-499.145] (-497.005) -- 0:00:52
      37500 -- (-513.288) [-497.252] (-498.683) (-497.723) * (-501.167) [-505.964] (-500.035) (-499.221) -- 0:00:51
      38000 -- (-506.516) [-499.187] (-498.611) (-498.957) * (-499.710) (-511.258) (-498.767) [-505.025] -- 0:00:50
      38500 -- (-508.313) (-500.098) (-501.044) [-497.546] * (-501.365) (-512.189) (-499.189) [-500.413] -- 0:00:49
      39000 -- (-515.755) [-501.245] (-497.552) (-497.346) * (-500.908) [-506.751] (-502.345) (-499.320) -- 0:00:49
      39500 -- (-520.801) [-497.299] (-498.880) (-497.764) * (-505.217) (-511.502) [-500.221] (-499.650) -- 0:00:48
      40000 -- (-507.806) (-501.664) [-498.057] (-497.074) * (-498.878) (-507.587) [-499.068] (-501.122) -- 0:00:48

      Average standard deviation of split frequencies: 0.023866

      40500 -- (-506.369) (-498.870) (-497.827) [-499.214] * (-497.419) (-503.903) (-499.296) [-497.932] -- 0:00:47
      41000 -- [-503.446] (-497.839) (-498.029) (-498.867) * (-501.775) (-511.979) [-498.808] (-500.249) -- 0:00:46
      41500 -- (-509.431) (-498.956) [-502.174] (-498.339) * [-499.202] (-506.911) (-500.108) (-505.004) -- 0:00:46
      42000 -- (-509.837) (-505.376) [-498.853] (-499.399) * [-499.112] (-511.533) (-499.839) (-504.516) -- 0:00:45
      42500 -- (-515.100) [-500.703] (-499.327) (-502.763) * (-499.097) [-501.704] (-500.912) (-499.106) -- 0:00:45
      43000 -- [-508.503] (-501.160) (-497.803) (-502.629) * (-500.514) (-508.555) [-498.322] (-501.031) -- 0:00:44
      43500 -- [-503.692] (-497.953) (-500.031) (-502.175) * (-499.242) (-502.405) [-498.108] (-499.973) -- 0:00:43
      44000 -- [-515.220] (-499.389) (-503.145) (-499.522) * (-497.279) (-509.526) (-497.529) [-497.664] -- 0:01:05
      44500 -- (-520.334) (-497.557) [-498.941] (-498.751) * (-500.004) (-518.234) [-498.362] (-500.708) -- 0:01:04
      45000 -- (-512.057) (-498.259) [-499.434] (-498.349) * (-499.305) (-506.621) (-501.869) [-498.561] -- 0:01:03

      Average standard deviation of split frequencies: 0.030231

      45500 -- (-506.737) [-497.668] (-496.847) (-506.269) * (-497.233) [-512.976] (-503.582) (-498.435) -- 0:01:02
      46000 -- (-507.704) (-502.276) [-500.765] (-501.098) * (-499.149) (-503.796) (-508.205) [-501.902] -- 0:01:02
      46500 -- (-509.003) (-499.288) (-500.248) [-497.156] * (-501.957) (-511.661) [-501.849] (-497.146) -- 0:01:01
      47000 -- (-517.073) [-498.079] (-497.024) (-501.645) * [-498.563] (-507.114) (-500.624) (-501.125) -- 0:01:00
      47500 -- (-509.219) (-498.596) (-499.161) [-500.948] * [-498.819] (-510.763) (-498.979) (-501.348) -- 0:01:00
      48000 -- [-517.802] (-501.275) (-497.490) (-498.836) * (-499.385) (-509.603) (-500.152) [-501.599] -- 0:00:59
      48500 -- [-506.687] (-499.597) (-498.143) (-498.429) * (-497.770) [-506.121] (-500.140) (-502.952) -- 0:00:58
      49000 -- (-510.613) (-499.463) [-498.394] (-505.805) * [-499.190] (-511.189) (-499.114) (-499.415) -- 0:00:58
      49500 -- (-507.323) [-498.294] (-497.550) (-504.583) * (-497.097) (-509.712) (-499.418) [-498.440] -- 0:00:57
      50000 -- (-518.414) (-501.868) [-498.435] (-499.935) * (-497.048) (-508.186) (-502.521) [-502.214] -- 0:00:57

      Average standard deviation of split frequencies: 0.031169

      50500 -- (-499.047) [-498.646] (-502.629) (-497.717) * (-497.196) [-505.143] (-500.655) (-498.280) -- 0:00:56
      51000 -- (-499.689) (-499.734) [-498.083] (-500.001) * (-499.358) (-506.014) (-504.014) [-499.576] -- 0:00:55
      51500 -- (-498.853) [-499.152] (-498.024) (-500.668) * (-498.811) (-505.801) [-500.905] (-498.460) -- 0:00:55
      52000 -- (-497.687) [-499.574] (-498.379) (-500.063) * (-498.930) (-516.173) [-497.788] (-502.012) -- 0:00:54
      52500 -- (-497.860) [-497.959] (-497.139) (-496.895) * (-497.477) (-509.200) [-497.543] (-499.170) -- 0:00:54
      53000 -- (-500.064) (-499.492) [-498.124] (-497.875) * [-498.469] (-505.624) (-499.746) (-498.306) -- 0:00:53
      53500 -- [-498.195] (-498.070) (-497.463) (-497.737) * (-497.981) [-508.261] (-497.060) (-500.369) -- 0:00:53
      54000 -- (-500.250) (-497.564) (-497.840) [-498.032] * [-498.838] (-511.776) (-498.906) (-497.299) -- 0:00:52
      54500 -- (-502.249) (-500.048) [-499.741] (-500.848) * (-500.309) (-505.057) [-501.220] (-497.473) -- 0:00:52
      55000 -- [-499.219] (-499.097) (-501.844) (-498.552) * [-498.589] (-508.445) (-499.645) (-498.871) -- 0:00:51

      Average standard deviation of split frequencies: 0.027592

      55500 -- (-497.713) (-500.295) [-499.339] (-497.649) * (-498.407) (-510.420) [-498.643] (-499.106) -- 0:00:51
      56000 -- (-500.760) (-499.284) [-500.327] (-498.575) * (-498.071) (-520.687) [-497.424] (-501.550) -- 0:00:50
      56500 -- (-500.769) (-499.742) (-497.952) [-498.315] * (-497.188) (-515.907) (-497.990) [-499.925] -- 0:00:50
      57000 -- (-499.616) (-500.556) (-497.821) [-500.054] * (-497.125) [-502.953] (-498.308) (-497.498) -- 0:00:49
      57500 -- (-498.021) [-498.827] (-498.104) (-498.217) * (-497.870) (-521.421) [-499.555] (-497.009) -- 0:00:49
      58000 -- (-498.268) [-499.816] (-496.881) (-498.019) * (-498.170) (-516.605) [-501.930] (-500.074) -- 0:00:48
      58500 -- (-497.748) (-498.690) (-499.707) [-497.921] * (-500.165) (-510.049) [-498.189] (-498.023) -- 0:00:48
      59000 -- [-497.447] (-499.390) (-499.709) (-501.408) * (-500.600) (-508.164) (-500.439) [-498.033] -- 0:00:47
      59500 -- (-498.449) [-498.891] (-500.416) (-500.360) * (-499.251) [-508.473] (-499.755) (-501.278) -- 0:00:47
      60000 -- (-498.539) (-498.683) (-498.479) [-500.677] * [-498.563] (-516.420) (-500.800) (-501.220) -- 0:00:47

      Average standard deviation of split frequencies: 0.029355

      60500 -- [-498.127] (-497.429) (-498.843) (-499.236) * (-499.562) (-519.551) (-500.888) [-500.193] -- 0:01:02
      61000 -- (-499.089) (-497.215) (-500.397) [-498.821] * (-498.607) [-500.464] (-499.688) (-498.514) -- 0:01:01
      61500 -- (-497.445) [-497.425] (-502.325) (-498.215) * (-498.575) (-499.238) [-499.381] (-498.183) -- 0:01:01
      62000 -- (-504.564) (-497.588) (-500.103) [-498.180] * (-502.864) (-499.207) (-498.799) [-502.633] -- 0:01:00
      62500 -- (-502.338) [-498.905] (-500.578) (-500.108) * (-504.454) (-497.270) [-496.987] (-498.944) -- 0:01:00
      63000 -- (-501.947) [-498.008] (-499.122) (-499.480) * [-497.837] (-499.343) (-497.488) (-500.084) -- 0:00:59
      63500 -- [-499.814] (-497.397) (-497.033) (-499.856) * [-502.542] (-498.351) (-499.490) (-501.056) -- 0:00:58
      64000 -- (-503.885) [-497.982] (-497.705) (-498.874) * (-500.098) [-502.012] (-502.078) (-498.196) -- 0:00:58
      64500 -- (-500.044) (-500.313) [-503.927] (-500.850) * [-498.458] (-504.643) (-500.093) (-501.500) -- 0:00:58
      65000 -- [-498.191] (-497.890) (-498.153) (-497.553) * [-498.638] (-499.148) (-500.156) (-500.473) -- 0:00:57

      Average standard deviation of split frequencies: 0.028173

      65500 -- [-499.255] (-499.429) (-497.300) (-505.993) * (-503.064) (-499.756) (-500.884) [-498.103] -- 0:00:57
      66000 -- [-498.951] (-499.070) (-503.158) (-504.624) * (-501.354) [-498.163] (-499.274) (-496.990) -- 0:00:56
      66500 -- (-499.275) (-500.443) (-499.187) [-497.654] * [-502.989] (-498.321) (-499.591) (-498.290) -- 0:00:56
      67000 -- (-498.297) (-498.357) (-497.151) [-498.444] * (-501.076) [-498.039] (-500.157) (-498.343) -- 0:00:55
      67500 -- (-497.855) (-499.609) (-500.365) [-498.173] * (-499.247) (-502.426) (-498.713) [-497.670] -- 0:00:55
      68000 -- [-499.170] (-499.602) (-507.261) (-497.088) * (-499.023) (-497.483) [-497.551] (-499.663) -- 0:00:54
      68500 -- (-497.251) (-500.060) [-506.074] (-497.094) * (-500.857) (-500.631) [-498.166] (-499.759) -- 0:00:54
      69000 -- (-497.485) [-498.919] (-500.865) (-502.956) * (-498.930) [-499.594] (-499.484) (-501.097) -- 0:00:53
      69500 -- (-498.411) [-499.345] (-503.712) (-500.054) * (-500.021) (-500.904) (-497.444) [-500.308] -- 0:00:53
      70000 -- (-496.986) (-497.481) [-500.786] (-498.612) * [-497.473] (-500.744) (-497.741) (-499.525) -- 0:00:53

      Average standard deviation of split frequencies: 0.030019

      70500 -- [-497.348] (-498.875) (-501.205) (-498.363) * (-497.952) [-496.987] (-498.775) (-498.079) -- 0:00:52
      71000 -- [-499.044] (-498.360) (-499.014) (-501.163) * (-498.953) [-500.996] (-500.479) (-496.750) -- 0:00:52
      71500 -- [-499.633] (-499.357) (-499.669) (-501.356) * (-497.196) [-497.427] (-501.415) (-497.757) -- 0:00:51
      72000 -- (-497.274) (-497.618) [-499.517] (-499.513) * [-499.702] (-498.292) (-499.733) (-497.373) -- 0:00:51
      72500 -- (-501.189) (-500.843) [-498.922] (-498.017) * (-498.740) (-497.360) (-501.106) [-500.806] -- 0:00:51
      73000 -- (-497.393) (-499.534) [-499.131] (-499.307) * (-498.357) [-497.235] (-500.114) (-499.375) -- 0:00:50
      73500 -- [-497.637] (-500.363) (-497.567) (-503.061) * (-497.362) (-497.243) [-498.501] (-500.042) -- 0:00:50
      74000 -- [-498.598] (-500.065) (-498.502) (-499.967) * (-498.115) [-498.682] (-499.800) (-497.624) -- 0:00:50
      74500 -- (-498.473) (-497.984) (-498.338) [-502.474] * [-497.785] (-503.889) (-498.096) (-498.678) -- 0:00:49
      75000 -- [-500.253] (-497.840) (-498.633) (-498.354) * (-496.962) (-499.977) [-498.622] (-497.721) -- 0:00:49

      Average standard deviation of split frequencies: 0.026878

      75500 -- (-501.077) (-504.699) [-500.602] (-499.758) * [-497.538] (-504.715) (-502.022) (-498.233) -- 0:00:48
      76000 -- (-503.242) (-499.412) (-497.969) [-498.718] * (-500.427) (-497.907) (-503.175) [-499.480] -- 0:00:48
      76500 -- [-497.877] (-501.729) (-499.029) (-502.242) * [-499.288] (-498.516) (-498.996) (-502.310) -- 0:00:48
      77000 -- (-498.381) (-497.783) (-500.042) [-500.030] * (-501.194) (-502.835) [-499.440] (-500.053) -- 0:00:47
      77500 -- (-498.075) (-498.780) [-498.423] (-497.573) * (-498.238) (-498.429) [-500.230] (-497.894) -- 0:00:59
      78000 -- [-498.691] (-498.176) (-500.429) (-497.417) * [-497.943] (-499.384) (-498.897) (-499.211) -- 0:00:59
      78500 -- (-498.518) (-501.143) [-499.164] (-497.405) * [-498.143] (-500.835) (-503.155) (-498.033) -- 0:00:58
      79000 -- (-499.936) (-498.639) [-498.447] (-502.864) * [-498.510] (-498.150) (-502.924) (-497.944) -- 0:00:58
      79500 -- (-499.594) (-498.297) [-498.042] (-498.105) * (-499.026) [-497.980] (-502.516) (-500.149) -- 0:00:57
      80000 -- [-499.450] (-499.770) (-499.818) (-504.255) * (-498.187) [-497.754] (-503.671) (-499.353) -- 0:00:57

      Average standard deviation of split frequencies: 0.029219

      80500 -- (-501.074) (-497.722) [-499.756] (-503.292) * [-497.786] (-500.786) (-498.855) (-500.187) -- 0:00:57
      81000 -- (-502.215) (-497.769) [-498.214] (-500.819) * [-498.060] (-497.164) (-501.860) (-499.055) -- 0:00:56
      81500 -- (-502.561) (-496.924) (-499.481) [-498.964] * [-498.191] (-497.491) (-501.908) (-501.466) -- 0:00:56
      82000 -- (-498.065) [-497.915] (-502.065) (-497.638) * (-497.337) (-498.448) [-501.067] (-499.454) -- 0:00:55
      82500 -- (-499.467) [-497.344] (-496.976) (-497.960) * [-499.200] (-499.485) (-503.202) (-498.966) -- 0:00:55
      83000 -- [-502.290] (-501.017) (-497.514) (-499.498) * [-497.816] (-497.592) (-499.725) (-499.523) -- 0:00:55
      83500 -- [-500.594] (-503.491) (-497.630) (-498.478) * [-498.062] (-499.574) (-497.769) (-500.092) -- 0:00:54
      84000 -- (-500.122) (-499.241) [-497.282] (-499.862) * (-498.129) (-499.364) [-498.658] (-502.374) -- 0:00:54
      84500 -- (-499.969) (-497.080) (-498.910) [-498.315] * (-498.038) (-498.320) (-500.920) [-499.249] -- 0:00:54
      85000 -- (-500.425) [-497.819] (-498.220) (-499.044) * (-499.528) [-499.321] (-502.300) (-499.189) -- 0:00:53

      Average standard deviation of split frequencies: 0.024234

      85500 -- [-503.887] (-497.731) (-498.764) (-499.670) * (-498.536) [-498.146] (-497.760) (-498.145) -- 0:00:53
      86000 -- (-502.747) (-499.678) (-498.733) [-499.629] * (-498.914) (-497.862) [-502.321] (-500.452) -- 0:00:53
      86500 -- (-497.750) (-498.697) (-500.318) [-498.223] * (-498.328) [-498.658] (-498.969) (-499.894) -- 0:00:52
      87000 -- (-498.076) (-498.262) [-499.905] (-498.952) * (-498.089) [-497.366] (-504.181) (-501.284) -- 0:00:52
      87500 -- (-499.832) (-499.445) (-499.668) [-497.945] * (-499.789) (-499.237) [-500.731] (-497.930) -- 0:00:52
      88000 -- (-498.252) (-498.774) [-497.609] (-497.406) * [-498.291] (-497.353) (-499.040) (-498.713) -- 0:00:51
      88500 -- (-497.954) (-498.130) (-497.532) [-498.340] * [-497.785] (-497.784) (-498.342) (-497.225) -- 0:00:51
      89000 -- (-498.844) (-500.435) (-499.291) [-498.855] * [-497.148] (-500.014) (-499.865) (-497.703) -- 0:00:51
      89500 -- (-500.757) (-500.355) [-500.029] (-499.141) * [-497.776] (-501.082) (-497.575) (-496.723) -- 0:00:50
      90000 -- (-500.906) (-502.375) [-499.454] (-498.431) * (-501.103) [-499.033] (-499.941) (-500.150) -- 0:00:50

      Average standard deviation of split frequencies: 0.024355

      90500 -- [-503.626] (-500.801) (-499.918) (-501.262) * (-502.957) [-499.796] (-498.993) (-497.360) -- 0:00:50
      91000 -- (-504.658) (-503.534) [-498.709] (-500.603) * (-499.767) (-500.168) [-497.791] (-500.638) -- 0:00:49
      91500 -- (-502.402) (-498.809) [-497.901] (-498.734) * [-498.439] (-501.481) (-499.759) (-500.646) -- 0:00:49
      92000 -- (-500.168) (-498.333) [-497.348] (-499.945) * (-497.031) (-498.837) [-497.784] (-497.012) -- 0:00:49
      92500 -- [-501.643] (-501.151) (-501.654) (-501.409) * (-497.281) (-498.481) (-498.033) [-497.552] -- 0:00:49
      93000 -- (-499.089) (-505.128) (-500.338) [-499.793] * (-498.216) (-499.217) (-499.885) [-497.004] -- 0:00:48
      93500 -- (-497.453) (-503.752) (-500.457) [-500.639] * (-497.768) (-499.458) (-501.378) [-498.095] -- 0:00:48
      94000 -- (-498.195) (-501.292) [-498.432] (-497.340) * (-500.740) (-500.498) (-501.476) [-497.683] -- 0:00:48
      94500 -- [-498.639] (-500.461) (-502.638) (-498.044) * [-499.624] (-500.091) (-501.106) (-498.832) -- 0:00:57
      95000 -- [-497.928] (-496.688) (-513.449) (-499.676) * (-498.596) (-505.620) (-497.585) [-497.733] -- 0:00:57

      Average standard deviation of split frequencies: 0.023002

      95500 -- (-497.379) [-496.909] (-499.735) (-498.281) * [-499.054] (-499.311) (-501.178) (-498.716) -- 0:00:56
      96000 -- [-498.435] (-497.542) (-504.311) (-497.123) * (-499.300) [-498.955] (-502.474) (-499.911) -- 0:00:56
      96500 -- (-500.817) (-498.251) (-506.443) [-498.397] * (-499.804) (-500.020) (-499.732) [-499.692] -- 0:00:56
      97000 -- (-502.363) (-497.682) (-499.407) [-498.349] * (-498.311) (-498.808) [-498.753] (-497.308) -- 0:00:55
      97500 -- (-497.808) (-497.027) [-499.983] (-498.104) * (-499.655) (-499.510) [-498.143] (-497.320) -- 0:00:55
      98000 -- [-497.162] (-498.270) (-500.260) (-500.606) * (-499.348) (-498.328) [-498.078] (-498.074) -- 0:00:55
      98500 -- (-497.859) [-496.852] (-501.543) (-501.828) * (-500.783) (-499.548) (-497.846) [-500.723] -- 0:00:54
      99000 -- [-500.041] (-498.699) (-498.116) (-498.032) * (-498.511) (-498.333) [-497.600] (-500.639) -- 0:00:54
      99500 -- [-500.146] (-499.871) (-498.337) (-500.638) * (-498.004) (-498.749) [-498.854] (-499.901) -- 0:00:54
      100000 -- (-504.990) [-498.543] (-499.965) (-499.113) * (-497.561) [-500.654] (-500.028) (-497.443) -- 0:00:54

      Average standard deviation of split frequencies: 0.024455

      100500 -- (-499.433) (-497.483) (-498.067) [-497.731] * (-503.728) (-498.514) [-499.626] (-498.807) -- 0:00:53
      101000 -- (-498.300) (-497.184) (-499.888) [-498.891] * (-500.379) [-497.170] (-500.829) (-498.358) -- 0:00:53
      101500 -- (-500.613) (-497.785) (-500.182) [-498.802] * (-497.934) [-500.411] (-499.062) (-497.803) -- 0:00:53
      102000 -- (-501.917) (-497.059) (-498.796) [-498.837] * (-497.839) (-498.264) (-496.920) [-498.543] -- 0:00:52
      102500 -- (-504.324) (-497.429) (-498.470) [-498.681] * (-498.230) (-499.136) (-497.834) [-498.563] -- 0:00:52
      103000 -- (-499.641) (-498.491) (-498.960) [-497.394] * (-504.916) (-497.377) (-497.311) [-499.875] -- 0:00:52
      103500 -- (-499.139) (-499.224) [-499.810] (-501.558) * (-497.576) [-497.587] (-502.312) (-501.993) -- 0:00:51
      104000 -- (-498.030) (-499.002) (-498.776) [-501.086] * (-498.450) [-498.137] (-496.846) (-502.130) -- 0:00:51
      104500 -- (-500.362) (-500.438) (-500.915) [-498.036] * (-497.905) (-497.159) (-498.716) [-504.922] -- 0:00:51
      105000 -- [-497.460] (-498.675) (-500.796) (-497.370) * [-497.639] (-498.068) (-498.787) (-498.647) -- 0:00:51

      Average standard deviation of split frequencies: 0.022903

      105500 -- [-498.703] (-499.094) (-503.210) (-497.333) * (-500.985) (-499.624) (-499.350) [-500.731] -- 0:00:50
      106000 -- (-499.978) [-497.049] (-502.852) (-497.932) * (-500.195) (-498.139) (-498.444) [-497.583] -- 0:00:50
      106500 -- (-498.385) (-500.466) (-502.496) [-497.631] * (-500.199) [-499.134] (-498.697) (-497.733) -- 0:00:50
      107000 -- [-498.732] (-499.034) (-497.968) (-499.286) * [-499.729] (-498.577) (-498.763) (-498.480) -- 0:00:50
      107500 -- [-497.991] (-498.896) (-497.266) (-499.818) * (-498.898) [-500.525] (-500.823) (-497.879) -- 0:00:49
      108000 -- (-498.563) (-499.959) [-497.243] (-498.115) * (-501.417) [-497.813] (-500.326) (-498.779) -- 0:00:49
      108500 -- (-502.016) (-498.359) [-497.711] (-498.084) * [-499.146] (-498.397) (-499.428) (-499.034) -- 0:00:49
      109000 -- (-499.499) (-497.490) (-497.224) [-497.982] * (-502.122) [-499.042] (-497.975) (-498.288) -- 0:00:49
      109500 -- (-501.351) [-501.828] (-498.268) (-497.567) * [-497.537] (-499.749) (-497.953) (-499.541) -- 0:00:48
      110000 -- (-498.291) [-501.392] (-497.792) (-497.721) * (-498.071) (-503.221) (-497.616) [-498.281] -- 0:00:48

      Average standard deviation of split frequencies: 0.022718

      110500 -- (-498.479) (-498.011) (-498.349) [-497.852] * [-499.101] (-500.884) (-499.776) (-499.921) -- 0:00:48
      111000 -- (-497.982) (-501.426) (-499.855) [-497.404] * (-498.131) (-497.361) (-499.108) [-499.412] -- 0:00:48
      111500 -- (-498.803) [-501.284] (-498.113) (-504.306) * [-498.560] (-496.900) (-499.865) (-498.292) -- 0:00:55
      112000 -- [-500.880] (-498.649) (-508.159) (-499.923) * [-500.696] (-497.235) (-502.527) (-498.555) -- 0:00:55
      112500 -- (-499.301) [-498.545] (-500.440) (-499.173) * (-498.015) (-498.001) [-500.540] (-502.554) -- 0:00:55
      113000 -- [-498.606] (-499.392) (-498.482) (-498.359) * [-499.651] (-497.289) (-498.059) (-500.572) -- 0:00:54
      113500 -- [-497.107] (-497.951) (-498.903) (-498.156) * [-498.024] (-499.837) (-499.022) (-498.062) -- 0:00:54
      114000 -- [-498.078] (-498.831) (-496.895) (-497.188) * [-498.489] (-500.055) (-501.745) (-498.473) -- 0:00:54
      114500 -- [-498.735] (-499.016) (-497.003) (-499.660) * (-498.156) (-500.109) (-498.186) [-500.322] -- 0:00:54
      115000 -- (-499.767) (-500.737) (-499.338) [-500.181] * [-497.361] (-497.186) (-497.468) (-498.172) -- 0:00:53

      Average standard deviation of split frequencies: 0.019250

      115500 -- (-499.190) (-497.996) [-504.723] (-499.510) * (-499.211) [-497.490] (-498.721) (-496.761) -- 0:00:53
      116000 -- (-497.769) (-497.483) (-499.455) [-501.484] * [-497.891] (-498.690) (-497.242) (-497.198) -- 0:00:53
      116500 -- [-499.154] (-499.201) (-499.672) (-497.907) * (-499.472) [-499.476] (-497.528) (-498.697) -- 0:00:53
      117000 -- (-497.206) (-497.970) [-499.333] (-502.100) * (-498.652) (-498.877) (-499.245) [-499.321] -- 0:00:52
      117500 -- (-498.874) [-499.987] (-499.579) (-501.511) * [-498.123] (-499.424) (-502.402) (-499.439) -- 0:00:52
      118000 -- [-498.279] (-501.145) (-500.786) (-498.309) * (-498.274) (-497.743) (-501.625) [-499.425] -- 0:00:52
      118500 -- (-499.514) [-498.436] (-498.926) (-508.379) * (-498.172) (-498.630) (-499.191) [-498.725] -- 0:00:52
      119000 -- (-500.301) [-497.541] (-499.231) (-499.103) * (-500.084) (-499.809) [-498.751] (-498.904) -- 0:00:51
      119500 -- (-498.837) (-500.240) [-502.168] (-500.034) * (-499.396) (-500.479) [-497.093] (-497.482) -- 0:00:51
      120000 -- (-498.867) (-497.386) [-499.798] (-498.223) * (-499.003) [-496.988] (-497.680) (-497.496) -- 0:00:51

      Average standard deviation of split frequencies: 0.019099

      120500 -- (-503.160) [-499.997] (-502.819) (-498.735) * [-501.697] (-497.617) (-499.091) (-502.672) -- 0:00:51
      121000 -- (-500.945) (-497.434) (-497.966) [-498.199] * (-501.271) (-499.768) [-498.205] (-500.131) -- 0:00:50
      121500 -- (-499.533) [-499.364] (-498.804) (-497.391) * (-497.545) [-500.278] (-498.611) (-504.243) -- 0:00:50
      122000 -- (-500.018) (-502.506) (-503.897) [-497.683] * (-507.316) [-500.291] (-499.898) (-508.370) -- 0:00:50
      122500 -- [-497.335] (-499.662) (-501.995) (-498.812) * (-499.250) (-498.031) [-496.970] (-499.698) -- 0:00:50
      123000 -- (-498.485) (-499.010) (-499.964) [-498.674] * (-498.803) (-497.606) [-498.475] (-499.621) -- 0:00:49
      123500 -- (-497.682) (-503.494) [-498.442] (-502.368) * (-499.433) (-498.623) (-498.997) [-497.961] -- 0:00:49
      124000 -- (-500.590) [-497.564] (-502.229) (-498.425) * (-500.684) [-498.212] (-497.786) (-500.263) -- 0:00:49
      124500 -- (-499.511) [-500.035] (-498.095) (-500.428) * [-499.942] (-505.009) (-497.302) (-498.285) -- 0:00:49
      125000 -- (-502.164) (-499.430) (-499.336) [-498.192] * [-499.260] (-499.421) (-500.646) (-497.891) -- 0:00:49

      Average standard deviation of split frequencies: 0.017722

      125500 -- (-498.222) [-501.201] (-500.430) (-498.014) * (-500.260) (-499.122) (-500.648) [-497.516] -- 0:00:48
      126000 -- [-503.460] (-499.584) (-498.761) (-497.241) * [-498.850] (-498.577) (-498.188) (-499.965) -- 0:00:48
      126500 -- [-499.322] (-502.373) (-497.584) (-498.765) * [-502.339] (-501.884) (-498.140) (-500.688) -- 0:00:48
      127000 -- (-499.304) (-500.023) (-501.312) [-499.465] * (-500.553) (-498.416) [-500.757] (-502.785) -- 0:00:48
      127500 -- [-500.628] (-498.238) (-498.411) (-501.003) * (-500.752) (-498.776) [-499.309] (-497.751) -- 0:00:47
      128000 -- (-500.884) (-500.248) (-500.305) [-498.393] * (-499.392) (-500.193) (-499.388) [-498.587] -- 0:00:54
      128500 -- [-498.204] (-496.877) (-501.188) (-499.930) * (-499.283) (-497.570) [-502.029] (-499.366) -- 0:00:54
      129000 -- (-501.198) [-497.709] (-501.687) (-500.013) * (-496.848) (-499.964) (-503.076) [-498.075] -- 0:00:54
      129500 -- [-498.436] (-498.729) (-497.601) (-500.362) * (-500.851) [-499.703] (-497.452) (-500.047) -- 0:00:53
      130000 -- [-497.497] (-497.903) (-500.216) (-500.996) * (-498.029) [-497.882] (-500.384) (-500.197) -- 0:00:53

      Average standard deviation of split frequencies: 0.014431

      130500 -- (-499.574) (-497.035) [-498.982] (-506.399) * (-499.941) (-499.589) [-500.822] (-499.714) -- 0:00:53
      131000 -- (-498.206) (-496.850) [-497.043] (-500.976) * (-500.994) [-499.633] (-501.322) (-499.587) -- 0:00:53
      131500 -- [-496.783] (-496.826) (-497.279) (-499.486) * [-498.574] (-500.170) (-501.352) (-500.709) -- 0:00:52
      132000 -- [-499.432] (-497.915) (-501.899) (-500.284) * [-500.904] (-503.372) (-498.727) (-497.588) -- 0:00:52
      132500 -- (-498.497) [-497.332] (-499.496) (-499.708) * (-500.359) (-499.453) [-501.207] (-498.037) -- 0:00:52
      133000 -- (-499.088) (-497.361) (-504.495) [-497.693] * (-499.079) (-497.153) (-507.442) [-498.258] -- 0:00:52
      133500 -- (-498.001) (-498.203) [-499.086] (-496.998) * (-498.741) (-497.959) (-500.038) [-502.560] -- 0:00:51
      134000 -- (-501.151) (-499.048) (-499.311) [-497.947] * (-500.132) (-497.597) [-497.985] (-498.119) -- 0:00:51
      134500 -- (-498.593) (-498.724) (-497.557) [-497.621] * (-499.490) [-500.110] (-499.760) (-498.616) -- 0:00:51
      135000 -- (-498.760) (-503.886) [-499.388] (-500.508) * (-500.450) (-497.521) (-499.584) [-501.043] -- 0:00:51

      Average standard deviation of split frequencies: 0.015020

      135500 -- [-498.667] (-499.889) (-498.598) (-498.004) * [-498.154] (-497.617) (-497.890) (-501.123) -- 0:00:51
      136000 -- (-498.030) [-499.515] (-507.683) (-498.203) * (-500.187) (-499.565) [-498.708] (-501.520) -- 0:00:50
      136500 -- (-497.350) (-498.567) [-499.957] (-497.766) * [-499.729] (-497.874) (-497.515) (-501.016) -- 0:00:50
      137000 -- [-497.212] (-497.163) (-499.132) (-498.084) * (-498.196) [-501.142] (-499.341) (-499.335) -- 0:00:50
      137500 -- (-497.577) (-498.585) (-501.256) [-498.571] * (-503.799) [-500.765] (-500.751) (-499.975) -- 0:00:50
      138000 -- (-500.281) (-497.681) (-498.445) [-499.512] * (-499.597) [-497.621] (-498.626) (-497.176) -- 0:00:49
      138500 -- (-501.875) (-500.479) [-500.299] (-503.823) * (-497.118) [-497.797] (-498.444) (-498.727) -- 0:00:49
      139000 -- (-502.624) (-498.126) (-499.826) [-500.727] * (-502.890) (-497.944) (-497.522) [-500.978] -- 0:00:49
      139500 -- (-497.613) (-502.656) (-497.936) [-498.380] * (-500.404) (-499.126) (-498.480) [-498.736] -- 0:00:49
      140000 -- (-499.201) [-497.214] (-498.233) (-501.021) * (-499.478) (-497.910) (-500.105) [-498.196] -- 0:00:49

      Average standard deviation of split frequencies: 0.014150

      140500 -- (-497.565) (-501.963) [-498.460] (-499.139) * [-497.895] (-500.132) (-499.214) (-500.221) -- 0:00:48
      141000 -- (-500.655) [-500.248] (-497.518) (-501.391) * (-500.959) (-497.744) (-501.063) [-499.485] -- 0:00:48
      141500 -- (-499.605) [-497.826] (-500.452) (-498.625) * (-500.969) (-497.232) [-498.819] (-497.880) -- 0:00:48
      142000 -- (-497.570) (-500.246) (-500.743) [-497.344] * (-497.795) [-497.037] (-499.873) (-497.951) -- 0:00:48
      142500 -- [-502.047] (-498.330) (-501.275) (-498.158) * [-497.741] (-502.195) (-501.481) (-497.261) -- 0:00:48
      143000 -- [-502.955] (-498.767) (-501.016) (-505.359) * (-497.846) (-501.886) [-501.117] (-497.965) -- 0:00:47
      143500 -- [-498.248] (-499.746) (-498.273) (-497.960) * (-499.730) (-497.901) [-499.131] (-499.249) -- 0:00:47
      144000 -- (-499.657) (-500.995) (-500.014) [-505.505] * (-497.111) (-497.945) (-497.749) [-498.982] -- 0:00:47
      144500 -- (-501.673) (-499.718) (-498.678) [-498.679] * (-499.213) (-496.762) (-500.257) [-500.273] -- 0:00:53
      145000 -- [-497.353] (-500.115) (-499.127) (-497.773) * [-499.228] (-498.064) (-498.414) (-500.449) -- 0:00:53

      Average standard deviation of split frequencies: 0.014275

      145500 -- (-501.355) (-499.632) (-498.717) [-499.905] * [-500.089] (-498.575) (-500.171) (-503.160) -- 0:00:52
      146000 -- (-499.120) [-499.273] (-500.567) (-500.044) * (-498.934) (-497.383) [-498.531] (-499.220) -- 0:00:52
      146500 -- (-497.389) [-500.183] (-501.973) (-503.529) * [-499.542] (-497.065) (-497.226) (-498.609) -- 0:00:52
      147000 -- (-498.530) (-498.352) [-500.234] (-499.187) * (-498.258) (-499.328) (-498.268) [-499.533] -- 0:00:52
      147500 -- (-499.549) (-497.962) (-499.829) [-497.304] * (-501.078) (-498.818) [-498.032] (-497.897) -- 0:00:52
      148000 -- [-500.173] (-500.259) (-500.023) (-499.483) * (-500.578) (-500.588) [-498.194] (-497.968) -- 0:00:51
      148500 -- (-500.472) (-497.311) (-498.783) [-501.259] * [-500.172] (-500.637) (-497.781) (-498.488) -- 0:00:51
      149000 -- (-496.753) (-497.580) (-502.084) [-500.612] * [-498.879] (-499.707) (-504.100) (-499.196) -- 0:00:51
      149500 -- (-496.838) [-500.639] (-503.259) (-497.995) * (-498.367) (-499.623) [-498.443] (-499.446) -- 0:00:51
      150000 -- (-499.078) [-498.874] (-498.360) (-498.087) * (-499.228) (-501.444) [-498.309] (-499.974) -- 0:00:51

      Average standard deviation of split frequencies: 0.012515

      150500 -- (-500.446) (-497.249) [-501.577] (-497.477) * (-497.622) (-499.834) [-500.168] (-503.018) -- 0:00:50
      151000 -- (-503.670) [-497.742] (-499.804) (-498.410) * (-500.094) (-499.185) [-497.304] (-499.874) -- 0:00:50
      151500 -- (-502.055) (-497.993) (-500.993) [-497.882] * [-500.118] (-500.864) (-498.389) (-500.731) -- 0:00:50
      152000 -- (-500.171) [-499.382] (-500.965) (-497.571) * (-499.719) (-500.884) (-498.331) [-498.802] -- 0:00:50
      152500 -- (-498.619) (-498.968) [-501.607] (-499.118) * (-500.472) (-502.042) [-502.843] (-497.607) -- 0:00:50
      153000 -- [-499.332] (-506.820) (-498.750) (-499.717) * (-500.799) (-501.121) [-499.148] (-497.074) -- 0:00:49
      153500 -- [-499.957] (-498.370) (-501.110) (-498.488) * [-498.962] (-501.320) (-498.365) (-498.797) -- 0:00:49
      154000 -- (-498.121) [-498.213] (-499.616) (-501.752) * (-497.701) (-499.322) [-499.864] (-497.822) -- 0:00:49
      154500 -- (-500.913) [-497.784] (-501.495) (-500.835) * (-500.064) (-499.020) [-500.457] (-496.989) -- 0:00:49
      155000 -- (-500.889) (-498.472) [-500.839] (-501.224) * (-498.744) (-497.910) (-498.023) [-499.057] -- 0:00:49

      Average standard deviation of split frequencies: 0.012255

      155500 -- (-497.271) (-497.633) (-498.598) [-500.954] * (-498.781) [-499.168] (-502.546) (-497.537) -- 0:00:48
      156000 -- (-497.765) [-497.450] (-502.593) (-506.128) * (-498.556) [-499.527] (-498.825) (-502.482) -- 0:00:48
      156500 -- [-499.150] (-499.146) (-502.933) (-501.751) * (-498.243) (-498.153) (-498.312) [-499.681] -- 0:00:48
      157000 -- (-500.282) (-501.518) [-498.552] (-498.120) * (-500.032) (-497.066) (-501.564) [-497.119] -- 0:00:48
      157500 -- (-501.234) [-499.802] (-497.787) (-499.809) * [-499.216] (-498.101) (-500.446) (-498.227) -- 0:00:48
      158000 -- (-497.869) [-497.317] (-499.337) (-498.313) * (-499.501) [-498.513] (-502.050) (-501.092) -- 0:00:47
      158500 -- [-497.459] (-497.969) (-498.756) (-499.508) * [-498.976] (-500.604) (-498.794) (-503.558) -- 0:00:47
      159000 -- [-498.459] (-497.951) (-502.874) (-498.591) * (-498.147) (-497.714) (-497.731) [-502.489] -- 0:00:47
      159500 -- [-498.303] (-497.626) (-499.251) (-499.232) * (-498.762) [-499.123] (-499.162) (-501.575) -- 0:00:47
      160000 -- [-498.950] (-497.789) (-497.405) (-497.875) * (-498.228) (-498.389) (-497.765) [-501.622] -- 0:00:47

      Average standard deviation of split frequencies: 0.012714

      160500 -- [-498.326] (-497.936) (-499.775) (-496.946) * (-499.422) (-498.497) (-497.898) [-501.628] -- 0:00:47
      161000 -- (-498.628) (-501.749) [-497.788] (-497.262) * (-498.075) (-498.281) [-500.251] (-499.677) -- 0:00:52
      161500 -- (-501.137) (-502.639) [-497.570] (-504.875) * [-497.616] (-498.421) (-500.655) (-500.905) -- 0:00:51
      162000 -- (-498.091) (-498.525) (-499.983) [-499.553] * (-498.613) (-500.206) (-500.407) [-498.833] -- 0:00:51
      162500 -- [-498.062] (-498.154) (-500.980) (-499.544) * (-499.287) (-500.522) [-498.208] (-504.618) -- 0:00:51
      163000 -- (-500.987) [-498.160] (-500.040) (-498.419) * (-500.081) (-501.068) (-500.738) [-498.667] -- 0:00:51
      163500 -- (-498.054) [-497.391] (-499.074) (-498.702) * (-500.240) (-498.491) [-498.891] (-500.599) -- 0:00:51
      164000 -- (-499.793) [-501.041] (-497.920) (-497.695) * [-497.590] (-498.421) (-497.473) (-500.988) -- 0:00:50
      164500 -- (-498.989) (-499.422) (-501.973) [-498.828] * [-498.842] (-498.619) (-500.205) (-501.802) -- 0:00:50
      165000 -- (-498.307) (-497.249) (-498.119) [-499.964] * (-499.161) (-499.230) [-500.602] (-498.009) -- 0:00:50

      Average standard deviation of split frequencies: 0.011359

      165500 -- (-499.156) (-501.818) (-502.242) [-499.685] * [-501.712] (-498.335) (-497.668) (-497.236) -- 0:00:50
      166000 -- (-498.284) (-503.421) [-501.368] (-499.802) * (-500.422) [-500.096] (-498.572) (-497.459) -- 0:00:50
      166500 -- [-498.267] (-500.408) (-498.381) (-498.280) * (-501.084) (-496.853) [-498.970] (-499.822) -- 0:00:50
      167000 -- (-499.005) (-498.603) [-499.391] (-498.162) * [-498.713] (-499.115) (-499.269) (-498.755) -- 0:00:49
      167500 -- (-497.422) [-501.052] (-503.109) (-499.115) * (-499.419) (-498.222) [-500.406] (-498.923) -- 0:00:49
      168000 -- (-496.987) (-499.342) (-500.841) [-498.221] * (-499.703) (-499.787) (-501.258) [-501.996] -- 0:00:49
      168500 -- (-497.645) (-500.911) (-499.961) [-497.543] * (-497.392) (-501.199) (-502.055) [-500.871] -- 0:00:49
      169000 -- (-502.480) (-499.391) (-501.292) [-498.987] * (-506.621) (-498.650) (-501.282) [-500.568] -- 0:00:49
      169500 -- [-498.248] (-503.587) (-500.136) (-499.970) * (-500.185) (-498.616) (-504.580) [-501.241] -- 0:00:48
      170000 -- (-500.512) [-499.392] (-500.382) (-504.001) * [-499.984] (-502.164) (-497.958) (-500.180) -- 0:00:48

      Average standard deviation of split frequencies: 0.012276

      170500 -- (-502.494) [-497.202] (-499.662) (-507.103) * (-499.609) [-498.421] (-500.066) (-499.793) -- 0:00:48
      171000 -- (-498.127) [-496.854] (-497.797) (-500.416) * (-498.895) (-498.948) (-502.511) [-499.346] -- 0:00:48
      171500 -- [-499.110] (-496.805) (-497.730) (-497.476) * (-499.147) (-497.255) [-498.821] (-499.340) -- 0:00:48
      172000 -- [-496.876] (-497.205) (-498.948) (-498.796) * (-501.840) (-498.595) (-501.340) [-497.416] -- 0:00:48
      172500 -- [-498.666] (-498.692) (-501.120) (-498.339) * (-498.021) (-497.692) [-496.968] (-499.559) -- 0:00:47
      173000 -- (-497.848) [-499.456] (-498.694) (-500.119) * [-497.442] (-498.776) (-500.142) (-497.866) -- 0:00:47
      173500 -- (-498.804) [-499.699] (-501.339) (-499.819) * [-499.277] (-497.956) (-499.642) (-499.470) -- 0:00:47
      174000 -- (-497.494) (-499.641) (-499.599) [-499.147] * (-502.571) (-497.624) [-497.288] (-499.689) -- 0:00:47
      174500 -- (-499.676) (-498.304) [-498.576] (-497.980) * (-499.493) [-497.635] (-497.455) (-498.171) -- 0:00:47
      175000 -- (-500.242) (-501.546) (-496.847) [-497.201] * (-501.382) (-498.357) (-498.599) [-498.748] -- 0:00:47

      Average standard deviation of split frequencies: 0.013707

      175500 -- (-498.741) [-497.026] (-501.450) (-498.296) * (-502.328) [-499.056] (-498.123) (-499.316) -- 0:00:46
      176000 -- (-497.750) (-501.065) (-501.343) [-499.436] * (-498.633) [-498.398] (-501.037) (-498.918) -- 0:00:46
      176500 -- (-498.596) (-497.348) [-501.048] (-500.967) * (-499.961) [-497.947] (-499.494) (-500.891) -- 0:00:46
      177000 -- (-497.303) (-499.536) [-498.656] (-500.722) * (-498.581) (-500.599) [-502.812] (-497.341) -- 0:00:46
      177500 -- (-499.699) (-497.730) (-499.357) [-501.441] * (-503.933) (-503.491) (-500.414) [-499.137] -- 0:00:46
      178000 -- (-497.234) (-505.092) (-498.855) [-502.902] * (-499.325) [-498.826] (-499.378) (-499.195) -- 0:00:46
      178500 -- (-499.411) [-498.141] (-498.703) (-500.468) * [-500.120] (-506.716) (-502.496) (-498.843) -- 0:00:50
      179000 -- [-499.251] (-499.679) (-498.512) (-497.817) * (-497.365) (-502.188) (-498.278) [-499.082] -- 0:00:50
      179500 -- (-498.365) [-497.857] (-500.464) (-500.567) * (-498.209) (-502.258) (-500.727) [-497.457] -- 0:00:50
      180000 -- (-497.038) [-498.823] (-499.966) (-500.940) * (-498.566) (-498.085) (-498.961) [-498.213] -- 0:00:50

      Average standard deviation of split frequencies: 0.013660

      180500 -- [-497.936] (-500.317) (-501.297) (-500.436) * (-499.923) [-497.186] (-502.359) (-497.424) -- 0:00:49
      181000 -- (-500.575) (-500.317) (-498.607) [-498.947] * (-499.858) (-499.671) [-497.889] (-499.193) -- 0:00:49
      181500 -- (-502.984) (-498.995) (-499.450) [-500.208] * (-499.647) (-498.543) [-497.095] (-499.607) -- 0:00:49
      182000 -- (-503.601) (-498.179) (-498.779) [-499.081] * [-498.115] (-497.546) (-500.217) (-501.396) -- 0:00:49
      182500 -- (-497.597) [-497.257] (-499.268) (-498.991) * [-497.339] (-499.001) (-498.204) (-502.025) -- 0:00:49
      183000 -- [-499.320] (-500.475) (-499.184) (-500.079) * (-499.555) (-498.377) (-500.317) [-498.943] -- 0:00:49
      183500 -- (-501.679) [-499.593] (-498.039) (-497.226) * [-499.602] (-499.179) (-502.381) (-500.569) -- 0:00:48
      184000 -- (-503.625) (-499.799) (-501.193) [-499.460] * (-498.546) [-499.555] (-498.558) (-499.972) -- 0:00:48
      184500 -- (-501.159) (-499.730) [-497.761] (-500.642) * (-500.678) [-498.963] (-499.057) (-497.541) -- 0:00:48
      185000 -- (-504.477) [-499.499] (-497.288) (-500.095) * (-499.749) (-502.056) [-498.933] (-497.673) -- 0:00:48

      Average standard deviation of split frequencies: 0.013072

      185500 -- (-499.109) (-499.604) (-500.104) [-501.047] * (-500.610) (-498.680) (-499.023) [-497.099] -- 0:00:48
      186000 -- (-498.742) (-499.355) [-497.110] (-501.044) * (-501.133) [-501.991] (-498.304) (-498.616) -- 0:00:48
      186500 -- (-497.478) (-498.557) [-501.915] (-500.424) * (-497.664) [-498.577] (-499.063) (-497.239) -- 0:00:47
      187000 -- [-499.626] (-500.188) (-499.667) (-498.912) * (-501.902) (-498.677) [-500.164] (-500.996) -- 0:00:47
      187500 -- (-500.318) (-503.486) [-498.593] (-499.664) * [-498.434] (-497.931) (-498.926) (-499.012) -- 0:00:47
      188000 -- (-499.318) [-498.624] (-501.365) (-499.842) * (-498.860) (-497.433) [-498.403] (-499.154) -- 0:00:47
      188500 -- (-499.221) (-497.205) [-501.062] (-498.329) * (-502.965) [-499.578] (-500.121) (-497.960) -- 0:00:47
      189000 -- [-497.280] (-501.491) (-498.230) (-498.222) * [-499.823] (-498.802) (-498.952) (-498.476) -- 0:00:47
      189500 -- [-497.560] (-506.582) (-498.914) (-497.804) * (-499.135) (-498.197) [-501.224] (-498.203) -- 0:00:47
      190000 -- (-497.115) [-498.793] (-500.141) (-497.411) * (-498.840) (-500.988) (-499.722) [-498.669] -- 0:00:46

      Average standard deviation of split frequencies: 0.012492

      190500 -- (-498.104) (-500.363) (-497.473) [-500.635] * [-499.774] (-502.352) (-498.512) (-498.067) -- 0:00:46
      191000 -- (-498.372) [-498.290] (-497.760) (-499.568) * (-498.283) (-498.805) (-498.720) [-498.452] -- 0:00:46
      191500 -- (-496.847) [-497.166] (-497.839) (-499.280) * (-498.812) [-499.160] (-503.572) (-499.380) -- 0:00:46
      192000 -- (-500.613) [-497.332] (-501.359) (-499.065) * (-497.409) (-498.867) (-497.647) [-498.482] -- 0:00:46
      192500 -- [-496.933] (-498.192) (-502.367) (-498.746) * (-497.612) (-499.465) (-498.720) [-497.730] -- 0:00:46
      193000 -- (-499.135) (-501.577) [-502.716] (-498.283) * [-499.659] (-497.693) (-499.256) (-497.097) -- 0:00:45
      193500 -- [-499.264] (-501.804) (-497.905) (-498.855) * [-499.983] (-499.203) (-497.271) (-496.818) -- 0:00:45
      194000 -- (-499.961) (-498.581) [-500.709] (-497.665) * (-499.325) (-497.001) [-498.030] (-498.089) -- 0:00:45
      194500 -- (-500.834) (-497.599) [-497.804] (-499.225) * (-497.690) [-497.690] (-498.887) (-497.541) -- 0:00:45
      195000 -- (-497.708) (-497.046) (-498.332) [-501.994] * [-500.871] (-499.168) (-498.240) (-497.007) -- 0:00:45

      Average standard deviation of split frequencies: 0.012167

      195500 -- [-500.271] (-500.004) (-497.847) (-497.779) * (-502.207) (-499.896) (-498.400) [-498.430] -- 0:00:49
      196000 -- (-500.350) (-503.215) [-497.541] (-497.977) * [-497.152] (-500.118) (-498.214) (-499.731) -- 0:00:49
      196500 -- (-499.020) (-500.499) (-497.562) [-497.893] * (-497.382) (-497.821) (-497.179) [-502.886] -- 0:00:49
      197000 -- (-504.622) (-501.317) [-497.938] (-498.886) * [-497.611] (-503.008) (-497.831) (-501.785) -- 0:00:48
      197500 -- [-500.728] (-499.681) (-499.597) (-501.047) * [-497.783] (-507.020) (-497.366) (-500.625) -- 0:00:48
      198000 -- [-498.885] (-497.220) (-499.110) (-502.912) * [-498.052] (-499.018) (-501.069) (-498.506) -- 0:00:48
      198500 -- (-502.012) [-497.100] (-499.607) (-500.374) * (-498.923) (-500.484) (-501.017) [-500.061] -- 0:00:48
      199000 -- [-501.636] (-498.669) (-498.175) (-500.878) * (-500.014) (-498.068) [-501.983] (-499.194) -- 0:00:48
      199500 -- (-500.442) (-500.742) [-498.756] (-497.167) * (-498.135) [-497.539] (-499.942) (-505.468) -- 0:00:48
      200000 -- (-497.951) (-501.269) (-497.615) [-498.929] * (-498.314) (-500.746) (-500.518) [-497.722] -- 0:00:48

      Average standard deviation of split frequencies: 0.013128

      200500 -- (-500.269) (-500.822) [-497.639] (-502.485) * (-498.282) (-498.392) [-499.364] (-497.826) -- 0:00:47
      201000 -- (-504.541) (-499.708) (-501.037) [-497.989] * [-501.448] (-501.968) (-501.912) (-503.168) -- 0:00:47
      201500 -- (-499.347) (-500.037) [-498.116] (-498.774) * [-500.923] (-500.576) (-501.656) (-506.855) -- 0:00:47
      202000 -- (-502.388) (-500.495) [-499.153] (-497.644) * [-498.259] (-501.090) (-502.355) (-503.149) -- 0:00:47
      202500 -- (-500.156) [-497.581] (-499.797) (-498.135) * (-500.951) [-498.487] (-499.046) (-502.115) -- 0:00:47
      203000 -- (-498.848) (-500.250) (-499.879) [-499.690] * (-501.222) (-498.527) [-498.967] (-498.249) -- 0:00:47
      203500 -- (-498.333) (-500.087) [-502.985] (-502.246) * (-506.278) (-499.137) (-498.326) [-498.573] -- 0:00:46
      204000 -- (-499.794) [-499.664] (-501.450) (-498.441) * [-498.177] (-498.628) (-498.311) (-499.522) -- 0:00:46
      204500 -- (-497.424) (-501.633) [-499.645] (-498.165) * (-498.742) (-497.339) [-497.962] (-500.224) -- 0:00:46
      205000 -- (-499.396) (-500.048) (-500.911) [-497.162] * (-498.940) [-497.536] (-496.978) (-499.095) -- 0:00:46

      Average standard deviation of split frequencies: 0.011803

      205500 -- (-498.934) (-500.614) (-500.520) [-500.047] * (-501.660) (-497.490) (-498.470) [-500.888] -- 0:00:46
      206000 -- (-497.223) (-499.649) (-500.346) [-499.864] * [-496.781] (-498.983) (-499.009) (-499.709) -- 0:00:46
      206500 -- [-497.309] (-499.531) (-498.421) (-497.475) * (-500.521) (-500.436) [-498.793] (-497.807) -- 0:00:46
      207000 -- [-497.786] (-501.172) (-496.927) (-497.800) * (-503.117) (-506.694) [-499.948] (-499.608) -- 0:00:45
      207500 -- [-498.031] (-506.202) (-497.666) (-499.598) * [-499.947] (-502.527) (-499.852) (-499.374) -- 0:00:45
      208000 -- (-500.793) (-499.062) [-497.739] (-499.605) * (-502.109) [-502.528] (-501.607) (-499.374) -- 0:00:45
      208500 -- [-497.819] (-497.039) (-498.351) (-504.592) * (-498.392) [-497.543] (-499.757) (-497.366) -- 0:00:45
      209000 -- (-498.466) [-499.621] (-502.589) (-498.879) * (-504.285) [-498.429] (-497.044) (-498.720) -- 0:00:45
      209500 -- [-496.886] (-498.853) (-502.802) (-498.184) * (-503.062) (-499.198) (-497.174) [-498.920] -- 0:00:45
      210000 -- [-497.003] (-499.970) (-497.237) (-498.642) * [-499.733] (-500.820) (-500.880) (-501.069) -- 0:00:45

      Average standard deviation of split frequencies: 0.013302

      210500 -- (-497.722) (-498.747) [-502.080] (-502.437) * (-499.771) (-500.347) (-497.581) [-500.150] -- 0:00:45
      211000 -- (-497.071) (-497.199) (-499.337) [-498.340] * (-499.763) (-500.827) (-498.418) [-499.880] -- 0:00:44
      211500 -- (-499.377) [-497.306] (-497.882) (-500.780) * (-500.795) [-498.992] (-497.486) (-499.232) -- 0:00:44
      212000 -- [-499.187] (-499.384) (-498.714) (-499.034) * (-501.438) [-503.266] (-497.762) (-501.765) -- 0:00:44
      212500 -- [-499.690] (-501.137) (-497.180) (-498.140) * (-498.042) [-501.008] (-497.955) (-498.530) -- 0:00:48
      213000 -- [-504.430] (-497.652) (-499.176) (-498.397) * (-499.954) (-499.264) [-499.638] (-498.256) -- 0:00:48
      213500 -- (-501.078) (-499.442) (-499.773) [-498.828] * (-497.516) (-499.303) (-500.848) [-499.476] -- 0:00:47
      214000 -- (-501.278) (-497.825) (-497.189) [-498.038] * [-498.742] (-498.974) (-504.460) (-497.990) -- 0:00:47
      214500 -- [-499.383] (-499.537) (-498.040) (-499.534) * (-497.997) (-500.732) [-500.824] (-498.593) -- 0:00:47
      215000 -- (-499.874) (-501.892) (-498.653) [-497.250] * (-506.365) [-505.891] (-498.901) (-499.776) -- 0:00:47

      Average standard deviation of split frequencies: 0.014892

      215500 -- (-501.324) (-498.501) (-499.239) [-499.167] * (-497.649) (-500.618) [-498.145] (-501.061) -- 0:00:47
      216000 -- (-498.370) [-498.890] (-498.236) (-501.098) * (-498.494) (-502.990) [-499.994] (-503.909) -- 0:00:47
      216500 -- (-498.394) (-501.971) [-500.219] (-499.021) * [-498.050] (-501.304) (-499.858) (-503.758) -- 0:00:47
      217000 -- (-499.442) [-497.723] (-499.177) (-498.139) * (-497.678) (-499.957) [-501.793] (-500.688) -- 0:00:46
      217500 -- (-497.602) [-499.200] (-500.315) (-502.403) * (-500.214) (-496.931) [-498.276] (-498.319) -- 0:00:46
      218000 -- (-498.944) (-500.435) [-497.628] (-500.981) * [-501.289] (-502.168) (-496.726) (-498.478) -- 0:00:46
      218500 -- (-499.943) (-500.272) [-497.369] (-500.346) * [-498.315] (-499.984) (-497.280) (-499.841) -- 0:00:46
      219000 -- [-501.220] (-498.571) (-498.006) (-501.215) * (-502.541) (-497.668) [-498.127] (-498.531) -- 0:00:46
      219500 -- [-498.181] (-498.526) (-502.926) (-500.775) * (-499.724) [-498.716] (-500.808) (-499.471) -- 0:00:46
      220000 -- [-499.355] (-500.546) (-500.121) (-498.380) * (-498.236) (-503.624) [-497.397] (-498.815) -- 0:00:46

      Average standard deviation of split frequencies: 0.012943

      220500 -- (-497.841) (-499.186) (-497.993) [-503.783] * (-500.078) (-498.763) (-499.643) [-500.234] -- 0:00:45
      221000 -- [-502.882] (-497.098) (-500.909) (-500.515) * (-497.378) (-498.659) [-497.567] (-496.871) -- 0:00:45
      221500 -- (-499.610) (-499.842) (-500.695) [-498.907] * (-498.905) [-497.048] (-498.030) (-496.797) -- 0:00:45
      222000 -- (-503.732) (-498.120) [-497.998] (-497.909) * (-498.463) [-497.898] (-498.233) (-498.641) -- 0:00:45
      222500 -- [-502.143] (-498.063) (-498.773) (-501.937) * (-498.075) (-498.899) [-497.931] (-499.990) -- 0:00:45
      223000 -- (-500.335) (-497.267) [-497.412] (-502.596) * [-500.374] (-501.991) (-498.868) (-497.650) -- 0:00:45
      223500 -- [-497.242] (-498.200) (-500.420) (-499.901) * (-499.939) (-498.862) [-497.361] (-499.949) -- 0:00:45
      224000 -- [-497.862] (-498.007) (-500.618) (-499.997) * (-499.321) (-497.725) [-499.940] (-500.448) -- 0:00:45
      224500 -- [-499.005] (-502.229) (-498.168) (-501.589) * (-500.475) (-498.996) (-501.158) [-498.351] -- 0:00:44
      225000 -- (-498.840) (-499.307) (-498.401) [-499.985] * [-497.761] (-498.575) (-505.132) (-499.441) -- 0:00:44

      Average standard deviation of split frequencies: 0.011088

      225500 -- (-500.927) [-498.047] (-498.709) (-498.284) * [-497.208] (-498.646) (-499.341) (-498.865) -- 0:00:44
      226000 -- (-500.952) [-497.402] (-499.399) (-498.653) * (-498.268) [-499.867] (-499.107) (-499.924) -- 0:00:44
      226500 -- (-500.029) (-499.357) [-499.543] (-501.790) * [-498.573] (-498.848) (-501.132) (-499.452) -- 0:00:44
      227000 -- (-500.994) (-497.289) (-498.887) [-502.209] * [-499.107] (-498.084) (-503.527) (-498.908) -- 0:00:44
      227500 -- (-500.654) [-497.462] (-497.278) (-498.343) * (-500.623) [-500.767] (-503.684) (-498.292) -- 0:00:44
      228000 -- (-503.829) [-500.674] (-498.652) (-499.442) * [-499.350] (-499.037) (-497.085) (-502.444) -- 0:00:44
      228500 -- [-497.229] (-501.117) (-497.368) (-499.077) * (-497.203) (-498.118) (-501.866) [-500.551] -- 0:00:43
      229000 -- (-497.797) (-499.197) (-497.388) [-497.905] * [-497.347] (-498.076) (-497.808) (-503.789) -- 0:00:43
      229500 -- [-498.429] (-498.804) (-497.512) (-501.136) * (-498.947) (-498.303) [-501.305] (-502.503) -- 0:00:47
      230000 -- (-502.676) [-497.723] (-498.788) (-504.819) * (-497.984) [-499.795] (-498.556) (-501.078) -- 0:00:46

      Average standard deviation of split frequencies: 0.011724

      230500 -- [-498.067] (-497.745) (-497.733) (-500.342) * [-497.352] (-499.202) (-499.046) (-500.753) -- 0:00:46
      231000 -- (-498.860) (-498.396) [-500.196] (-497.574) * (-499.718) (-499.082) [-498.301] (-502.436) -- 0:00:46
      231500 -- [-498.528] (-498.239) (-498.361) (-496.746) * [-499.112] (-501.426) (-499.991) (-497.567) -- 0:00:46
      232000 -- (-499.780) (-497.805) (-501.211) [-496.888] * (-500.152) [-504.746] (-498.499) (-498.731) -- 0:00:46
      232500 -- (-500.147) (-500.097) [-497.522] (-496.974) * (-498.345) (-499.335) (-497.366) [-498.609] -- 0:00:46
      233000 -- [-498.942] (-499.580) (-497.718) (-498.916) * (-498.835) (-498.540) [-497.473] (-499.184) -- 0:00:46
      233500 -- [-498.001] (-499.561) (-500.411) (-498.077) * [-497.449] (-499.542) (-497.258) (-501.235) -- 0:00:45
      234000 -- (-499.738) [-498.908] (-502.269) (-496.993) * (-498.869) (-497.978) [-501.904] (-496.903) -- 0:00:45
      234500 -- [-498.339] (-498.810) (-498.116) (-498.848) * [-499.216] (-500.085) (-500.014) (-498.830) -- 0:00:45
      235000 -- [-499.291] (-496.642) (-499.557) (-499.057) * [-497.939] (-503.975) (-499.498) (-500.175) -- 0:00:45

      Average standard deviation of split frequencies: 0.011354

      235500 -- (-497.831) (-497.580) [-499.232] (-499.232) * [-497.797] (-501.099) (-498.635) (-501.273) -- 0:00:45
      236000 -- (-498.161) (-499.646) (-498.295) [-499.912] * (-500.233) (-500.977) [-498.203] (-499.667) -- 0:00:45
      236500 -- [-501.846] (-497.946) (-501.099) (-498.759) * (-503.024) (-498.794) [-497.635] (-502.242) -- 0:00:45
      237000 -- [-499.825] (-501.553) (-497.858) (-500.166) * (-500.300) (-500.201) [-500.739] (-497.985) -- 0:00:45
      237500 -- (-501.392) [-497.960] (-499.202) (-501.055) * (-503.318) [-497.617] (-500.977) (-498.375) -- 0:00:44
      238000 -- (-497.664) [-498.531] (-503.640) (-498.150) * (-500.496) [-497.883] (-500.368) (-498.261) -- 0:00:44
      238500 -- (-498.174) (-500.167) [-498.002] (-501.016) * (-498.030) [-503.689] (-499.218) (-499.994) -- 0:00:44
      239000 -- [-499.266] (-499.759) (-498.541) (-503.717) * [-502.345] (-501.048) (-497.393) (-497.843) -- 0:00:44
      239500 -- [-498.901] (-498.003) (-499.238) (-498.339) * (-497.592) (-502.638) (-497.083) [-498.840] -- 0:00:44
      240000 -- (-498.795) (-497.196) (-498.384) [-496.902] * (-497.713) (-505.987) [-499.267] (-499.484) -- 0:00:44

      Average standard deviation of split frequencies: 0.012623

      240500 -- (-499.165) (-497.336) (-498.911) [-501.492] * (-498.606) (-499.620) (-497.102) [-499.082] -- 0:00:44
      241000 -- (-497.944) [-498.848] (-500.359) (-500.589) * (-502.290) (-498.913) [-498.452] (-498.773) -- 0:00:44
      241500 -- [-499.373] (-506.078) (-498.873) (-502.246) * (-502.982) (-501.948) (-497.369) [-502.014] -- 0:00:43
      242000 -- (-497.979) [-498.446] (-497.643) (-500.958) * (-501.940) (-499.806) [-499.411] (-500.469) -- 0:00:43
      242500 -- (-497.359) [-497.720] (-502.562) (-498.261) * (-498.595) (-502.016) (-501.513) [-497.684] -- 0:00:43
      243000 -- (-501.709) (-500.633) (-500.448) [-498.372] * (-500.892) (-499.189) [-498.740] (-499.465) -- 0:00:43
      243500 -- (-498.507) (-497.888) [-499.343] (-501.198) * [-498.752] (-500.446) (-498.273) (-497.780) -- 0:00:43
      244000 -- (-498.873) (-497.666) (-498.208) [-501.736] * [-502.758] (-497.381) (-498.441) (-499.979) -- 0:00:43
      244500 -- (-498.215) (-499.609) (-500.430) [-501.942] * (-500.884) [-498.193] (-497.947) (-503.672) -- 0:00:43
      245000 -- (-499.745) [-499.487] (-497.375) (-499.578) * (-497.512) [-498.418] (-497.412) (-499.168) -- 0:00:43

      Average standard deviation of split frequencies: 0.012243

      245500 -- (-498.206) [-498.686] (-500.216) (-502.080) * [-500.458] (-502.400) (-498.308) (-500.643) -- 0:00:43
      246000 -- (-497.590) (-501.547) [-498.565] (-502.658) * (-498.878) [-500.090] (-497.090) (-496.848) -- 0:00:42
      246500 -- (-499.923) [-497.216] (-499.985) (-499.455) * (-499.333) [-503.669] (-499.529) (-500.612) -- 0:00:45
      247000 -- (-500.653) (-499.972) [-503.473] (-499.653) * [-496.956] (-499.562) (-499.764) (-498.796) -- 0:00:45
      247500 -- (-497.705) [-499.136] (-497.226) (-502.584) * (-497.243) [-498.466] (-502.924) (-500.283) -- 0:00:45
      248000 -- (-498.459) (-498.660) (-499.923) [-497.592] * (-503.450) [-500.597] (-497.861) (-499.361) -- 0:00:45
      248500 -- (-500.231) (-499.747) (-498.532) [-497.630] * (-498.473) [-500.009] (-501.259) (-497.200) -- 0:00:45
      249000 -- (-498.378) (-498.983) (-496.909) [-498.555] * (-498.084) [-497.382] (-498.475) (-497.307) -- 0:00:45
      249500 -- [-498.162] (-499.529) (-501.003) (-505.419) * [-502.024] (-498.146) (-497.971) (-498.063) -- 0:00:45
      250000 -- [-497.642] (-497.133) (-501.282) (-501.668) * (-501.561) [-498.841] (-498.316) (-498.114) -- 0:00:45

      Average standard deviation of split frequencies: 0.012500

      250500 -- (-498.746) (-497.754) (-504.959) [-500.264] * (-498.346) (-501.871) [-496.879] (-507.198) -- 0:00:44
      251000 -- (-501.539) (-500.685) (-499.182) [-498.576] * [-497.720] (-499.827) (-498.793) (-498.637) -- 0:00:44
      251500 -- (-508.243) (-499.048) (-499.567) [-499.029] * (-499.685) [-500.003] (-500.851) (-498.846) -- 0:00:44
      252000 -- (-499.529) (-499.864) (-499.912) [-498.146] * (-500.138) (-500.591) (-498.566) [-497.831] -- 0:00:44
      252500 -- (-501.805) (-500.295) (-499.309) [-498.422] * (-501.828) (-497.870) (-497.297) [-499.691] -- 0:00:44
      253000 -- (-497.178) [-499.843] (-496.819) (-496.839) * [-500.703] (-497.228) (-500.101) (-497.639) -- 0:00:44
      253500 -- (-500.604) [-500.522] (-497.926) (-498.090) * [-500.168] (-500.705) (-498.868) (-497.099) -- 0:00:44
      254000 -- [-499.559] (-501.365) (-499.312) (-499.062) * (-503.873) [-497.449] (-497.591) (-497.440) -- 0:00:44
      254500 -- (-502.880) (-500.177) (-501.524) [-499.788] * (-510.167) (-501.529) (-499.622) [-498.124] -- 0:00:43
      255000 -- (-498.385) (-499.730) [-499.377] (-499.055) * (-501.554) (-497.415) (-498.232) [-501.689] -- 0:00:43

      Average standard deviation of split frequencies: 0.012132

      255500 -- [-497.699] (-501.727) (-499.363) (-498.210) * (-500.770) (-500.299) [-497.039] (-502.045) -- 0:00:43
      256000 -- (-497.887) (-497.571) [-499.512] (-498.269) * (-500.943) [-507.594] (-498.532) (-499.413) -- 0:00:43
      256500 -- (-500.078) [-498.894] (-501.113) (-497.760) * (-499.150) [-499.301] (-498.730) (-499.735) -- 0:00:43
      257000 -- (-501.642) (-500.326) (-498.716) [-498.986] * (-499.245) (-498.995) (-499.398) [-499.879] -- 0:00:43
      257500 -- [-497.322] (-500.418) (-498.268) (-498.794) * (-497.101) (-497.457) (-498.827) [-500.667] -- 0:00:43
      258000 -- (-498.476) (-502.848) (-497.397) [-497.256] * (-497.353) (-498.282) [-497.500] (-500.625) -- 0:00:43
      258500 -- (-500.610) (-504.533) [-498.921] (-497.502) * (-499.407) (-497.737) [-497.579] (-503.236) -- 0:00:43
      259000 -- (-498.419) [-499.468] (-500.438) (-498.174) * (-501.153) [-498.933] (-500.756) (-506.518) -- 0:00:42
      259500 -- [-497.836] (-497.928) (-499.096) (-503.964) * (-498.636) (-499.842) [-499.496] (-499.417) -- 0:00:42
      260000 -- (-498.562) [-499.968] (-504.309) (-499.525) * (-498.297) (-501.581) (-500.241) [-500.842] -- 0:00:42

      Average standard deviation of split frequencies: 0.013191

      260500 -- [-501.854] (-500.976) (-500.525) (-501.120) * [-500.707] (-502.402) (-501.427) (-500.174) -- 0:00:42
      261000 -- (-499.660) [-498.753] (-499.036) (-499.384) * (-499.289) (-497.241) (-499.247) [-500.698] -- 0:00:42
      261500 -- (-499.015) [-504.950] (-498.414) (-498.135) * [-502.296] (-500.954) (-501.369) (-499.015) -- 0:00:42
      262000 -- [-500.212] (-499.442) (-499.871) (-497.937) * (-498.285) (-497.438) (-499.955) [-499.203] -- 0:00:42
      262500 -- (-500.353) (-497.381) [-500.283] (-501.226) * (-498.163) [-497.185] (-497.436) (-499.787) -- 0:00:42
      263000 -- (-501.099) (-497.975) [-498.901] (-501.332) * (-501.237) [-497.679] (-499.223) (-497.420) -- 0:00:42
      263500 -- (-499.360) [-497.573] (-501.763) (-500.369) * (-499.679) (-498.204) (-497.876) [-498.693] -- 0:00:44
      264000 -- (-502.214) [-498.446] (-499.692) (-503.072) * (-498.106) (-499.834) [-498.091] (-500.239) -- 0:00:44
      264500 -- (-498.035) (-501.052) (-503.221) [-501.930] * (-498.275) (-498.874) [-499.000] (-498.198) -- 0:00:44
      265000 -- (-501.970) [-498.122] (-501.709) (-499.079) * [-499.010] (-499.847) (-497.540) (-498.429) -- 0:00:44

      Average standard deviation of split frequencies: 0.012718

      265500 -- (-500.111) (-502.858) (-498.634) [-497.088] * (-498.514) (-501.390) [-500.563] (-498.243) -- 0:00:44
      266000 -- (-499.722) (-498.288) (-497.275) [-497.773] * (-500.374) [-499.424] (-497.445) (-500.540) -- 0:00:44
      266500 -- (-504.729) (-499.181) [-498.075] (-498.531) * (-500.232) [-498.964] (-500.539) (-496.998) -- 0:00:44
      267000 -- (-502.803) (-502.515) (-501.285) [-500.827] * (-499.342) (-500.735) (-500.101) [-500.029] -- 0:00:43
      267500 -- [-500.451] (-506.496) (-498.521) (-500.309) * (-498.802) (-502.413) [-500.169] (-499.412) -- 0:00:43
      268000 -- (-498.829) [-497.015] (-498.707) (-501.202) * (-498.489) (-499.676) (-498.190) [-502.516] -- 0:00:43
      268500 -- (-500.054) (-498.938) (-498.777) [-498.333] * (-502.079) [-499.004] (-497.977) (-497.691) -- 0:00:43
      269000 -- (-497.243) [-499.920] (-500.967) (-498.109) * (-500.146) (-499.646) [-498.635] (-498.043) -- 0:00:43
      269500 -- (-500.643) (-502.167) [-504.953] (-498.794) * [-497.165] (-498.722) (-499.387) (-498.708) -- 0:00:43
      270000 -- [-499.717] (-504.157) (-500.653) (-504.737) * (-498.427) [-498.085] (-499.182) (-497.220) -- 0:00:43

      Average standard deviation of split frequencies: 0.012089

      270500 -- (-498.871) [-496.870] (-501.079) (-501.438) * (-498.651) (-497.534) [-500.645] (-500.465) -- 0:00:43
      271000 -- (-497.321) (-496.812) (-500.835) [-499.036] * (-499.998) (-497.420) [-501.747] (-497.863) -- 0:00:43
      271500 -- (-498.783) [-499.353] (-505.893) (-497.204) * [-498.275] (-498.582) (-500.497) (-500.345) -- 0:00:42
      272000 -- (-499.244) (-499.997) (-498.806) [-497.401] * (-501.073) [-502.085] (-498.009) (-500.271) -- 0:00:42
      272500 -- [-497.662] (-500.270) (-499.340) (-500.554) * (-499.638) (-497.890) [-499.028] (-498.151) -- 0:00:42
      273000 -- (-497.297) (-497.404) [-500.619] (-501.153) * (-503.025) [-498.063] (-496.695) (-498.495) -- 0:00:42
      273500 -- [-498.525] (-497.818) (-497.820) (-501.660) * (-504.622) [-497.877] (-497.717) (-497.436) -- 0:00:42
      274000 -- (-498.114) [-498.145] (-498.897) (-498.557) * (-499.550) (-497.655) [-500.875] (-498.273) -- 0:00:42
      274500 -- [-498.114] (-497.423) (-501.583) (-498.649) * (-500.630) (-498.130) [-498.250] (-499.672) -- 0:00:42
      275000 -- (-500.350) (-500.844) [-499.027] (-499.638) * [-499.066] (-497.488) (-497.517) (-498.717) -- 0:00:42

      Average standard deviation of split frequencies: 0.012157

      275500 -- (-498.504) (-505.344) [-497.556] (-501.716) * (-499.674) (-502.180) [-500.413] (-499.104) -- 0:00:42
      276000 -- (-504.775) [-501.293] (-499.192) (-499.102) * (-497.968) (-498.455) (-498.001) [-497.509] -- 0:00:41
      276500 -- (-501.331) (-501.986) (-500.322) [-498.612] * (-502.092) (-496.865) [-500.587] (-497.766) -- 0:00:41
      277000 -- (-502.175) (-499.255) (-501.253) [-496.907] * (-499.720) [-497.929] (-498.860) (-500.324) -- 0:00:41
      277500 -- (-496.753) [-499.706] (-499.768) (-497.634) * (-497.581) [-499.336] (-502.210) (-498.626) -- 0:00:41
      278000 -- (-497.620) [-499.007] (-503.119) (-499.182) * (-499.799) [-498.996] (-498.717) (-499.959) -- 0:00:41
      278500 -- (-499.832) (-499.449) [-499.111] (-497.885) * (-497.464) (-496.817) (-503.246) [-501.156] -- 0:00:41
      279000 -- (-500.279) [-501.521] (-496.950) (-497.346) * [-499.770] (-496.909) (-500.321) (-502.775) -- 0:00:41
      279500 -- [-497.931] (-498.526) (-503.256) (-497.684) * (-500.002) [-497.151] (-498.340) (-505.031) -- 0:00:43
      280000 -- (-497.806) (-497.289) [-499.809] (-496.839) * (-499.545) [-497.738] (-499.500) (-497.869) -- 0:00:43

      Average standard deviation of split frequencies: 0.012745

      280500 -- (-498.846) [-496.881] (-497.436) (-498.463) * (-497.829) (-498.712) [-500.358] (-498.743) -- 0:00:43
      281000 -- (-500.237) (-501.113) [-497.950] (-501.068) * (-499.305) [-498.231] (-499.572) (-498.768) -- 0:00:43
      281500 -- (-497.293) (-498.767) (-498.648) [-497.223] * [-499.800] (-501.468) (-499.214) (-501.386) -- 0:00:43
      282000 -- (-497.647) [-498.747] (-499.388) (-508.280) * (-501.365) (-499.631) (-497.434) [-498.258] -- 0:00:43
      282500 -- [-499.824] (-499.119) (-500.674) (-503.200) * (-499.839) (-498.077) (-498.769) [-498.869] -- 0:00:43
      283000 -- (-499.261) [-499.865] (-500.706) (-500.490) * [-497.474] (-501.525) (-499.381) (-497.602) -- 0:00:43
      283500 -- [-498.150] (-498.796) (-506.587) (-498.946) * (-497.910) [-498.362] (-498.041) (-500.794) -- 0:00:42
      284000 -- [-500.421] (-497.716) (-499.248) (-500.887) * (-498.331) [-497.885] (-499.938) (-498.643) -- 0:00:42
      284500 -- [-500.293] (-497.978) (-499.122) (-498.717) * (-499.114) [-499.015] (-497.139) (-499.028) -- 0:00:42
      285000 -- [-497.699] (-498.319) (-500.346) (-501.341) * (-501.111) [-498.194] (-500.513) (-498.382) -- 0:00:42

      Average standard deviation of split frequencies: 0.012604

      285500 -- (-498.546) (-502.333) (-501.395) [-497.223] * (-503.444) [-499.519] (-501.638) (-502.126) -- 0:00:42
      286000 -- (-497.551) [-498.110] (-500.289) (-501.667) * (-500.438) (-499.487) [-498.150] (-499.352) -- 0:00:42
      286500 -- (-499.232) [-497.901] (-498.227) (-500.457) * [-497.792] (-499.346) (-499.912) (-498.923) -- 0:00:42
      287000 -- (-499.271) (-498.235) [-498.210] (-499.467) * (-501.048) (-497.817) [-497.914] (-501.306) -- 0:00:42
      287500 -- (-498.379) [-501.074] (-502.778) (-501.098) * (-498.786) (-497.669) (-498.180) [-499.774] -- 0:00:42
      288000 -- (-499.043) (-498.509) (-502.269) [-498.140] * [-499.370] (-501.665) (-498.045) (-499.066) -- 0:00:42
      288500 -- [-499.231] (-500.979) (-498.263) (-498.815) * [-498.908] (-500.674) (-499.067) (-500.719) -- 0:00:41
      289000 -- (-497.997) [-500.901] (-499.460) (-500.086) * [-499.493] (-497.737) (-498.935) (-500.484) -- 0:00:41
      289500 -- (-500.211) (-501.818) (-500.435) [-498.411] * (-501.846) (-498.396) (-499.538) [-499.184] -- 0:00:41
      290000 -- (-498.466) (-497.413) [-500.493] (-497.659) * [-498.313] (-498.296) (-503.688) (-497.227) -- 0:00:41

      Average standard deviation of split frequencies: 0.012974

      290500 -- (-500.711) [-497.867] (-498.149) (-497.244) * (-498.872) (-499.007) (-497.072) [-497.671] -- 0:00:41
      291000 -- [-499.658] (-498.217) (-498.115) (-498.207) * (-498.819) (-500.626) (-497.635) [-497.646] -- 0:00:41
      291500 -- [-496.923] (-498.695) (-497.173) (-503.511) * (-497.879) (-499.609) [-497.978] (-497.435) -- 0:00:41
      292000 -- [-497.864] (-498.707) (-497.611) (-499.288) * (-498.305) [-501.142] (-498.772) (-497.984) -- 0:00:41
      292500 -- (-497.532) (-499.014) [-498.597] (-498.758) * (-498.624) [-498.107] (-499.479) (-497.698) -- 0:00:41
      293000 -- (-497.117) (-497.537) [-498.608] (-498.889) * (-503.096) [-499.219] (-499.532) (-497.455) -- 0:00:41
      293500 -- (-496.758) (-499.659) [-498.907] (-499.056) * (-501.050) (-499.661) [-498.427] (-500.567) -- 0:00:40
      294000 -- [-497.319] (-503.393) (-502.307) (-498.972) * [-497.864] (-498.255) (-496.976) (-498.740) -- 0:00:40
      294500 -- (-497.171) [-497.024] (-500.112) (-497.567) * (-497.476) (-499.404) (-501.114) [-498.359] -- 0:00:40
      295000 -- (-497.792) [-497.356] (-499.238) (-500.286) * (-499.283) [-498.846] (-499.606) (-497.236) -- 0:00:40

      Average standard deviation of split frequencies: 0.011856

      295500 -- (-499.243) (-497.912) [-497.409] (-499.070) * [-499.669] (-503.022) (-497.849) (-497.966) -- 0:00:40
      296000 -- (-498.489) (-498.422) (-504.625) [-498.919] * [-497.979] (-501.443) (-499.057) (-498.789) -- 0:00:40
      296500 -- (-498.087) (-499.080) (-500.834) [-498.768] * (-501.625) (-498.215) [-498.567] (-497.659) -- 0:00:40
      297000 -- (-499.162) (-499.595) [-501.132] (-499.661) * [-501.573] (-499.441) (-498.919) (-502.393) -- 0:00:42
      297500 -- (-500.283) [-500.405] (-497.911) (-498.249) * (-498.169) [-499.313] (-498.224) (-500.854) -- 0:00:42
      298000 -- (-501.710) (-498.291) (-498.334) [-497.396] * (-500.695) (-498.642) (-497.470) [-499.004] -- 0:00:42
      298500 -- [-497.546] (-498.077) (-498.783) (-498.336) * (-498.898) [-497.568] (-501.209) (-501.071) -- 0:00:42
      299000 -- (-497.224) (-498.519) (-498.835) [-497.214] * [-498.732] (-501.343) (-499.750) (-500.908) -- 0:00:42
      299500 -- (-500.169) (-498.036) (-498.221) [-499.903] * (-499.596) (-498.747) (-503.374) [-501.585] -- 0:00:42
      300000 -- (-500.762) [-500.696] (-501.798) (-501.896) * (-497.209) [-498.071] (-497.276) (-498.874) -- 0:00:42

      Average standard deviation of split frequencies: 0.011933

      300500 -- (-497.480) [-497.483] (-505.514) (-499.733) * (-497.547) (-498.916) (-499.647) [-500.166] -- 0:00:41
      301000 -- [-497.319] (-498.764) (-500.406) (-498.496) * (-498.374) (-498.176) [-499.776] (-502.750) -- 0:00:41
      301500 -- [-498.230] (-501.460) (-498.634) (-498.533) * [-499.246] (-499.657) (-500.725) (-499.992) -- 0:00:41
      302000 -- (-497.657) (-501.464) (-499.397) [-499.275] * (-500.921) [-501.220] (-502.539) (-509.727) -- 0:00:41
      302500 -- (-498.390) (-497.551) (-503.790) [-508.539] * [-504.293] (-502.639) (-501.022) (-502.666) -- 0:00:41
      303000 -- (-500.874) [-499.424] (-498.950) (-498.605) * (-503.062) (-502.942) (-498.612) [-499.072] -- 0:00:41
      303500 -- (-499.241) (-497.649) [-499.450] (-497.866) * (-502.599) (-498.758) (-500.127) [-499.179] -- 0:00:41
      304000 -- (-499.152) (-502.372) (-497.561) [-500.073] * (-504.869) [-497.920] (-506.164) (-500.942) -- 0:00:41
      304500 -- (-500.449) (-503.896) (-500.438) [-497.438] * (-504.094) (-499.966) (-501.083) [-497.910] -- 0:00:41
      305000 -- [-498.417] (-502.390) (-498.596) (-500.215) * [-498.367] (-506.294) (-498.155) (-499.094) -- 0:00:41

      Average standard deviation of split frequencies: 0.011468

      305500 -- [-498.921] (-498.221) (-498.004) (-499.511) * (-497.384) (-498.208) [-499.112] (-497.688) -- 0:00:40
      306000 -- (-499.588) (-497.891) [-497.225] (-497.013) * (-496.793) (-497.132) (-497.516) [-498.099] -- 0:00:40
      306500 -- [-498.859] (-498.148) (-500.923) (-499.190) * (-498.623) [-497.532] (-498.476) (-500.491) -- 0:00:40
      307000 -- (-499.592) (-498.461) [-500.552] (-497.832) * (-500.670) [-498.224] (-498.476) (-498.061) -- 0:00:40
      307500 -- (-500.942) [-499.310] (-501.196) (-497.912) * (-502.784) [-498.025] (-498.897) (-497.828) -- 0:00:40
      308000 -- (-499.149) [-498.545] (-499.026) (-497.607) * [-497.725] (-501.465) (-498.084) (-498.765) -- 0:00:40
      308500 -- (-498.382) [-498.578] (-498.917) (-502.608) * (-500.593) (-499.860) [-498.626] (-497.553) -- 0:00:40
      309000 -- (-501.217) (-498.976) [-499.834] (-501.515) * (-498.561) [-497.723] (-497.436) (-500.573) -- 0:00:40
      309500 -- [-498.192] (-498.928) (-499.753) (-498.507) * (-501.262) [-499.087] (-497.836) (-499.245) -- 0:00:40
      310000 -- (-499.351) (-498.773) [-499.019] (-502.027) * (-501.003) (-499.743) [-498.140] (-497.656) -- 0:00:40

      Average standard deviation of split frequencies: 0.012059

      310500 -- (-498.314) (-503.492) (-499.200) [-499.841] * (-497.809) (-499.948) (-500.180) [-499.035] -- 0:00:39
      311000 -- (-497.135) [-499.765] (-497.679) (-499.064) * [-498.595] (-498.170) (-499.867) (-498.611) -- 0:00:39
      311500 -- (-497.784) (-499.298) (-503.524) [-498.874] * [-497.712] (-496.849) (-501.247) (-499.417) -- 0:00:39
      312000 -- (-497.802) (-502.642) [-497.241] (-497.817) * [-498.827] (-499.391) (-500.128) (-503.320) -- 0:00:39
      312500 -- (-498.934) (-501.651) (-501.013) [-499.219] * (-498.854) [-498.573] (-497.988) (-501.965) -- 0:00:39
      313000 -- (-497.781) [-500.929] (-499.425) (-498.922) * (-498.908) [-498.980] (-500.404) (-497.269) -- 0:00:39
      313500 -- (-498.674) [-500.324] (-505.361) (-498.049) * (-500.531) (-499.008) (-499.221) [-497.570] -- 0:00:41
      314000 -- [-501.663] (-498.581) (-498.137) (-504.301) * (-498.273) (-497.228) (-502.095) [-498.733] -- 0:00:41
      314500 -- (-499.434) (-499.325) (-503.018) [-498.654] * (-500.441) [-496.994] (-498.737) (-502.381) -- 0:00:41
      315000 -- (-499.343) (-498.813) (-497.131) [-497.452] * [-499.456] (-498.319) (-501.179) (-501.088) -- 0:00:41

      Average standard deviation of split frequencies: 0.013177

      315500 -- (-498.172) (-500.087) (-499.440) [-498.295] * (-497.316) [-498.933] (-499.024) (-501.287) -- 0:00:41
      316000 -- (-498.931) (-499.101) (-499.974) [-498.710] * (-499.665) (-498.112) (-501.581) [-497.650] -- 0:00:41
      316500 -- [-498.948] (-498.633) (-497.769) (-508.466) * (-498.355) (-500.091) [-499.362] (-498.205) -- 0:00:41
      317000 -- (-500.775) [-498.555] (-498.318) (-502.994) * (-498.877) (-502.225) [-501.116] (-499.509) -- 0:00:40
      317500 -- [-500.810] (-498.332) (-496.881) (-500.308) * [-497.448] (-501.333) (-497.455) (-499.350) -- 0:00:40
      318000 -- (-502.436) (-498.683) (-502.202) [-499.242] * (-498.371) (-498.285) (-498.502) [-498.916] -- 0:00:40
      318500 -- [-498.897] (-497.580) (-504.216) (-504.511) * (-503.900) [-498.038] (-498.057) (-500.085) -- 0:00:40
      319000 -- [-498.534] (-497.664) (-500.084) (-501.471) * (-502.466) (-502.687) [-497.505] (-499.762) -- 0:00:40
      319500 -- (-499.390) (-500.568) (-499.517) [-497.477] * (-507.326) [-497.185] (-497.309) (-499.617) -- 0:00:40
      320000 -- (-496.871) (-503.803) (-498.747) [-498.650] * (-501.429) (-499.641) (-500.567) [-498.576] -- 0:00:40

      Average standard deviation of split frequencies: 0.013802

      320500 -- (-498.539) (-498.529) (-498.958) [-497.540] * (-497.926) (-499.803) (-499.373) [-499.289] -- 0:00:40
      321000 -- (-498.412) [-497.906] (-504.219) (-496.887) * (-500.982) (-497.211) (-498.337) [-498.756] -- 0:00:40
      321500 -- [-500.146] (-497.538) (-500.172) (-497.409) * (-498.220) (-498.682) [-498.364] (-497.026) -- 0:00:40
      322000 -- [-498.462] (-497.255) (-497.559) (-497.833) * [-498.240] (-497.772) (-500.277) (-497.574) -- 0:00:40
      322500 -- (-500.167) (-499.337) (-498.306) [-498.676] * (-498.899) (-498.149) (-498.231) [-499.145] -- 0:00:39
      323000 -- (-502.762) (-499.736) [-497.357] (-498.053) * (-498.065) (-499.030) [-497.330] (-500.814) -- 0:00:39
      323500 -- (-499.871) (-499.936) [-497.141] (-497.752) * [-499.730] (-500.655) (-498.076) (-498.631) -- 0:00:39
      324000 -- [-498.640] (-500.878) (-497.761) (-498.061) * (-500.564) [-497.695] (-496.942) (-500.533) -- 0:00:39
      324500 -- (-502.292) [-500.526] (-499.516) (-499.587) * (-499.347) [-497.222] (-498.791) (-499.586) -- 0:00:39
      325000 -- (-498.547) [-498.205] (-497.240) (-499.576) * (-499.711) [-498.315] (-500.537) (-502.281) -- 0:00:39

      Average standard deviation of split frequencies: 0.013243

      325500 -- [-497.699] (-500.112) (-497.744) (-502.075) * (-499.229) [-502.247] (-503.946) (-498.292) -- 0:00:39
      326000 -- (-498.479) (-504.388) [-499.880] (-498.864) * (-497.230) (-499.731) [-500.243] (-497.521) -- 0:00:39
      326500 -- (-499.534) (-500.705) [-497.877] (-500.129) * [-500.792] (-497.495) (-505.845) (-498.410) -- 0:00:39
      327000 -- (-496.895) (-499.262) (-496.772) [-498.755] * (-498.289) [-497.672] (-499.250) (-511.738) -- 0:00:39
      327500 -- (-502.183) (-500.361) (-498.469) [-497.101] * (-499.687) (-502.299) (-500.139) [-498.099] -- 0:00:39
      328000 -- [-496.980] (-499.454) (-498.646) (-499.212) * [-501.483] (-499.711) (-501.298) (-497.222) -- 0:00:38
      328500 -- (-497.918) [-501.507] (-497.931) (-499.080) * [-499.045] (-499.197) (-500.880) (-498.456) -- 0:00:38
      329000 -- (-500.293) (-500.036) [-497.405] (-498.082) * (-503.498) (-500.037) (-502.698) [-500.754] -- 0:00:40
      329500 -- [-500.765] (-498.106) (-499.159) (-504.550) * (-500.369) (-500.010) (-497.682) [-497.396] -- 0:00:40
      330000 -- (-504.877) (-500.486) (-499.590) [-498.614] * (-502.669) (-497.222) [-498.584] (-497.458) -- 0:00:40

      Average standard deviation of split frequencies: 0.013281

      330500 -- [-497.653] (-497.472) (-499.608) (-499.642) * (-498.574) (-497.113) (-498.502) [-501.926] -- 0:00:40
      331000 -- [-498.528] (-500.937) (-498.628) (-498.401) * (-497.327) (-497.659) [-498.906] (-502.504) -- 0:00:40
      331500 -- (-498.889) (-500.071) (-498.334) [-499.719] * (-502.090) (-499.222) [-498.058] (-503.966) -- 0:00:40
      332000 -- (-501.611) (-499.490) [-497.964] (-498.640) * (-498.088) [-498.198] (-499.070) (-499.507) -- 0:00:40
      332500 -- (-497.705) [-497.614] (-498.603) (-498.213) * (-498.534) (-497.895) (-500.248) [-499.501] -- 0:00:40
      333000 -- (-497.559) (-501.366) (-498.190) [-498.458] * [-499.417] (-498.104) (-501.503) (-497.728) -- 0:00:40
      333500 -- (-497.955) [-503.609] (-502.359) (-497.040) * [-499.534] (-499.151) (-498.379) (-499.962) -- 0:00:39
      334000 -- (-498.059) (-506.482) (-505.551) [-497.389] * [-498.426] (-500.580) (-501.291) (-499.856) -- 0:00:39
      334500 -- (-498.776) [-497.659] (-498.095) (-499.549) * (-498.378) (-500.169) (-498.422) [-498.471] -- 0:00:39
      335000 -- [-498.955] (-499.107) (-498.576) (-501.838) * [-499.002] (-499.189) (-501.189) (-501.342) -- 0:00:39

      Average standard deviation of split frequencies: 0.013513

      335500 -- (-497.558) (-498.649) [-498.115] (-498.871) * (-498.133) [-502.037] (-497.162) (-501.940) -- 0:00:39
      336000 -- [-499.735] (-498.370) (-502.584) (-497.980) * (-498.657) (-497.401) [-496.992] (-499.656) -- 0:00:39
      336500 -- [-500.288] (-500.756) (-501.091) (-497.898) * [-498.314] (-497.192) (-498.159) (-498.092) -- 0:00:39
      337000 -- (-499.008) (-503.925) [-499.924] (-500.934) * (-498.529) [-500.629] (-497.441) (-501.371) -- 0:00:39
      337500 -- (-499.811) (-500.235) [-499.262] (-498.055) * (-499.612) (-500.470) (-500.171) [-499.416] -- 0:00:39
      338000 -- (-500.010) (-500.236) (-499.670) [-502.010] * [-498.766] (-501.803) (-500.389) (-498.107) -- 0:00:39
      338500 -- (-501.723) [-498.442] (-500.627) (-500.862) * (-499.075) (-501.353) (-500.147) [-501.476] -- 0:00:39
      339000 -- (-499.261) [-497.896] (-501.346) (-499.304) * (-498.689) (-498.144) (-497.638) [-499.104] -- 0:00:38
      339500 -- (-499.693) (-499.564) [-498.239] (-496.824) * (-497.645) [-502.382] (-498.278) (-499.277) -- 0:00:38
      340000 -- (-497.723) (-500.823) [-498.086] (-498.202) * (-498.033) (-499.038) (-497.260) [-500.211] -- 0:00:38

      Average standard deviation of split frequencies: 0.012381

      340500 -- (-499.581) [-496.794] (-498.984) (-497.507) * (-503.472) [-498.253] (-500.971) (-499.052) -- 0:00:38
      341000 -- (-498.915) (-497.209) [-498.866] (-497.505) * (-497.349) [-499.439] (-499.468) (-497.720) -- 0:00:38
      341500 -- [-497.673] (-500.170) (-501.395) (-502.360) * (-499.317) (-498.598) (-497.944) [-497.551] -- 0:00:38
      342000 -- [-498.017] (-502.480) (-500.487) (-500.563) * (-500.116) (-499.876) [-497.179] (-497.565) -- 0:00:38
      342500 -- (-498.139) (-500.313) (-497.832) [-497.959] * (-497.147) [-502.069] (-497.348) (-497.538) -- 0:00:38
      343000 -- [-500.403] (-499.186) (-498.967) (-499.510) * (-498.322) (-498.003) [-497.402] (-499.550) -- 0:00:38
      343500 -- (-498.806) [-497.888] (-498.680) (-497.289) * [-501.185] (-498.036) (-497.950) (-498.525) -- 0:00:38
      344000 -- (-503.874) (-497.430) (-500.396) [-510.016] * (-501.615) [-501.803] (-501.716) (-498.858) -- 0:00:40
      344500 -- [-499.244] (-497.940) (-502.085) (-500.724) * (-500.709) (-496.686) (-499.650) [-498.678] -- 0:00:39
      345000 -- (-497.429) (-497.331) (-502.099) [-499.544] * (-497.689) (-497.759) (-501.014) [-498.841] -- 0:00:39

      Average standard deviation of split frequencies: 0.011975

      345500 -- (-498.774) (-500.016) [-500.334] (-499.653) * (-498.831) (-499.295) [-500.358] (-502.623) -- 0:00:39
      346000 -- (-498.076) [-497.357] (-501.740) (-500.588) * (-501.376) (-498.838) (-497.553) [-497.660] -- 0:00:39
      346500 -- (-497.998) (-497.708) (-502.338) [-500.480] * (-500.450) [-498.071] (-498.741) (-505.223) -- 0:00:39
      347000 -- (-498.897) (-502.927) [-499.318] (-500.449) * (-500.447) (-499.143) [-498.016] (-499.087) -- 0:00:39
      347500 -- (-501.781) [-498.610] (-498.928) (-499.582) * (-500.722) (-500.387) (-501.709) [-497.038] -- 0:00:39
      348000 -- (-498.894) (-498.555) (-501.192) [-498.244] * [-496.910] (-498.227) (-500.362) (-500.627) -- 0:00:39
      348500 -- (-499.528) (-499.589) (-497.127) [-500.295] * [-497.982] (-498.782) (-499.205) (-498.752) -- 0:00:39
      349000 -- (-498.910) [-499.591] (-499.635) (-499.163) * (-499.721) [-498.578] (-497.418) (-499.081) -- 0:00:39
      349500 -- [-498.795] (-500.748) (-501.362) (-498.688) * [-498.176] (-499.811) (-497.663) (-497.334) -- 0:00:39
      350000 -- (-500.088) [-500.857] (-499.371) (-500.376) * (-501.077) (-500.344) (-498.851) [-497.043] -- 0:00:39

      Average standard deviation of split frequencies: 0.011277

      350500 -- (-496.975) (-499.661) [-497.034] (-497.557) * (-498.531) [-499.380] (-497.936) (-497.615) -- 0:00:38
      351000 -- (-500.042) (-501.430) [-497.434] (-502.826) * (-498.438) [-499.599] (-502.657) (-497.413) -- 0:00:38
      351500 -- (-499.970) (-500.497) [-496.900] (-498.746) * (-498.699) (-498.449) [-497.031] (-498.415) -- 0:00:38
      352000 -- (-504.005) (-501.134) [-500.733] (-498.102) * [-499.222] (-499.077) (-504.690) (-497.822) -- 0:00:38
      352500 -- (-502.997) [-498.930] (-500.184) (-497.752) * (-500.183) [-499.354] (-499.311) (-497.534) -- 0:00:38
      353000 -- (-497.618) [-499.807] (-500.509) (-503.116) * (-498.686) (-499.422) (-497.525) [-497.403] -- 0:00:38
      353500 -- (-497.592) (-500.761) [-497.684] (-498.908) * [-498.072] (-499.712) (-499.123) (-498.886) -- 0:00:38
      354000 -- [-500.155] (-507.890) (-497.220) (-498.470) * (-498.424) (-499.476) (-498.875) [-498.489] -- 0:00:38
      354500 -- (-503.552) (-498.925) (-497.992) [-499.137] * [-501.015] (-505.271) (-500.222) (-497.707) -- 0:00:38
      355000 -- (-498.152) [-499.043] (-497.901) (-498.128) * (-499.031) (-501.594) [-500.116] (-498.219) -- 0:00:38

      Average standard deviation of split frequencies: 0.010593

      355500 -- [-499.360] (-498.020) (-502.169) (-499.852) * (-498.750) (-499.507) (-499.277) [-497.179] -- 0:00:38
      356000 -- (-500.690) [-498.008] (-497.781) (-499.161) * (-500.118) (-501.989) (-498.873) [-498.987] -- 0:00:37
      356500 -- (-500.298) [-498.084] (-497.715) (-499.264) * (-498.223) (-498.540) (-502.833) [-499.223] -- 0:00:37
      357000 -- (-501.688) (-497.277) [-498.695] (-498.524) * (-503.017) [-496.868] (-505.843) (-500.859) -- 0:00:37
      357500 -- (-500.109) [-499.749] (-497.948) (-496.935) * (-499.835) [-500.252] (-499.529) (-499.475) -- 0:00:37
      358000 -- [-501.198] (-498.099) (-500.947) (-499.242) * (-497.724) (-499.958) (-502.007) [-499.690] -- 0:00:37
      358500 -- (-499.004) (-498.683) (-500.385) [-498.263] * (-497.931) [-501.861] (-500.606) (-496.819) -- 0:00:37
      359000 -- (-506.661) (-500.421) [-498.433] (-499.511) * (-497.512) (-500.408) (-500.325) [-498.510] -- 0:00:37
      359500 -- (-499.086) (-499.431) [-501.453] (-500.841) * (-500.192) (-501.317) (-498.368) [-500.931] -- 0:00:39
      360000 -- (-498.462) (-498.185) [-499.790] (-499.267) * [-499.377] (-500.864) (-498.942) (-497.416) -- 0:00:39

      Average standard deviation of split frequencies: 0.009730

      360500 -- (-497.622) (-501.309) [-497.661] (-500.072) * [-501.147] (-499.178) (-500.158) (-498.668) -- 0:00:39
      361000 -- (-497.255) (-500.225) (-503.901) [-499.529] * (-500.975) (-500.473) (-500.541) [-498.104] -- 0:00:38
      361500 -- (-499.070) [-498.537] (-500.288) (-505.037) * (-500.612) (-499.409) [-498.145] (-498.968) -- 0:00:38
      362000 -- (-500.152) (-502.911) [-498.130] (-499.408) * (-499.361) (-502.902) (-498.636) [-498.693] -- 0:00:38
      362500 -- (-499.301) (-499.839) (-497.302) [-497.810] * [-497.465] (-499.404) (-499.317) (-500.983) -- 0:00:38
      363000 -- (-499.278) (-501.405) [-497.599] (-497.881) * [-497.546] (-499.030) (-498.653) (-497.139) -- 0:00:38
      363500 -- (-498.292) (-501.484) (-502.312) [-497.623] * [-497.314] (-500.701) (-498.786) (-497.279) -- 0:00:38
      364000 -- (-500.069) [-500.178] (-502.087) (-499.584) * (-498.440) (-500.555) [-497.353] (-499.861) -- 0:00:38
      364500 -- (-498.072) (-498.938) (-504.125) [-502.154] * (-501.177) (-500.986) [-497.419] (-499.053) -- 0:00:38
      365000 -- (-501.367) [-499.058] (-497.383) (-502.840) * (-498.204) (-498.857) [-501.150] (-497.244) -- 0:00:38

      Average standard deviation of split frequencies: 0.010304

      365500 -- (-501.035) [-500.145] (-497.927) (-496.992) * (-498.091) [-501.486] (-500.642) (-497.914) -- 0:00:38
      366000 -- [-497.402] (-499.300) (-502.163) (-497.931) * (-498.027) (-499.085) [-497.577] (-497.329) -- 0:00:38
      366500 -- [-498.348] (-498.048) (-501.910) (-498.861) * (-499.350) (-499.179) [-497.734] (-498.996) -- 0:00:38
      367000 -- (-500.148) (-498.608) (-497.520) [-499.194] * [-499.650] (-502.367) (-502.502) (-497.314) -- 0:00:37
      367500 -- (-499.678) (-500.504) [-498.841] (-498.990) * [-498.167] (-502.285) (-499.194) (-498.143) -- 0:00:37
      368000 -- [-497.826] (-499.777) (-497.483) (-502.642) * (-501.335) (-498.475) (-503.645) [-497.164] -- 0:00:37
      368500 -- (-497.480) [-504.139] (-502.983) (-502.028) * (-500.202) (-500.781) (-497.425) [-497.447] -- 0:00:37
      369000 -- (-498.324) (-499.559) [-499.679] (-498.786) * (-501.059) [-501.060] (-497.728) (-496.958) -- 0:00:37
      369500 -- (-499.970) [-497.718] (-500.465) (-500.387) * [-500.629] (-501.120) (-498.496) (-498.789) -- 0:00:37
      370000 -- [-501.127] (-501.695) (-499.732) (-499.115) * [-500.833] (-500.768) (-498.361) (-498.419) -- 0:00:37

      Average standard deviation of split frequencies: 0.009397

      370500 -- (-499.442) (-498.933) [-499.665] (-498.653) * (-506.697) (-498.547) [-498.076] (-499.055) -- 0:00:37
      371000 -- (-500.551) (-500.198) (-503.602) [-497.750] * (-498.065) [-497.641] (-497.768) (-499.120) -- 0:00:37
      371500 -- [-502.331] (-499.228) (-497.559) (-501.662) * (-498.333) [-497.611] (-503.849) (-498.375) -- 0:00:37
      372000 -- [-501.056] (-498.778) (-500.990) (-500.850) * [-502.122] (-501.058) (-500.340) (-502.681) -- 0:00:37
      372500 -- (-500.083) [-499.011] (-506.220) (-500.485) * (-501.144) (-498.579) (-499.620) [-497.599] -- 0:00:37
      373000 -- (-499.120) (-500.535) (-503.054) [-497.951] * [-497.698] (-498.437) (-499.806) (-499.063) -- 0:00:36
      373500 -- (-499.704) (-503.317) [-500.783] (-498.281) * (-501.699) (-498.303) [-497.454] (-501.960) -- 0:00:36
      374000 -- (-499.319) (-500.653) [-499.874] (-499.680) * (-502.147) (-497.400) (-498.433) [-498.029] -- 0:00:36
      374500 -- (-499.941) (-498.812) (-498.550) [-497.453] * (-503.216) [-497.695] (-501.243) (-497.860) -- 0:00:36
      375000 -- (-500.161) (-497.697) (-500.270) [-500.232] * (-498.914) (-499.066) (-498.151) [-498.311] -- 0:00:36

      Average standard deviation of split frequencies: 0.009612

      375500 -- (-496.999) (-500.304) (-498.362) [-499.219] * (-497.122) (-502.257) (-500.103) [-498.942] -- 0:00:38
      376000 -- (-497.815) [-497.035] (-497.406) (-500.055) * (-497.500) (-498.564) (-499.457) [-499.138] -- 0:00:38
      376500 -- [-497.107] (-498.133) (-498.852) (-497.800) * [-499.951] (-500.837) (-498.808) (-499.101) -- 0:00:38
      377000 -- (-497.619) [-497.993] (-497.767) (-499.289) * [-502.759] (-498.451) (-499.795) (-498.018) -- 0:00:38
      377500 -- [-497.465] (-498.061) (-500.434) (-501.890) * (-499.128) [-496.715] (-500.166) (-498.767) -- 0:00:37
      378000 -- (-499.201) (-498.611) (-500.114) [-497.826] * (-498.081) [-499.362] (-500.488) (-500.666) -- 0:00:37
      378500 -- (-502.229) (-498.635) (-499.366) [-498.896] * (-497.297) [-499.210] (-500.500) (-503.133) -- 0:00:37
      379000 -- [-501.634] (-499.217) (-497.538) (-499.012) * [-497.679] (-500.992) (-500.727) (-500.942) -- 0:00:37
      379500 -- (-499.811) (-497.770) (-500.805) [-497.923] * (-499.858) (-497.577) (-497.667) [-497.582] -- 0:00:37
      380000 -- (-498.408) (-502.489) [-499.345] (-501.317) * [-500.753] (-501.750) (-497.592) (-500.491) -- 0:00:37

      Average standard deviation of split frequencies: 0.009219

      380500 -- [-499.022] (-501.706) (-498.365) (-500.599) * (-499.856) (-498.161) (-499.425) [-501.504] -- 0:00:37
      381000 -- (-497.411) (-498.103) (-500.757) [-499.880] * (-498.630) (-497.195) [-497.895] (-501.296) -- 0:00:37
      381500 -- [-503.141] (-498.003) (-503.273) (-499.039) * (-500.015) (-500.682) [-501.913] (-498.339) -- 0:00:37
      382000 -- (-498.976) (-499.796) [-497.798] (-497.899) * [-497.635] (-497.489) (-498.428) (-500.434) -- 0:00:37
      382500 -- (-499.676) [-498.062] (-499.209) (-500.199) * (-503.522) (-497.708) (-497.569) [-503.721] -- 0:00:37
      383000 -- (-498.614) [-501.478] (-501.366) (-498.121) * (-500.925) (-497.145) (-500.482) [-497.722] -- 0:00:37
      383500 -- (-497.827) [-500.381] (-501.020) (-498.102) * (-497.505) [-498.782] (-499.906) (-501.191) -- 0:00:36
      384000 -- (-497.527) [-497.408] (-499.119) (-498.638) * (-497.991) (-497.363) (-502.199) [-498.622] -- 0:00:36
      384500 -- (-499.231) (-499.010) [-497.709] (-498.588) * (-497.796) (-500.692) [-499.341] (-496.960) -- 0:00:36
      385000 -- (-497.215) (-497.826) (-498.255) [-497.103] * (-499.156) (-501.983) (-501.089) [-496.939] -- 0:00:36

      Average standard deviation of split frequencies: 0.009159

      385500 -- (-498.070) (-497.953) [-499.372] (-498.403) * [-498.907] (-504.099) (-498.838) (-497.549) -- 0:00:36
      386000 -- (-498.404) (-498.409) [-497.981] (-498.319) * (-501.100) (-500.556) (-497.737) [-500.181] -- 0:00:36
      386500 -- (-499.185) (-499.626) [-498.721] (-501.726) * [-499.386] (-504.206) (-498.663) (-503.040) -- 0:00:36
      387000 -- (-504.456) (-497.252) [-499.064] (-500.363) * (-499.137) [-499.271] (-498.333) (-499.709) -- 0:00:36
      387500 -- [-498.474] (-499.410) (-498.302) (-506.222) * (-500.025) (-498.675) [-500.736] (-498.261) -- 0:00:36
      388000 -- [-501.669] (-496.885) (-499.754) (-499.209) * [-498.556] (-497.613) (-497.572) (-501.508) -- 0:00:36
      388500 -- (-502.672) (-497.918) [-498.003] (-497.662) * (-497.996) (-498.171) [-497.257] (-500.299) -- 0:00:36
      389000 -- [-497.589] (-500.559) (-499.834) (-502.913) * (-498.043) (-499.184) (-500.229) [-504.076] -- 0:00:36
      389500 -- (-497.840) [-503.578] (-499.053) (-498.363) * (-499.172) [-497.058] (-499.356) (-503.782) -- 0:00:36
      390000 -- [-498.235] (-501.893) (-499.663) (-497.899) * [-498.376] (-497.645) (-502.151) (-501.429) -- 0:00:35

      Average standard deviation of split frequencies: 0.009251

      390500 -- (-497.358) (-498.446) [-498.257] (-498.594) * (-498.275) [-498.876] (-502.756) (-502.357) -- 0:00:35
      391000 -- (-498.921) (-497.259) [-498.129] (-498.603) * (-498.139) [-497.693] (-503.560) (-497.909) -- 0:00:37
      391500 -- (-496.798) (-497.427) [-496.828] (-497.475) * (-497.228) [-499.769] (-503.166) (-499.203) -- 0:00:37
      392000 -- (-497.429) [-497.330] (-497.213) (-497.890) * [-497.562] (-500.768) (-498.894) (-503.529) -- 0:00:37
      392500 -- (-499.975) (-500.403) (-497.866) [-497.309] * (-501.180) (-500.401) [-497.762] (-497.597) -- 0:00:37
      393000 -- (-498.926) [-500.478] (-500.454) (-500.668) * (-503.800) [-498.429] (-497.784) (-499.890) -- 0:00:37
      393500 -- (-498.433) (-500.407) (-501.459) [-500.209] * [-502.113] (-498.089) (-497.131) (-499.606) -- 0:00:36
      394000 -- [-500.167] (-502.522) (-502.673) (-498.173) * (-497.715) (-499.006) (-498.125) [-497.387] -- 0:00:36
      394500 -- (-498.388) (-501.708) [-499.249] (-499.309) * (-500.627) (-497.610) [-500.101] (-497.553) -- 0:00:36
      395000 -- [-499.207] (-505.741) (-497.725) (-497.392) * [-499.212] (-496.835) (-497.539) (-498.478) -- 0:00:36

      Average standard deviation of split frequencies: 0.009788

      395500 -- (-502.531) [-498.427] (-503.714) (-498.798) * (-498.132) (-499.789) [-497.388] (-505.549) -- 0:00:36
      396000 -- (-499.015) (-497.218) (-504.090) [-499.143] * (-500.866) (-497.206) [-499.290] (-501.263) -- 0:00:36
      396500 -- (-497.073) (-499.732) [-498.163] (-498.918) * (-497.410) (-497.743) (-498.278) [-500.576] -- 0:00:36
      397000 -- [-497.909] (-499.609) (-504.291) (-506.203) * (-498.398) (-502.510) (-500.729) [-499.969] -- 0:00:36
      397500 -- [-499.570] (-500.373) (-498.020) (-498.132) * (-497.799) [-499.303] (-498.573) (-501.681) -- 0:00:36
      398000 -- (-497.471) (-498.608) [-497.393] (-497.302) * (-498.051) [-498.211] (-498.624) (-497.154) -- 0:00:36
      398500 -- (-506.039) [-500.823] (-499.082) (-497.700) * [-498.181] (-498.650) (-502.196) (-498.477) -- 0:00:36
      399000 -- (-499.538) (-497.322) (-504.949) [-499.894] * (-501.049) (-499.572) (-500.792) [-499.730] -- 0:00:36
      399500 -- (-500.136) (-500.485) (-501.985) [-500.127] * [-498.151] (-498.666) (-500.209) (-499.962) -- 0:00:36
      400000 -- (-498.723) (-499.205) [-498.525] (-503.892) * [-497.909] (-496.694) (-498.747) (-498.835) -- 0:00:36

      Average standard deviation of split frequencies: 0.009935

      400500 -- (-497.137) (-499.720) [-498.375] (-499.008) * [-497.299] (-497.074) (-498.359) (-498.712) -- 0:00:35
      401000 -- (-498.590) (-500.256) [-498.446] (-501.646) * [-498.292] (-497.413) (-501.822) (-498.110) -- 0:00:35
      401500 -- (-499.827) [-497.158] (-499.866) (-500.732) * (-499.805) (-497.115) (-500.439) [-496.955] -- 0:00:35
      402000 -- (-499.243) [-498.913] (-498.700) (-498.265) * (-497.907) (-497.065) [-496.861] (-502.484) -- 0:00:35
      402500 -- [-498.669] (-498.938) (-497.284) (-500.848) * (-497.642) [-498.622] (-499.476) (-498.259) -- 0:00:35
      403000 -- (-497.570) (-500.777) [-499.233] (-501.567) * (-506.220) (-498.396) (-500.075) [-497.380] -- 0:00:35
      403500 -- [-500.746] (-498.737) (-498.209) (-499.949) * (-500.571) (-498.520) [-501.089] (-497.509) -- 0:00:35
      404000 -- (-500.845) [-502.580] (-499.108) (-497.010) * [-502.836] (-499.269) (-500.910) (-498.241) -- 0:00:35
      404500 -- [-499.389] (-500.584) (-499.097) (-497.665) * (-497.884) (-499.246) [-502.523] (-498.686) -- 0:00:35
      405000 -- (-502.035) (-499.855) [-499.711] (-500.091) * (-499.742) [-498.555] (-500.160) (-497.406) -- 0:00:35

      Average standard deviation of split frequencies: 0.010192

      405500 -- (-499.181) (-500.964) (-499.886) [-501.956] * [-500.488] (-503.948) (-499.427) (-499.240) -- 0:00:35
      406000 -- (-497.361) (-499.445) (-500.298) [-501.562] * [-501.182] (-502.853) (-497.642) (-498.222) -- 0:00:35
      406500 -- [-497.836] (-500.720) (-501.890) (-499.212) * (-498.906) (-498.838) (-500.713) [-498.006] -- 0:00:35
      407000 -- (-499.336) (-498.925) [-502.758] (-499.287) * (-497.666) (-499.071) (-500.020) [-504.061] -- 0:00:34
      407500 -- [-500.729] (-497.852) (-498.349) (-502.124) * (-499.265) (-500.371) (-499.939) [-498.261] -- 0:00:36
      408000 -- (-502.718) (-503.524) [-499.006] (-501.326) * [-499.014] (-507.418) (-499.849) (-498.783) -- 0:00:36
      408500 -- [-501.847] (-508.327) (-499.867) (-498.592) * (-500.403) [-499.908] (-499.421) (-499.710) -- 0:00:36
      409000 -- (-499.262) (-502.515) [-498.656] (-504.424) * (-501.868) (-497.348) (-499.596) [-497.628] -- 0:00:36
      409500 -- (-498.076) (-499.305) (-498.681) [-503.192] * (-497.562) [-501.673] (-501.039) (-497.522) -- 0:00:36
      410000 -- (-496.870) (-503.157) (-497.759) [-498.893] * [-499.961] (-501.208) (-498.212) (-497.652) -- 0:00:35

      Average standard deviation of split frequencies: 0.010204

      410500 -- [-498.755] (-498.569) (-499.634) (-502.062) * (-497.161) [-501.036] (-501.957) (-497.055) -- 0:00:35
      411000 -- (-500.155) (-500.423) [-500.036] (-497.413) * (-501.210) (-501.222) (-500.879) [-498.161] -- 0:00:35
      411500 -- (-498.000) [-499.172] (-498.612) (-499.862) * (-503.965) (-497.659) [-496.693] (-497.455) -- 0:00:35
      412000 -- [-499.755] (-498.718) (-503.232) (-500.986) * (-502.066) [-499.350] (-497.051) (-501.771) -- 0:00:35
      412500 -- [-498.086] (-498.516) (-500.137) (-497.185) * (-497.612) (-497.647) [-498.382] (-497.417) -- 0:00:35
      413000 -- [-497.351] (-498.000) (-500.681) (-499.058) * (-498.152) [-498.302] (-498.454) (-496.865) -- 0:00:35
      413500 -- (-499.521) [-500.114] (-498.440) (-500.243) * (-498.721) (-499.356) (-500.024) [-498.840] -- 0:00:35
      414000 -- (-498.130) (-499.176) (-499.552) [-498.735] * (-500.088) (-497.292) [-507.550] (-498.657) -- 0:00:35
      414500 -- (-499.082) (-499.828) [-498.546] (-505.081) * (-499.831) [-498.049] (-506.513) (-498.905) -- 0:00:35
      415000 -- (-498.935) (-498.656) [-499.828] (-499.965) * [-501.549] (-499.636) (-497.756) (-500.114) -- 0:00:35

      Average standard deviation of split frequencies: 0.010073

      415500 -- (-500.849) (-501.574) (-500.677) [-499.122] * (-499.642) (-498.664) [-500.633] (-504.920) -- 0:00:35
      416000 -- (-501.692) [-499.359] (-499.146) (-499.174) * (-498.404) (-500.048) [-496.905] (-501.645) -- 0:00:35
      416500 -- (-499.816) (-498.403) (-496.669) [-497.937] * (-501.842) [-499.324] (-498.114) (-499.089) -- 0:00:35
      417000 -- [-500.516] (-499.205) (-500.616) (-498.220) * (-504.412) [-498.028] (-499.141) (-497.163) -- 0:00:34
      417500 -- (-501.215) [-497.941] (-501.916) (-498.352) * (-500.006) (-498.838) (-500.051) [-500.264] -- 0:00:34
      418000 -- (-499.360) (-498.815) (-502.105) [-497.248] * (-500.677) [-498.270] (-501.505) (-499.457) -- 0:00:34
      418500 -- [-499.174] (-499.365) (-500.940) (-497.493) * (-501.240) [-498.888] (-496.782) (-498.518) -- 0:00:34
      419000 -- (-497.595) (-501.956) (-504.064) [-498.159] * (-499.024) (-500.356) (-500.891) [-498.694] -- 0:00:34
      419500 -- (-499.250) (-498.223) [-505.010] (-498.736) * (-502.119) [-499.504] (-497.454) (-504.196) -- 0:00:34
      420000 -- (-499.450) (-497.108) (-500.419) [-506.694] * (-504.648) (-499.637) [-499.664] (-500.257) -- 0:00:34

      Average standard deviation of split frequencies: 0.009961

      420500 -- (-498.164) (-497.559) (-502.188) [-499.207] * (-503.463) (-498.702) [-499.377] (-502.199) -- 0:00:34
      421000 -- (-497.178) (-499.467) (-497.975) [-498.110] * [-502.142] (-499.745) (-502.367) (-499.638) -- 0:00:34
      421500 -- (-498.657) [-497.160] (-502.313) (-501.151) * (-500.822) [-497.035] (-502.328) (-503.582) -- 0:00:34
      422000 -- (-497.772) [-503.506] (-501.915) (-500.734) * (-497.988) (-497.677) [-497.309] (-499.059) -- 0:00:34
      422500 -- (-500.177) (-498.840) [-499.641] (-497.169) * (-498.186) (-501.059) (-498.440) [-498.883] -- 0:00:34
      423000 -- (-499.601) (-499.024) (-498.623) [-499.082] * (-501.084) (-499.852) [-498.258] (-497.684) -- 0:00:34
      423500 -- (-498.454) [-499.558] (-498.627) (-500.125) * (-499.448) (-497.138) (-498.426) [-500.177] -- 0:00:34
      424000 -- (-497.599) (-500.078) (-498.580) [-500.966] * (-498.548) [-498.200] (-499.741) (-508.053) -- 0:00:33
      424500 -- (-505.847) (-503.314) [-500.545] (-503.465) * (-501.096) (-501.955) (-499.257) [-498.801] -- 0:00:35
      425000 -- (-504.709) [-498.206] (-500.428) (-500.002) * [-500.617] (-497.325) (-499.784) (-498.435) -- 0:00:35

      Average standard deviation of split frequencies: 0.009529

      425500 -- (-499.940) (-498.303) [-497.256] (-498.098) * (-500.487) (-501.050) [-498.866] (-500.432) -- 0:00:35
      426000 -- [-500.165] (-497.967) (-499.057) (-497.126) * (-499.629) [-498.967] (-498.804) (-503.789) -- 0:00:35
      426500 -- (-498.374) (-498.127) (-500.914) [-497.107] * [-500.437] (-498.168) (-497.739) (-503.924) -- 0:00:34
      427000 -- (-501.601) (-500.302) (-502.312) [-497.281] * (-500.131) [-499.183] (-497.449) (-498.333) -- 0:00:34
      427500 -- [-501.018] (-501.376) (-506.953) (-499.184) * (-498.178) (-498.643) [-499.319] (-499.445) -- 0:00:34
      428000 -- (-498.386) [-500.559] (-504.689) (-498.626) * (-498.579) (-498.696) (-497.880) [-498.249] -- 0:00:34
      428500 -- (-498.848) (-498.613) [-503.589] (-497.974) * (-499.093) (-501.910) [-499.244] (-499.040) -- 0:00:34
      429000 -- [-498.950] (-499.253) (-499.882) (-497.791) * (-497.272) (-497.937) [-498.680] (-501.830) -- 0:00:34
      429500 -- (-496.980) [-499.640] (-498.030) (-499.192) * [-496.766] (-500.228) (-501.293) (-501.394) -- 0:00:34
      430000 -- (-498.256) (-501.094) (-498.404) [-502.189] * (-497.128) (-498.583) [-500.067] (-499.217) -- 0:00:34

      Average standard deviation of split frequencies: 0.008878

      430500 -- (-501.523) (-499.178) (-498.740) [-500.356] * (-499.026) (-498.615) (-500.379) [-498.752] -- 0:00:34
      431000 -- (-498.549) (-498.093) (-498.684) [-499.413] * (-497.904) (-496.989) [-498.535] (-501.154) -- 0:00:34
      431500 -- (-499.803) (-498.781) (-497.649) [-498.178] * [-498.126] (-501.883) (-499.501) (-501.991) -- 0:00:34
      432000 -- (-499.521) (-498.164) [-499.083] (-497.217) * (-498.206) (-500.725) [-498.174] (-500.346) -- 0:00:34
      432500 -- [-499.017] (-497.436) (-501.921) (-498.934) * (-497.621) (-498.056) (-497.603) [-497.863] -- 0:00:34
      433000 -- (-501.092) [-497.295] (-503.616) (-499.494) * [-499.001] (-501.502) (-500.239) (-501.665) -- 0:00:34
      433500 -- (-499.337) (-498.287) [-497.662] (-498.066) * (-501.006) (-505.355) [-501.989] (-500.005) -- 0:00:33
      434000 -- (-507.868) [-500.324] (-500.316) (-501.695) * (-504.958) (-498.584) (-500.211) [-497.965] -- 0:00:33
      434500 -- (-501.654) (-501.826) (-498.070) [-498.909] * (-499.373) (-497.869) (-498.857) [-497.021] -- 0:00:33
      435000 -- (-499.660) (-498.411) [-501.381] (-500.387) * [-498.186] (-499.766) (-500.308) (-502.493) -- 0:00:33

      Average standard deviation of split frequencies: 0.008529

      435500 -- (-498.792) [-501.246] (-497.537) (-499.130) * [-497.257] (-499.148) (-498.060) (-498.717) -- 0:00:33
      436000 -- (-496.718) (-499.456) [-497.088] (-502.665) * [-497.960] (-498.889) (-497.449) (-498.587) -- 0:00:33
      436500 -- (-498.939) (-500.578) (-498.627) [-498.393] * (-505.713) (-497.431) (-498.783) [-499.893] -- 0:00:33
      437000 -- (-501.762) [-497.962] (-498.160) (-501.164) * (-502.965) [-499.480] (-498.451) (-498.110) -- 0:00:33
      437500 -- (-497.740) (-497.390) [-499.776] (-497.965) * (-498.439) (-499.406) [-498.067] (-498.722) -- 0:00:33
      438000 -- (-499.449) (-499.254) (-498.424) [-499.319] * (-497.853) [-500.527] (-498.107) (-500.168) -- 0:00:33
      438500 -- (-500.422) (-502.719) [-496.659] (-498.284) * [-500.579] (-499.115) (-499.708) (-498.594) -- 0:00:33
      439000 -- (-498.765) (-499.199) [-498.313] (-498.798) * [-499.059] (-500.869) (-497.644) (-498.234) -- 0:00:33
      439500 -- [-499.066] (-497.248) (-498.904) (-497.474) * (-499.898) (-500.200) (-498.728) [-496.926] -- 0:00:33
      440000 -- (-498.459) [-500.042] (-498.398) (-498.239) * (-497.459) (-500.007) [-501.788] (-499.343) -- 0:00:33

      Average standard deviation of split frequencies: 0.007964

      440500 -- (-499.519) [-499.364] (-499.338) (-498.959) * (-497.301) (-498.706) [-498.632] (-498.433) -- 0:00:33
      441000 -- [-499.891] (-503.191) (-496.948) (-498.889) * (-499.388) (-497.777) [-500.482] (-498.409) -- 0:00:34
      441500 -- (-498.199) (-503.901) [-498.102] (-499.540) * [-499.010] (-497.087) (-499.286) (-497.861) -- 0:00:34
      442000 -- [-500.217] (-498.540) (-501.027) (-501.840) * (-498.394) (-497.446) (-498.447) [-499.544] -- 0:00:34
      442500 -- (-500.952) (-501.497) (-498.173) [-498.349] * [-497.833] (-498.834) (-504.283) (-502.649) -- 0:00:34
      443000 -- (-498.994) (-499.742) [-500.431] (-500.832) * (-499.051) (-498.452) [-498.827] (-500.479) -- 0:00:33
      443500 -- (-499.564) (-498.405) (-502.533) [-499.336] * (-497.552) [-500.088] (-498.031) (-499.548) -- 0:00:33
      444000 -- (-499.537) (-499.461) (-500.586) [-500.692] * (-499.343) [-497.427] (-498.004) (-501.761) -- 0:00:33
      444500 -- (-500.613) (-501.822) (-501.449) [-500.438] * (-502.756) (-498.888) (-498.750) [-497.576] -- 0:00:33
      445000 -- (-499.958) [-500.023] (-499.435) (-500.917) * (-504.050) (-498.411) [-499.632] (-497.490) -- 0:00:33

      Average standard deviation of split frequencies: 0.008456

      445500 -- (-497.232) (-500.926) [-498.829] (-498.368) * (-498.926) [-499.915] (-498.770) (-497.372) -- 0:00:33
      446000 -- (-497.475) (-498.719) (-496.729) [-499.525] * (-497.224) (-498.219) (-497.588) [-497.986] -- 0:00:33
      446500 -- [-498.732] (-498.675) (-496.887) (-499.965) * (-498.839) (-498.085) (-497.872) [-500.221] -- 0:00:33
      447000 -- (-497.200) (-499.563) (-499.142) [-499.287] * (-500.382) (-500.027) (-499.600) [-504.870] -- 0:00:33
      447500 -- (-497.775) (-501.323) [-500.679] (-499.731) * (-498.937) [-498.647] (-499.963) (-497.444) -- 0:00:33
      448000 -- (-496.787) (-498.562) [-502.890] (-501.039) * (-499.572) (-498.235) [-502.514] (-500.745) -- 0:00:33
      448500 -- (-499.605) (-498.382) [-498.218] (-497.817) * (-501.275) [-497.601] (-499.497) (-500.996) -- 0:00:33
      449000 -- [-498.352] (-498.346) (-500.526) (-497.789) * [-499.028] (-498.094) (-499.661) (-498.127) -- 0:00:33
      449500 -- [-499.229] (-499.707) (-499.218) (-499.644) * [-499.188] (-500.111) (-499.909) (-498.610) -- 0:00:33
      450000 -- (-500.932) (-499.318) (-503.456) [-498.001] * (-498.518) (-501.775) (-499.486) [-499.583] -- 0:00:33

      Average standard deviation of split frequencies: 0.008542

      450500 -- (-499.518) (-499.515) (-497.480) [-498.162] * (-497.229) (-501.450) (-499.724) [-497.069] -- 0:00:32
      451000 -- (-499.779) (-497.596) [-497.746] (-499.954) * [-501.204] (-498.124) (-497.875) (-500.669) -- 0:00:32
      451500 -- (-498.796) (-497.631) [-497.173] (-502.151) * [-498.003] (-500.291) (-498.769) (-497.112) -- 0:00:32
      452000 -- (-499.754) (-497.524) [-500.790] (-497.369) * (-501.913) (-497.319) [-497.155] (-498.102) -- 0:00:32
      452500 -- (-506.625) (-498.116) (-502.659) [-497.766] * (-500.894) [-497.207] (-497.617) (-498.220) -- 0:00:32
      453000 -- (-500.144) (-500.316) (-502.472) [-498.342] * (-500.518) (-497.154) [-503.696] (-499.517) -- 0:00:32
      453500 -- (-498.256) (-499.125) [-502.206] (-498.001) * (-502.074) (-497.167) (-501.790) [-497.105] -- 0:00:32
      454000 -- (-497.739) (-498.531) (-497.394) [-498.219] * (-500.634) (-497.379) [-497.764] (-498.361) -- 0:00:32
      454500 -- [-504.617] (-500.984) (-497.169) (-497.462) * (-498.659) [-498.954] (-498.154) (-498.899) -- 0:00:32
      455000 -- (-498.328) (-498.280) (-498.568) [-499.428] * (-498.005) (-498.183) [-497.958] (-499.707) -- 0:00:32

      Average standard deviation of split frequencies: 0.008500

      455500 -- (-497.571) (-497.070) (-504.057) [-501.463] * (-498.130) (-497.232) (-497.186) [-498.908] -- 0:00:32
      456000 -- (-497.850) (-498.246) (-503.281) [-498.143] * (-499.079) (-502.542) [-498.363] (-498.245) -- 0:00:32
      456500 -- (-497.856) (-497.377) (-507.205) [-498.556] * [-500.210] (-501.034) (-500.864) (-497.784) -- 0:00:32
      457000 -- (-500.305) [-501.642] (-499.446) (-498.290) * (-504.896) (-503.993) [-499.589] (-499.038) -- 0:00:32
      457500 -- (-497.886) (-498.442) [-500.690] (-499.013) * (-500.791) [-497.036] (-499.425) (-498.293) -- 0:00:32
      458000 -- [-502.342] (-500.280) (-500.571) (-498.223) * [-499.313] (-500.954) (-499.256) (-498.197) -- 0:00:33
      458500 -- (-500.521) [-497.360] (-502.403) (-498.975) * [-501.273] (-499.667) (-498.501) (-498.304) -- 0:00:33
      459000 -- (-500.429) (-499.024) (-498.610) [-498.274] * (-500.230) (-502.367) [-497.395] (-498.656) -- 0:00:33
      459500 -- (-501.982) (-499.997) [-498.056] (-499.938) * (-497.477) [-499.543] (-499.983) (-497.633) -- 0:00:32
      460000 -- (-499.697) (-501.105) (-498.581) [-501.303] * (-500.360) [-499.292] (-499.979) (-497.309) -- 0:00:32

      Average standard deviation of split frequencies: 0.008357

      460500 -- [-498.877] (-499.207) (-497.656) (-499.083) * (-497.861) (-498.835) [-497.628] (-499.823) -- 0:00:32
      461000 -- (-499.807) [-499.180] (-499.922) (-499.557) * (-501.462) (-503.262) [-497.749] (-502.859) -- 0:00:32
      461500 -- (-501.449) (-499.073) (-499.846) [-498.672] * (-498.183) [-498.524] (-502.334) (-501.304) -- 0:00:32
      462000 -- (-499.322) [-499.441] (-499.129) (-499.612) * (-505.789) (-497.595) [-498.904] (-498.843) -- 0:00:32
      462500 -- (-499.897) [-499.206] (-499.871) (-501.007) * [-500.402] (-500.555) (-498.120) (-498.800) -- 0:00:32
      463000 -- (-502.893) [-501.221] (-500.487) (-497.845) * (-500.076) (-498.866) [-498.240] (-498.558) -- 0:00:32
      463500 -- (-497.668) (-499.581) [-499.177] (-498.562) * (-497.490) (-497.294) (-505.903) [-498.647] -- 0:00:32
      464000 -- (-498.688) (-501.572) (-499.532) [-498.717] * (-498.123) [-498.068] (-502.687) (-498.331) -- 0:00:32
      464500 -- (-499.750) [-503.395] (-497.175) (-503.797) * [-500.066] (-498.269) (-502.439) (-498.002) -- 0:00:32
      465000 -- (-500.075) (-502.765) (-498.854) [-497.056] * (-503.851) (-504.597) (-497.313) [-500.352] -- 0:00:32

      Average standard deviation of split frequencies: 0.009850

      465500 -- (-497.400) (-502.366) (-499.377) [-497.260] * (-502.144) (-505.884) [-499.526] (-497.076) -- 0:00:32
      466000 -- (-501.141) [-500.182] (-498.136) (-498.751) * [-499.726] (-499.921) (-498.990) (-497.500) -- 0:00:32
      466500 -- (-505.195) [-497.396] (-499.776) (-500.017) * (-499.407) (-499.517) [-499.988] (-497.934) -- 0:00:32
      467000 -- (-498.390) (-498.744) [-497.736] (-499.121) * (-497.611) (-498.293) [-497.907] (-501.452) -- 0:00:31
      467500 -- (-498.301) (-499.203) (-502.330) [-497.508] * (-497.910) (-497.288) [-498.676] (-499.871) -- 0:00:31
      468000 -- (-498.920) [-499.605] (-500.775) (-502.722) * [-497.998] (-498.117) (-499.719) (-500.531) -- 0:00:31
      468500 -- (-498.332) [-498.539] (-502.779) (-500.008) * (-500.794) (-499.583) (-502.870) [-498.197] -- 0:00:31
      469000 -- [-497.386] (-497.462) (-501.730) (-497.564) * (-497.910) (-501.549) [-498.184] (-498.503) -- 0:00:31
      469500 -- (-497.999) (-497.458) [-497.625] (-502.317) * (-498.618) [-500.844] (-498.752) (-497.128) -- 0:00:31
      470000 -- (-498.598) [-497.378] (-498.947) (-498.632) * (-501.495) (-499.728) (-499.479) [-497.544] -- 0:00:31

      Average standard deviation of split frequencies: 0.009647

      470500 -- (-496.953) (-498.673) (-497.484) [-499.729] * [-498.322] (-500.732) (-497.760) (-498.960) -- 0:00:31
      471000 -- (-498.767) (-498.923) [-501.036] (-498.094) * [-498.002] (-499.911) (-498.343) (-497.297) -- 0:00:31
      471500 -- (-499.032) (-498.783) (-498.674) [-498.996] * [-500.664] (-498.943) (-500.002) (-499.214) -- 0:00:31
      472000 -- (-499.676) [-497.099] (-499.948) (-498.453) * (-500.465) [-497.825] (-501.557) (-502.348) -- 0:00:31
      472500 -- (-497.537) (-497.227) [-496.994] (-499.171) * [-505.523] (-498.075) (-502.101) (-498.504) -- 0:00:31
      473000 -- [-497.706] (-500.804) (-498.455) (-501.542) * (-505.411) [-498.340] (-497.616) (-500.442) -- 0:00:31
      473500 -- (-498.504) (-499.823) [-496.950] (-501.599) * [-502.732] (-497.992) (-498.623) (-498.115) -- 0:00:31
      474000 -- (-497.459) (-498.861) [-497.634] (-500.550) * (-497.914) [-500.084] (-500.364) (-497.865) -- 0:00:31
      474500 -- (-500.365) [-497.492] (-498.649) (-500.358) * [-499.419] (-497.353) (-497.689) (-498.237) -- 0:00:32
      475000 -- (-498.069) (-499.763) [-497.686] (-498.483) * (-498.094) (-501.336) (-498.354) [-497.409] -- 0:00:32

      Average standard deviation of split frequencies: 0.009903

      475500 -- (-497.100) [-503.133] (-498.325) (-498.918) * (-501.089) (-503.755) (-497.672) [-497.187] -- 0:00:31
      476000 -- (-498.284) [-497.185] (-496.958) (-502.760) * [-499.316] (-498.845) (-502.132) (-497.833) -- 0:00:31
      476500 -- (-497.722) (-498.226) [-498.868] (-504.031) * (-498.849) (-499.122) [-498.761] (-496.796) -- 0:00:31
      477000 -- [-498.578] (-499.879) (-500.730) (-501.313) * (-499.842) [-498.633] (-497.519) (-498.227) -- 0:00:31
      477500 -- [-499.508] (-499.292) (-499.255) (-500.791) * (-500.269) [-499.068] (-496.963) (-499.153) -- 0:00:31
      478000 -- (-498.508) [-497.341] (-501.887) (-498.595) * (-497.252) [-498.011] (-497.350) (-499.790) -- 0:00:31
      478500 -- (-501.266) (-499.089) (-499.396) [-498.679] * (-497.990) (-498.483) (-500.588) [-498.210] -- 0:00:31
      479000 -- [-499.898] (-501.143) (-499.129) (-503.184) * (-502.153) [-497.938] (-502.760) (-497.323) -- 0:00:31
      479500 -- (-500.337) (-498.985) (-497.852) [-499.037] * (-497.605) [-498.756] (-498.908) (-497.266) -- 0:00:31
      480000 -- (-497.592) (-497.727) [-499.609] (-500.396) * [-502.375] (-501.280) (-499.050) (-497.962) -- 0:00:31

      Average standard deviation of split frequencies: 0.010943

      480500 -- (-501.541) (-497.927) (-497.571) [-501.423] * (-505.214) [-498.828] (-498.755) (-497.817) -- 0:00:31
      481000 -- (-497.962) (-496.991) [-497.341] (-500.403) * (-500.438) (-497.400) (-500.316) [-497.665] -- 0:00:31
      481500 -- (-498.177) (-498.104) (-500.395) [-500.035] * [-501.667] (-500.008) (-500.205) (-500.127) -- 0:00:31
      482000 -- (-499.411) (-497.738) [-498.349] (-499.216) * (-497.979) (-498.093) [-500.384] (-498.788) -- 0:00:31
      482500 -- (-500.384) (-498.836) [-502.646] (-503.752) * (-498.880) (-497.833) [-498.678] (-498.394) -- 0:00:31
      483000 -- (-501.380) (-498.786) [-502.000] (-503.986) * (-498.810) [-498.491] (-496.864) (-498.503) -- 0:00:31
      483500 -- (-500.364) (-497.030) (-499.844) [-500.331] * (-499.489) [-501.916] (-496.944) (-499.115) -- 0:00:30
      484000 -- (-499.831) [-499.568] (-497.658) (-498.277) * (-500.696) (-499.012) (-499.453) [-497.710] -- 0:00:30
      484500 -- (-499.316) (-503.247) (-498.698) [-498.920] * [-499.544] (-502.116) (-497.874) (-501.142) -- 0:00:30
      485000 -- (-500.696) (-498.759) [-500.297] (-499.649) * (-500.082) (-497.391) [-497.988] (-500.681) -- 0:00:30

      Average standard deviation of split frequencies: 0.011009

      485500 -- (-503.452) (-499.362) [-498.386] (-498.266) * [-500.305] (-497.285) (-500.712) (-498.554) -- 0:00:30
      486000 -- [-498.587] (-502.984) (-498.042) (-498.419) * [-497.369] (-498.555) (-500.082) (-498.084) -- 0:00:30
      486500 -- [-499.368] (-497.509) (-499.530) (-499.373) * [-497.344] (-497.657) (-497.375) (-500.229) -- 0:00:30
      487000 -- (-497.970) [-498.894] (-496.882) (-500.297) * (-498.505) [-497.669] (-498.729) (-499.517) -- 0:00:30
      487500 -- [-497.088] (-499.991) (-499.277) (-500.331) * (-500.384) [-502.288] (-499.690) (-497.476) -- 0:00:30
      488000 -- [-496.958] (-501.271) (-498.340) (-501.757) * [-496.841] (-500.401) (-500.279) (-498.452) -- 0:00:30
      488500 -- (-497.466) [-498.560] (-500.395) (-498.146) * (-497.384) (-498.647) (-498.533) [-501.193] -- 0:00:30
      489000 -- (-499.582) (-501.294) (-500.556) [-497.239] * (-497.984) [-498.015] (-503.974) (-499.965) -- 0:00:30
      489500 -- [-499.294] (-498.638) (-504.238) (-497.526) * (-501.205) [-500.656] (-498.380) (-498.401) -- 0:00:30
      490000 -- [-497.046] (-497.249) (-501.216) (-498.447) * (-497.867) [-498.721] (-501.945) (-499.637) -- 0:00:30

      Average standard deviation of split frequencies: 0.010664

      490500 -- (-498.865) [-499.512] (-503.873) (-499.562) * [-501.041] (-498.716) (-500.151) (-499.877) -- 0:00:30
      491000 -- (-498.565) [-498.256] (-498.136) (-498.354) * (-497.399) (-497.360) (-505.469) [-497.983] -- 0:00:30
      491500 -- (-497.862) [-497.341] (-502.207) (-501.853) * (-497.773) (-499.345) (-498.814) [-497.539] -- 0:00:31
      492000 -- (-497.399) (-501.173) (-500.641) [-500.489] * (-499.491) (-499.502) (-503.937) [-499.784] -- 0:00:30
      492500 -- (-499.867) [-498.109] (-504.360) (-498.338) * [-497.588] (-497.363) (-501.098) (-500.007) -- 0:00:30
      493000 -- (-498.583) (-498.686) [-500.470] (-497.400) * (-498.808) [-497.898] (-497.922) (-499.918) -- 0:00:30
      493500 -- [-499.819] (-497.683) (-497.736) (-501.174) * (-502.978) (-502.598) (-497.571) [-499.686] -- 0:00:30
      494000 -- (-498.570) [-498.492] (-500.864) (-498.227) * (-499.404) (-499.248) [-498.324] (-502.020) -- 0:00:30
      494500 -- [-501.030] (-499.373) (-501.004) (-497.627) * (-500.659) (-498.504) [-498.535] (-499.701) -- 0:00:30
      495000 -- (-502.467) [-502.683] (-500.997) (-498.333) * (-500.352) [-498.744] (-498.809) (-500.825) -- 0:00:30

      Average standard deviation of split frequencies: 0.010169

      495500 -- (-501.445) [-501.733] (-501.588) (-498.880) * (-502.475) (-501.551) (-501.788) [-499.900] -- 0:00:30
      496000 -- (-501.557) (-500.058) [-500.650] (-501.014) * (-497.221) [-498.784] (-501.472) (-502.184) -- 0:00:30
      496500 -- (-503.630) (-498.173) (-497.674) [-500.313] * (-497.124) [-498.490] (-497.831) (-500.904) -- 0:00:30
      497000 -- (-499.062) (-498.560) (-497.220) [-498.744] * (-499.440) [-497.509] (-498.281) (-498.781) -- 0:00:30
      497500 -- (-498.012) (-504.690) (-497.594) [-497.272] * (-499.987) [-497.785] (-499.884) (-500.734) -- 0:00:30
      498000 -- (-497.767) [-497.437] (-498.751) (-498.739) * (-499.395) (-498.230) [-499.989] (-502.420) -- 0:00:30
      498500 -- (-497.640) (-500.182) (-503.216) [-497.509] * (-497.713) [-499.904] (-504.879) (-501.719) -- 0:00:30
      499000 -- (-496.956) (-497.766) (-497.368) [-503.249] * (-499.142) (-497.281) (-499.785) [-499.640] -- 0:00:30
      499500 -- [-497.774] (-499.569) (-499.665) (-499.725) * (-498.193) (-499.289) (-500.793) [-498.005] -- 0:00:30
      500000 -- (-498.520) (-501.638) (-500.296) [-499.224] * [-501.114] (-500.134) (-500.936) (-497.739) -- 0:00:30

      Average standard deviation of split frequencies: 0.009792

      500500 -- [-498.161] (-500.179) (-499.169) (-499.723) * [-497.960] (-497.919) (-500.425) (-498.324) -- 0:00:29
      501000 -- (-501.098) (-499.058) (-499.008) [-497.905] * (-499.747) (-500.059) (-501.573) [-499.618] -- 0:00:29
      501500 -- (-501.771) (-499.006) [-498.350] (-500.982) * (-499.892) [-499.244] (-505.566) (-501.446) -- 0:00:29
      502000 -- (-502.524) (-501.353) (-499.462) [-497.476] * [-498.980] (-498.511) (-501.443) (-498.478) -- 0:00:29
      502500 -- (-499.075) (-500.089) (-499.540) [-498.475] * (-498.938) (-499.520) (-499.200) [-498.934] -- 0:00:29
      503000 -- (-499.201) (-499.884) (-499.950) [-499.771] * (-499.796) (-500.629) (-502.801) [-497.716] -- 0:00:29
      503500 -- (-499.886) [-500.613] (-501.464) (-496.839) * (-500.159) (-503.629) [-498.501] (-497.257) -- 0:00:29
      504000 -- (-499.996) [-499.144] (-497.955) (-497.616) * (-498.128) (-498.882) [-499.114] (-498.036) -- 0:00:29
      504500 -- (-501.963) (-498.164) (-499.627) [-500.897] * (-499.117) (-502.636) (-497.608) [-500.236] -- 0:00:29
      505000 -- (-499.762) [-497.668] (-497.670) (-499.065) * (-499.773) (-504.523) (-500.637) [-498.433] -- 0:00:29

      Average standard deviation of split frequencies: 0.009968

      505500 -- [-497.943] (-499.008) (-502.480) (-498.507) * (-497.457) [-500.378] (-500.764) (-500.956) -- 0:00:29
      506000 -- [-497.062] (-497.809) (-501.052) (-501.583) * (-499.171) (-502.275) (-498.772) [-497.867] -- 0:00:29
      506500 -- (-501.133) (-498.596) (-502.160) [-497.516] * (-498.818) (-499.160) (-498.809) [-498.397] -- 0:00:29
      507000 -- (-497.269) (-501.077) [-501.904] (-501.748) * [-498.739] (-497.959) (-501.940) (-498.277) -- 0:00:29
      507500 -- (-499.735) (-499.217) [-497.356] (-499.125) * [-499.572] (-500.131) (-504.300) (-498.682) -- 0:00:29
      508000 -- (-506.715) (-497.332) (-499.480) [-499.197] * (-498.931) (-498.604) (-499.924) [-498.153] -- 0:00:30
      508500 -- [-497.190] (-499.145) (-497.306) (-500.804) * (-498.778) (-499.530) [-498.003] (-497.808) -- 0:00:29
      509000 -- (-497.975) (-500.064) (-498.213) [-498.690] * [-498.459] (-499.360) (-497.668) (-496.749) -- 0:00:29
      509500 -- (-500.784) (-498.499) [-499.789] (-497.269) * [-500.010] (-500.924) (-498.360) (-496.961) -- 0:00:29
      510000 -- (-498.672) [-497.880] (-502.930) (-499.366) * (-498.616) [-497.296] (-498.472) (-497.498) -- 0:00:29

      Average standard deviation of split frequencies: 0.009785

      510500 -- (-503.935) [-497.908] (-497.149) (-499.380) * [-502.446] (-499.319) (-499.150) (-498.945) -- 0:00:29
      511000 -- (-497.939) (-499.230) [-498.563] (-503.030) * [-503.448] (-499.375) (-499.715) (-498.271) -- 0:00:29
      511500 -- [-497.146] (-498.344) (-498.355) (-501.796) * [-500.650] (-499.669) (-499.885) (-497.818) -- 0:00:29
      512000 -- (-497.889) [-499.241] (-497.607) (-500.897) * (-499.245) [-498.686] (-499.382) (-497.524) -- 0:00:29
      512500 -- [-498.007] (-500.773) (-497.071) (-498.636) * [-497.305] (-500.169) (-500.709) (-498.493) -- 0:00:29
      513000 -- (-497.429) (-499.451) [-498.375] (-501.979) * (-501.745) [-497.684] (-498.123) (-499.322) -- 0:00:29
      513500 -- [-496.878] (-499.196) (-497.751) (-501.678) * [-498.147] (-500.144) (-500.259) (-499.501) -- 0:00:29
      514000 -- [-498.645] (-500.587) (-501.037) (-501.307) * (-500.150) (-501.546) [-499.552] (-498.973) -- 0:00:29
      514500 -- (-498.060) [-499.387] (-499.571) (-498.671) * (-499.260) (-499.969) [-497.411] (-499.008) -- 0:00:29
      515000 -- (-499.113) (-498.198) (-502.233) [-500.467] * (-499.499) (-498.557) (-497.373) [-503.617] -- 0:00:29

      Average standard deviation of split frequencies: 0.010338

      515500 -- [-497.637] (-497.771) (-501.758) (-500.741) * [-497.909] (-503.692) (-498.138) (-497.495) -- 0:00:29
      516000 -- (-499.367) [-497.754] (-497.150) (-502.877) * (-497.705) (-503.089) (-498.880) [-500.239] -- 0:00:29
      516500 -- (-497.794) [-501.141] (-500.320) (-501.367) * [-497.211] (-499.696) (-499.973) (-502.263) -- 0:00:29
      517000 -- (-497.134) (-498.134) (-500.096) [-499.754] * (-500.410) (-501.942) [-497.256] (-501.489) -- 0:00:28
      517500 -- (-498.716) [-497.133] (-500.072) (-497.652) * (-499.258) [-497.392] (-498.738) (-502.515) -- 0:00:28
      518000 -- [-500.174] (-496.949) (-505.288) (-498.180) * (-502.277) [-498.274] (-498.129) (-503.623) -- 0:00:28
      518500 -- [-497.666] (-500.015) (-500.796) (-498.512) * [-501.448] (-498.722) (-498.873) (-507.525) -- 0:00:28
      519000 -- (-496.871) [-498.962] (-498.186) (-498.210) * (-501.035) (-497.595) [-502.120] (-499.533) -- 0:00:28
      519500 -- [-497.659] (-498.221) (-498.095) (-498.921) * (-500.935) (-497.538) (-499.892) [-499.166] -- 0:00:28
      520000 -- (-497.879) (-497.873) (-497.684) [-499.474] * (-498.694) [-498.222] (-502.289) (-500.475) -- 0:00:28

      Average standard deviation of split frequencies: 0.010915

      520500 -- (-501.251) [-498.106] (-496.832) (-497.660) * (-497.227) (-497.701) (-502.165) [-499.824] -- 0:00:28
      521000 -- (-500.885) (-501.925) (-498.372) [-497.252] * [-496.884] (-499.000) (-499.796) (-498.508) -- 0:00:28
      521500 -- (-498.510) (-504.180) (-502.319) [-501.640] * [-501.861] (-498.914) (-499.678) (-497.911) -- 0:00:28
      522000 -- (-498.676) (-502.391) (-502.446) [-499.053] * (-501.004) (-499.003) [-501.398] (-498.363) -- 0:00:28
      522500 -- [-499.280] (-499.241) (-502.991) (-500.663) * (-499.659) (-499.303) [-497.216] (-501.184) -- 0:00:28
      523000 -- (-500.150) [-499.059] (-499.600) (-509.170) * (-499.338) [-497.740] (-501.375) (-498.211) -- 0:00:28
      523500 -- [-500.872] (-498.751) (-498.883) (-500.238) * (-502.348) (-498.136) [-499.824] (-498.293) -- 0:00:28
      524000 -- [-499.125] (-499.001) (-499.889) (-498.861) * [-498.191] (-497.838) (-498.267) (-498.132) -- 0:00:28
      524500 -- (-497.967) (-497.407) (-497.537) [-498.506] * (-497.662) (-506.103) (-499.526) [-498.259] -- 0:00:28
      525000 -- (-498.059) (-498.263) [-499.841] (-498.764) * (-498.630) (-503.961) [-498.265] (-498.337) -- 0:00:28

      Average standard deviation of split frequencies: 0.010396

      525500 -- (-499.824) (-498.421) (-500.074) [-498.918] * (-499.998) (-497.346) (-498.905) [-497.872] -- 0:00:28
      526000 -- [-500.780] (-498.836) (-499.356) (-497.459) * (-497.703) (-503.296) (-497.030) [-497.507] -- 0:00:28
      526500 -- (-498.358) [-502.259] (-501.738) (-497.368) * (-500.830) (-499.377) (-501.799) [-504.417] -- 0:00:28
      527000 -- (-506.819) [-498.845] (-497.686) (-501.835) * (-498.880) (-498.883) (-503.692) [-498.103] -- 0:00:28
      527500 -- (-499.979) (-502.435) (-498.279) [-497.603] * (-501.848) (-498.929) [-498.125] (-499.723) -- 0:00:28
      528000 -- (-499.335) [-501.194] (-501.151) (-500.757) * (-506.908) (-497.601) (-499.129) [-501.442] -- 0:00:28
      528500 -- (-497.773) (-502.165) (-498.005) [-498.641] * (-502.582) (-498.348) [-500.615] (-501.379) -- 0:00:28
      529000 -- (-498.192) (-497.703) (-500.534) [-501.455] * (-507.124) (-499.175) (-499.247) [-499.211] -- 0:00:28
      529500 -- [-500.169] (-499.910) (-499.268) (-500.880) * (-502.682) (-503.017) [-497.153] (-500.673) -- 0:00:28
      530000 -- [-497.997] (-499.878) (-503.173) (-501.004) * (-503.212) (-499.753) (-499.659) [-498.364] -- 0:00:28

      Average standard deviation of split frequencies: 0.009624

      530500 -- [-502.786] (-499.873) (-497.057) (-503.558) * (-499.559) (-499.990) (-500.139) [-498.918] -- 0:00:28
      531000 -- [-498.959] (-498.541) (-501.996) (-503.229) * [-500.439] (-502.414) (-500.590) (-497.767) -- 0:00:28
      531500 -- (-498.478) (-498.777) [-498.577] (-499.154) * [-500.210] (-500.834) (-500.082) (-498.583) -- 0:00:28
      532000 -- [-497.626] (-497.512) (-501.761) (-499.394) * (-500.447) (-499.792) [-499.531] (-497.669) -- 0:00:28
      532500 -- (-499.341) (-498.914) [-498.425] (-497.897) * (-498.581) [-498.782] (-499.589) (-499.296) -- 0:00:28
      533000 -- (-499.277) [-501.136] (-498.200) (-501.730) * (-502.795) (-497.945) [-497.017] (-501.001) -- 0:00:28
      533500 -- (-499.029) (-498.693) [-501.923] (-500.175) * (-499.761) [-502.674] (-499.198) (-500.155) -- 0:00:27
      534000 -- (-499.277) (-501.400) [-505.459] (-497.722) * (-501.105) (-504.038) (-501.533) [-497.212] -- 0:00:27
      534500 -- (-499.246) (-498.834) (-497.651) [-500.066] * (-501.555) (-498.106) [-498.835] (-497.045) -- 0:00:27
      535000 -- (-497.423) (-504.335) [-497.246] (-501.015) * (-499.986) (-499.172) [-499.001] (-498.381) -- 0:00:27

      Average standard deviation of split frequencies: 0.009528

      535500 -- (-499.535) (-504.151) [-498.664] (-499.367) * (-500.746) [-499.507] (-506.821) (-497.314) -- 0:00:27
      536000 -- (-500.266) (-502.166) (-498.642) [-498.014] * [-497.764] (-497.988) (-500.794) (-497.331) -- 0:00:27
      536500 -- (-498.400) (-498.098) [-499.141] (-500.184) * (-497.684) (-498.793) (-503.554) [-497.910] -- 0:00:27
      537000 -- [-499.618] (-499.936) (-497.258) (-497.328) * (-502.230) [-499.970] (-499.376) (-497.762) -- 0:00:27
      537500 -- (-500.664) (-497.360) (-497.257) [-498.739] * [-497.127] (-501.962) (-497.006) (-501.408) -- 0:00:27
      538000 -- [-497.769] (-498.109) (-501.813) (-499.599) * (-499.012) [-496.898] (-499.311) (-498.941) -- 0:00:27
      538500 -- (-499.684) (-497.525) [-497.868] (-497.029) * (-498.207) (-498.663) (-501.384) [-501.334] -- 0:00:27
      539000 -- (-502.918) (-497.348) [-499.923] (-500.433) * [-498.776] (-498.782) (-499.573) (-500.185) -- 0:00:27
      539500 -- (-504.445) (-499.343) (-498.154) [-498.036] * (-498.045) [-498.642] (-498.854) (-504.512) -- 0:00:27
      540000 -- (-501.184) (-498.287) [-499.636] (-503.057) * (-503.996) (-500.928) (-498.440) [-499.047] -- 0:00:27

      Average standard deviation of split frequencies: 0.009736

      540500 -- (-500.612) (-498.328) [-503.212] (-499.917) * (-498.728) (-502.510) [-498.697] (-497.074) -- 0:00:27
      541000 -- [-499.251] (-499.719) (-499.990) (-497.698) * (-497.909) (-504.266) [-500.097] (-498.434) -- 0:00:27
      541500 -- [-497.408] (-498.607) (-500.950) (-499.758) * [-498.527] (-499.906) (-502.683) (-500.415) -- 0:00:27
      542000 -- [-499.713] (-499.265) (-501.106) (-499.054) * (-501.623) (-499.215) [-504.175] (-499.046) -- 0:00:27
      542500 -- [-498.160] (-500.465) (-500.966) (-500.671) * (-497.376) [-498.800] (-499.504) (-500.736) -- 0:00:27
      543000 -- (-498.888) (-497.242) (-498.900) [-502.008] * [-502.270] (-499.238) (-496.919) (-498.551) -- 0:00:27
      543500 -- (-503.197) (-499.671) (-498.851) [-498.647] * (-498.106) [-497.465] (-499.863) (-498.115) -- 0:00:27
      544000 -- (-497.507) [-496.865] (-498.673) (-499.321) * (-499.073) (-500.094) (-498.800) [-499.585] -- 0:00:27
      544500 -- [-498.748] (-497.847) (-499.945) (-498.699) * (-497.595) (-497.973) (-498.816) [-499.081] -- 0:00:27
      545000 -- (-497.649) [-501.523] (-498.418) (-498.596) * (-501.497) (-499.296) (-499.420) [-499.452] -- 0:00:27

      Average standard deviation of split frequencies: 0.010088

      545500 -- (-500.207) (-500.779) (-499.068) [-499.560] * (-497.673) (-498.647) [-498.612] (-500.801) -- 0:00:27
      546000 -- (-500.724) [-498.885] (-498.429) (-498.407) * (-502.300) (-499.450) [-499.907] (-499.140) -- 0:00:27
      546500 -- (-499.006) [-498.592] (-498.841) (-498.085) * (-500.724) (-499.094) (-500.614) [-499.100] -- 0:00:27
      547000 -- [-498.458] (-503.653) (-500.569) (-498.419) * [-499.100] (-498.152) (-497.585) (-499.184) -- 0:00:27
      547500 -- (-498.674) (-497.511) [-505.387] (-502.232) * (-498.350) (-500.186) (-498.600) [-496.926] -- 0:00:27
      548000 -- (-498.588) (-499.044) [-499.406] (-498.262) * (-498.781) [-498.880] (-504.240) (-497.958) -- 0:00:27
      548500 -- (-502.239) (-497.526) [-499.811] (-496.901) * (-496.928) (-499.773) (-496.774) [-499.506] -- 0:00:27
      549000 -- (-500.489) (-498.000) (-501.470) [-498.831] * (-498.455) (-500.371) [-500.692] (-499.544) -- 0:00:27
      549500 -- (-498.275) (-502.126) [-501.616] (-498.103) * (-499.073) [-496.979] (-499.681) (-498.579) -- 0:00:27
      550000 -- [-498.304] (-500.195) (-498.832) (-498.278) * (-500.321) (-497.574) [-496.681] (-500.638) -- 0:00:27

      Average standard deviation of split frequencies: 0.010498

      550500 -- [-501.719] (-501.125) (-497.628) (-497.723) * (-498.627) (-499.592) [-499.100] (-499.702) -- 0:00:26
      551000 -- (-499.245) (-498.836) (-497.378) [-499.087] * (-499.969) (-499.300) (-497.209) [-497.923] -- 0:00:26
      551500 -- [-498.913] (-498.783) (-497.564) (-501.127) * [-500.555] (-499.354) (-497.517) (-500.895) -- 0:00:26
      552000 -- (-497.139) (-502.275) (-498.158) [-498.017] * (-501.115) (-499.619) [-497.454] (-499.158) -- 0:00:26
      552500 -- [-498.194] (-497.552) (-497.843) (-499.018) * (-499.612) (-499.255) [-497.249] (-498.959) -- 0:00:26
      553000 -- (-499.845) (-498.718) [-500.090] (-497.655) * (-497.821) (-497.211) (-497.999) [-499.043] -- 0:00:26
      553500 -- (-502.960) (-498.718) [-498.735] (-498.248) * [-498.318] (-498.742) (-497.891) (-497.318) -- 0:00:26
      554000 -- (-497.580) (-499.355) (-500.090) [-500.262] * (-501.033) (-499.073) [-498.080] (-499.010) -- 0:00:26
      554500 -- [-497.615] (-499.735) (-497.225) (-500.966) * (-498.007) (-498.585) (-498.177) [-498.080] -- 0:00:26
      555000 -- (-499.850) [-500.274] (-498.958) (-505.276) * (-499.564) [-504.243] (-498.680) (-497.977) -- 0:00:26

      Average standard deviation of split frequencies: 0.010397

      555500 -- (-498.694) (-497.655) [-498.005] (-499.467) * (-497.757) [-498.908] (-497.828) (-501.306) -- 0:00:26
      556000 -- [-498.082] (-498.530) (-497.764) (-500.376) * (-504.406) (-498.736) (-500.846) [-498.343] -- 0:00:26
      556500 -- (-498.522) (-498.103) (-499.354) [-497.234] * (-501.417) [-498.627] (-497.949) (-499.370) -- 0:00:26
      557000 -- (-498.969) [-501.528] (-497.985) (-499.278) * (-498.792) (-498.260) [-497.664] (-500.486) -- 0:00:26
      557500 -- (-501.526) (-501.289) (-500.463) [-501.079] * (-498.729) (-496.983) [-503.675] (-499.484) -- 0:00:26
      558000 -- [-497.240] (-502.713) (-498.743) (-499.827) * (-498.028) (-497.315) [-497.472] (-497.926) -- 0:00:26
      558500 -- (-502.949) (-498.466) (-498.391) [-501.042] * (-499.617) (-502.526) (-497.239) [-498.497] -- 0:00:26
      559000 -- (-498.550) (-499.170) (-497.854) [-500.703] * (-502.012) (-502.376) (-497.946) [-498.719] -- 0:00:26
      559500 -- [-499.747] (-497.335) (-497.736) (-500.499) * [-500.712] (-499.731) (-499.752) (-501.302) -- 0:00:26
      560000 -- (-500.294) [-502.082] (-498.597) (-502.464) * (-499.983) [-499.103] (-501.680) (-500.498) -- 0:00:26

      Average standard deviation of split frequencies: 0.010837

      560500 -- (-501.567) [-502.051] (-499.906) (-499.004) * [-500.948] (-497.806) (-501.227) (-500.218) -- 0:00:26
      561000 -- (-500.487) (-500.533) (-499.152) [-499.247] * (-498.740) (-497.383) [-501.083] (-499.698) -- 0:00:26
      561500 -- (-504.554) (-497.846) [-499.521] (-500.612) * [-498.726] (-504.390) (-498.225) (-500.060) -- 0:00:26
      562000 -- (-503.021) (-497.641) [-499.112] (-498.035) * (-502.586) (-500.092) (-499.223) [-499.474] -- 0:00:26
      562500 -- [-498.477] (-499.438) (-498.633) (-497.717) * (-499.963) (-498.710) (-501.250) [-497.425] -- 0:00:26
      563000 -- (-500.609) [-496.940] (-499.858) (-500.492) * (-497.610) (-500.927) (-500.116) [-496.809] -- 0:00:26
      563500 -- (-497.691) (-497.817) (-497.987) [-499.260] * (-498.218) (-497.724) (-500.063) [-501.635] -- 0:00:26
      564000 -- (-499.276) (-498.429) [-497.621] (-497.868) * (-497.428) (-498.740) [-499.457] (-498.489) -- 0:00:26
      564500 -- (-502.851) [-501.820] (-497.594) (-496.904) * [-499.182] (-499.540) (-499.685) (-499.746) -- 0:00:26
      565000 -- (-507.334) (-499.259) (-499.162) [-497.990] * [-497.505] (-500.850) (-500.922) (-496.650) -- 0:00:26

      Average standard deviation of split frequencies: 0.009731

      565500 -- (-500.804) (-500.735) (-497.976) [-498.326] * (-497.531) [-497.680] (-498.717) (-503.391) -- 0:00:26
      566000 -- (-503.068) [-500.282] (-497.953) (-498.517) * [-501.833] (-500.252) (-499.578) (-499.332) -- 0:00:26
      566500 -- (-503.076) [-498.656] (-500.839) (-499.745) * (-503.789) (-500.342) (-498.348) [-497.564] -- 0:00:26
      567000 -- [-499.194] (-498.604) (-498.239) (-498.639) * [-498.276] (-498.156) (-498.821) (-501.729) -- 0:00:25
      567500 -- (-500.018) (-503.434) [-497.544] (-499.831) * (-498.181) (-498.680) [-498.234] (-498.657) -- 0:00:25
      568000 -- (-498.808) [-500.400] (-498.958) (-506.596) * (-499.214) (-502.515) (-498.525) [-498.604] -- 0:00:25
      568500 -- (-499.124) (-499.418) (-498.666) [-500.599] * (-499.828) (-499.580) [-497.926] (-497.699) -- 0:00:25
      569000 -- (-498.501) (-499.540) [-499.665] (-497.857) * (-501.827) [-498.638] (-498.829) (-498.747) -- 0:00:25
      569500 -- (-499.044) (-498.626) (-500.226) [-498.526] * (-498.585) [-497.890] (-500.993) (-497.751) -- 0:00:25
      570000 -- [-497.601] (-499.617) (-501.157) (-498.032) * (-497.055) (-497.911) [-498.900] (-500.418) -- 0:00:25

      Average standard deviation of split frequencies: 0.010463

      570500 -- (-499.199) [-498.337] (-499.595) (-498.804) * (-498.525) [-503.390] (-499.370) (-504.304) -- 0:00:25
      571000 -- (-499.358) (-501.226) [-502.409] (-497.218) * (-497.835) (-497.384) [-499.219] (-501.361) -- 0:00:25
      571500 -- [-499.686] (-500.475) (-501.921) (-497.181) * (-499.005) (-506.287) [-498.699] (-497.525) -- 0:00:25
      572000 -- (-498.041) [-498.115] (-501.850) (-497.131) * (-498.626) (-498.201) (-501.530) [-501.976] -- 0:00:25
      572500 -- (-500.165) (-504.458) (-498.559) [-497.418] * [-498.354] (-500.153) (-499.418) (-502.165) -- 0:00:25
      573000 -- (-503.027) [-497.156] (-498.677) (-503.571) * (-498.627) (-497.449) [-499.271] (-499.020) -- 0:00:25
      573500 -- (-496.780) (-500.591) [-498.340] (-500.687) * [-497.800] (-498.908) (-497.358) (-500.569) -- 0:00:25
      574000 -- (-497.820) (-499.127) [-500.042] (-499.761) * [-498.249] (-497.617) (-502.527) (-498.374) -- 0:00:25
      574500 -- (-497.851) (-499.276) (-500.428) [-499.823] * [-497.627] (-499.093) (-499.112) (-499.671) -- 0:00:25
      575000 -- (-500.895) [-498.374] (-499.326) (-502.615) * [-499.181] (-499.995) (-500.479) (-499.344) -- 0:00:25

      Average standard deviation of split frequencies: 0.010730

      575500 -- (-499.280) (-498.188) (-498.345) [-499.782] * (-500.992) (-498.533) (-499.203) [-497.415] -- 0:00:25
      576000 -- (-497.908) (-497.383) [-497.858] (-499.016) * (-504.253) (-499.448) (-499.155) [-498.890] -- 0:00:25
      576500 -- (-504.976) [-497.628] (-502.056) (-498.798) * (-503.990) (-498.122) (-498.937) [-497.206] -- 0:00:25
      577000 -- (-502.216) (-497.360) [-498.117] (-498.779) * (-503.412) [-497.733] (-501.863) (-497.866) -- 0:00:25
      577500 -- (-499.822) (-500.431) [-499.944] (-497.587) * [-498.295] (-498.148) (-501.182) (-503.227) -- 0:00:25
      578000 -- (-497.624) (-498.927) [-499.980] (-500.916) * (-501.203) (-499.915) [-496.829] (-503.029) -- 0:00:25
      578500 -- (-503.426) [-497.588] (-501.878) (-497.142) * [-500.045] (-498.594) (-497.797) (-497.115) -- 0:00:25
      579000 -- (-499.202) (-501.987) [-499.612] (-497.100) * [-501.081] (-497.851) (-498.325) (-497.495) -- 0:00:25
      579500 -- (-499.658) (-498.057) [-498.417] (-498.862) * (-499.434) [-496.955] (-500.605) (-500.008) -- 0:00:25
      580000 -- (-498.897) [-500.309] (-498.486) (-500.176) * [-499.692] (-500.359) (-506.338) (-501.923) -- 0:00:25

      Average standard deviation of split frequencies: 0.010915

      580500 -- [-497.938] (-500.985) (-498.469) (-498.186) * (-499.476) (-504.591) [-497.780] (-498.574) -- 0:00:25
      581000 -- [-496.999] (-497.669) (-500.823) (-497.187) * (-499.067) (-502.322) (-501.040) [-498.620] -- 0:00:25
      581500 -- [-497.605] (-498.982) (-501.232) (-497.179) * (-497.119) (-501.281) [-499.339] (-504.252) -- 0:00:25
      582000 -- [-497.103] (-504.339) (-499.248) (-499.939) * (-498.029) [-498.757] (-499.101) (-502.211) -- 0:00:25
      582500 -- (-497.480) [-503.186] (-499.253) (-499.117) * [-499.300] (-498.751) (-501.494) (-504.110) -- 0:00:25
      583000 -- (-496.822) (-498.895) (-502.381) [-503.002] * [-497.513] (-497.642) (-501.223) (-499.820) -- 0:00:25
      583500 -- (-496.793) [-498.953] (-502.279) (-500.124) * (-498.950) (-499.778) [-500.825] (-497.780) -- 0:00:24
      584000 -- (-501.607) (-498.234) (-499.174) [-500.531] * (-498.130) (-498.455) [-498.189] (-498.006) -- 0:00:24
      584500 -- (-502.392) [-498.055] (-497.918) (-500.068) * (-498.537) (-497.945) [-499.163] (-498.279) -- 0:00:24
      585000 -- (-500.428) (-499.546) [-498.143] (-498.752) * (-497.340) (-500.345) [-497.648] (-497.503) -- 0:00:24

      Average standard deviation of split frequencies: 0.010905

      585500 -- (-500.160) (-498.696) [-501.099] (-498.897) * [-497.376] (-498.197) (-500.670) (-498.844) -- 0:00:24
      586000 -- (-500.620) [-498.744] (-502.643) (-498.368) * (-497.632) (-500.831) [-498.943] (-501.285) -- 0:00:24
      586500 -- (-505.969) (-499.193) (-498.271) [-501.091] * (-499.071) (-500.002) (-498.218) [-499.896] -- 0:00:24
      587000 -- (-497.802) (-502.460) [-500.516] (-497.952) * (-500.569) (-499.610) [-497.268] (-496.858) -- 0:00:24
      587500 -- (-498.179) (-499.905) [-500.597] (-500.782) * (-501.738) (-496.979) (-497.154) [-496.974] -- 0:00:24
      588000 -- (-499.323) (-499.011) (-497.539) [-499.892] * [-500.730] (-497.074) (-497.506) (-498.397) -- 0:00:24
      588500 -- (-497.592) (-498.525) [-496.897] (-498.415) * (-497.544) [-497.503] (-497.553) (-497.803) -- 0:00:24
      589000 -- (-499.438) (-498.124) (-499.747) [-498.591] * (-498.535) (-500.764) (-500.139) [-497.367] -- 0:00:24
      589500 -- (-500.111) (-500.271) (-500.077) [-498.107] * [-497.636] (-499.801) (-498.621) (-502.093) -- 0:00:24
      590000 -- (-499.584) (-499.903) [-499.522] (-497.958) * (-499.561) (-500.011) [-497.932] (-499.490) -- 0:00:24

      Average standard deviation of split frequencies: 0.010845

      590500 -- (-499.751) (-497.980) [-500.207] (-499.469) * (-499.329) [-498.793] (-501.239) (-499.363) -- 0:00:24
      591000 -- [-497.549] (-497.291) (-498.384) (-498.651) * (-500.980) (-501.666) (-500.756) [-497.434] -- 0:00:24
      591500 -- [-497.840] (-500.483) (-498.626) (-499.776) * [-500.774] (-500.920) (-499.346) (-499.011) -- 0:00:24
      592000 -- (-503.581) (-497.391) [-500.117] (-499.155) * [-497.478] (-500.087) (-500.198) (-501.592) -- 0:00:24
      592500 -- (-499.242) (-501.914) [-501.420] (-500.067) * (-499.569) (-497.872) (-498.924) [-500.772] -- 0:00:24
      593000 -- [-497.274] (-499.122) (-497.581) (-502.981) * (-497.368) [-497.461] (-500.089) (-499.778) -- 0:00:24
      593500 -- (-497.545) (-498.452) (-499.333) [-498.444] * (-497.806) (-503.037) [-497.570] (-500.871) -- 0:00:24
      594000 -- (-499.640) (-500.044) (-498.538) [-500.738] * [-501.782] (-500.963) (-499.577) (-498.341) -- 0:00:24
      594500 -- (-497.837) (-501.884) (-499.105) [-499.013] * (-499.070) [-500.744] (-497.436) (-499.485) -- 0:00:24
      595000 -- (-498.563) (-498.072) (-498.368) [-499.377] * [-499.882] (-496.879) (-498.786) (-498.922) -- 0:00:24

      Average standard deviation of split frequencies: 0.010748

      595500 -- [-498.400] (-497.072) (-501.897) (-506.718) * (-498.492) (-502.561) [-497.375] (-496.982) -- 0:00:24
      596000 -- (-501.245) (-500.183) (-501.168) [-501.248] * [-501.694] (-497.079) (-498.661) (-501.787) -- 0:00:24
      596500 -- (-502.005) (-501.047) [-498.706] (-500.513) * (-499.822) (-500.161) (-498.351) [-501.345] -- 0:00:24
      597000 -- (-499.423) (-501.275) (-503.879) [-499.824] * (-500.154) (-498.335) [-498.907] (-499.596) -- 0:00:24
      597500 -- (-498.913) (-498.764) [-497.801] (-505.128) * (-499.640) (-497.907) [-498.637] (-498.368) -- 0:00:24
      598000 -- (-499.785) (-498.095) (-499.072) [-500.052] * (-500.597) [-497.984] (-497.518) (-498.276) -- 0:00:24
      598500 -- (-498.935) (-499.719) (-497.874) [-496.956] * (-497.620) (-500.464) [-497.733] (-496.778) -- 0:00:24
      599000 -- (-500.136) [-497.512] (-499.479) (-497.054) * (-501.054) [-502.367] (-498.717) (-497.715) -- 0:00:24
      599500 -- (-500.411) [-502.018] (-498.807) (-499.074) * (-502.927) (-500.132) [-497.088] (-497.386) -- 0:00:24
      600000 -- (-498.200) [-501.599] (-501.732) (-499.422) * (-497.562) (-500.208) (-500.108) [-497.917] -- 0:00:24

      Average standard deviation of split frequencies: 0.010526

      600500 -- (-499.170) (-497.936) (-498.300) [-499.797] * [-501.746] (-500.097) (-500.246) (-497.533) -- 0:00:23
      601000 -- [-499.540] (-499.826) (-499.012) (-497.342) * (-498.851) [-499.809] (-502.033) (-497.724) -- 0:00:23
      601500 -- [-499.983] (-498.429) (-500.107) (-496.989) * (-498.469) (-500.517) (-498.888) [-500.870] -- 0:00:23
      602000 -- [-497.012] (-501.658) (-499.923) (-497.916) * [-500.626] (-501.203) (-500.377) (-501.157) -- 0:00:23
      602500 -- [-499.235] (-498.333) (-502.110) (-498.606) * (-497.927) [-498.888] (-499.973) (-499.806) -- 0:00:23
      603000 -- [-500.006] (-498.677) (-498.466) (-499.583) * [-497.560] (-497.536) (-500.206) (-498.197) -- 0:00:23
      603500 -- (-496.902) (-501.665) [-500.288] (-501.771) * [-497.603] (-498.597) (-499.346) (-497.998) -- 0:00:23
      604000 -- (-496.936) (-501.368) [-497.296] (-499.527) * (-498.503) (-499.453) (-497.709) [-498.887] -- 0:00:23
      604500 -- (-496.914) [-500.854] (-500.153) (-501.828) * [-498.339] (-500.948) (-497.359) (-501.633) -- 0:00:23
      605000 -- [-497.654] (-499.544) (-499.918) (-502.032) * (-504.397) (-499.580) [-500.185] (-498.024) -- 0:00:23

      Average standard deviation of split frequencies: 0.010113

      605500 -- (-498.138) (-497.535) (-499.405) [-497.404] * [-497.454] (-500.249) (-498.658) (-500.056) -- 0:00:23
      606000 -- (-502.142) [-498.563] (-499.220) (-499.454) * (-500.417) [-498.699] (-502.442) (-498.520) -- 0:00:23
      606500 -- (-498.484) (-498.459) [-498.704] (-497.995) * (-498.882) (-498.373) (-504.258) [-499.115] -- 0:00:23
      607000 -- (-497.534) [-498.969] (-499.881) (-497.314) * [-498.229] (-500.230) (-501.124) (-498.627) -- 0:00:23
      607500 -- (-499.405) [-497.752] (-499.529) (-497.291) * [-496.983] (-504.356) (-499.329) (-499.776) -- 0:00:23
      608000 -- (-501.254) (-497.586) (-498.627) [-498.887] * [-500.642] (-505.471) (-502.303) (-497.744) -- 0:00:23
      608500 -- [-498.342] (-498.691) (-501.181) (-501.641) * (-503.578) (-502.005) (-501.076) [-499.644] -- 0:00:23
      609000 -- [-499.725] (-501.477) (-506.406) (-499.198) * (-496.832) [-498.264] (-502.242) (-499.769) -- 0:00:23
      609500 -- (-499.542) (-504.127) [-497.214] (-498.913) * [-497.060] (-498.759) (-498.630) (-499.042) -- 0:00:23
      610000 -- (-499.045) [-500.046] (-497.658) (-499.380) * (-497.871) (-501.765) [-498.324] (-499.162) -- 0:00:23

      Average standard deviation of split frequencies: 0.010262

      610500 -- [-498.534] (-497.759) (-499.519) (-499.779) * [-497.445] (-499.412) (-498.207) (-503.948) -- 0:00:23
      611000 -- (-501.278) (-502.901) [-501.592] (-499.028) * (-497.415) [-499.284] (-504.257) (-499.643) -- 0:00:23
      611500 -- (-501.066) [-498.370] (-498.477) (-500.466) * (-497.307) [-503.732] (-501.243) (-502.719) -- 0:00:23
      612000 -- (-500.913) (-499.210) [-498.503] (-497.611) * [-498.143] (-499.643) (-498.706) (-500.548) -- 0:00:23
      612500 -- (-497.433) (-498.445) [-499.049] (-497.726) * (-500.860) (-498.736) [-498.280] (-506.295) -- 0:00:23
      613000 -- [-500.670] (-501.304) (-498.397) (-498.293) * (-497.329) [-497.044] (-499.873) (-499.406) -- 0:00:23
      613500 -- (-498.445) [-500.120] (-503.160) (-499.692) * (-498.435) [-500.206] (-497.463) (-499.220) -- 0:00:23
      614000 -- [-497.626] (-498.545) (-498.133) (-498.018) * (-499.367) [-501.660] (-497.219) (-501.408) -- 0:00:23
      614500 -- (-498.381) [-498.361] (-499.766) (-499.098) * (-501.375) (-501.942) [-497.940] (-498.505) -- 0:00:23
      615000 -- (-498.472) [-497.583] (-502.761) (-498.752) * (-502.429) [-500.084] (-499.009) (-497.478) -- 0:00:23

      Average standard deviation of split frequencies: 0.010129

      615500 -- (-499.734) [-497.766] (-501.246) (-503.102) * (-499.777) (-498.462) (-498.402) [-496.709] -- 0:00:23
      616000 -- (-499.183) [-500.783] (-499.381) (-502.957) * (-498.754) [-500.512] (-498.716) (-497.291) -- 0:00:23
      616500 -- (-505.173) [-499.330] (-499.219) (-498.308) * [-497.729] (-501.205) (-503.554) (-497.006) -- 0:00:23
      617000 -- (-498.880) (-507.799) (-499.093) [-503.484] * (-497.892) (-498.179) (-497.671) [-496.878] -- 0:00:22
      617500 -- (-499.418) [-504.416] (-498.286) (-500.626) * [-499.804] (-501.248) (-499.074) (-498.391) -- 0:00:22
      618000 -- [-497.424] (-499.470) (-498.719) (-498.895) * (-501.686) (-499.107) (-499.947) [-501.758] -- 0:00:22
      618500 -- (-500.801) (-499.551) (-499.783) [-497.420] * [-500.157] (-499.248) (-504.634) (-497.713) -- 0:00:22
      619000 -- (-499.576) [-501.632] (-503.871) (-499.366) * [-498.332] (-500.060) (-505.415) (-500.379) -- 0:00:22
      619500 -- (-498.554) [-501.979] (-501.946) (-500.709) * (-497.680) (-504.512) [-501.429] (-497.651) -- 0:00:22
      620000 -- (-497.921) [-498.668] (-497.270) (-498.506) * (-497.406) (-499.165) [-504.852] (-501.900) -- 0:00:22

      Average standard deviation of split frequencies: 0.010008

      620500 -- (-498.512) (-498.580) (-497.665) [-496.936] * (-497.630) (-497.306) (-499.714) [-498.962] -- 0:00:22
      621000 -- (-499.233) (-497.289) [-498.840] (-497.826) * (-498.050) (-497.306) [-503.844] (-498.604) -- 0:00:22
      621500 -- (-500.760) (-497.822) (-498.994) [-499.078] * (-499.082) (-497.614) (-499.281) [-499.188] -- 0:00:22
      622000 -- (-500.628) (-498.145) [-501.470] (-500.329) * (-497.398) [-498.224] (-498.041) (-498.113) -- 0:00:22
      622500 -- (-499.578) [-499.837] (-498.090) (-498.049) * [-498.295] (-497.344) (-497.729) (-500.272) -- 0:00:22
      623000 -- [-498.499] (-498.924) (-497.957) (-499.833) * [-498.799] (-498.847) (-498.622) (-499.162) -- 0:00:22
      623500 -- (-506.965) [-497.489] (-498.322) (-498.906) * (-498.880) [-498.193] (-502.103) (-499.771) -- 0:00:22
      624000 -- (-505.469) [-498.255] (-497.730) (-497.453) * (-497.741) (-499.946) [-498.092] (-498.051) -- 0:00:22
      624500 -- (-501.002) [-500.312] (-497.225) (-501.471) * (-497.338) (-500.643) [-498.117] (-498.062) -- 0:00:22
      625000 -- (-498.652) (-499.082) [-497.303] (-497.841) * (-497.526) (-499.915) [-497.916] (-499.794) -- 0:00:22

      Average standard deviation of split frequencies: 0.010188

      625500 -- (-501.502) (-499.115) [-499.203] (-498.995) * (-498.846) (-497.042) [-498.519] (-502.487) -- 0:00:22
      626000 -- (-499.305) (-497.933) [-499.916] (-497.966) * (-498.782) (-498.176) [-498.637] (-499.112) -- 0:00:22
      626500 -- (-499.333) (-501.035) [-498.954] (-499.359) * (-498.748) (-497.692) (-499.908) [-497.898] -- 0:00:22
      627000 -- (-498.091) (-499.533) [-498.561] (-497.805) * (-496.837) (-500.463) (-499.447) [-497.119] -- 0:00:22
      627500 -- (-500.206) (-497.800) (-498.598) [-498.520] * [-498.447] (-498.343) (-498.430) (-499.694) -- 0:00:22
      628000 -- (-497.413) (-499.839) [-497.554] (-502.195) * (-505.369) [-499.513] (-498.248) (-500.795) -- 0:00:22
      628500 -- (-496.732) (-497.288) [-500.525] (-498.910) * (-504.086) [-500.545] (-500.787) (-499.388) -- 0:00:22
      629000 -- (-497.623) (-500.418) [-498.117] (-500.436) * (-502.904) (-501.369) (-499.925) [-497.592] -- 0:00:22
      629500 -- [-499.428] (-499.483) (-500.578) (-500.782) * [-500.715] (-498.334) (-499.490) (-498.016) -- 0:00:22
      630000 -- [-500.503] (-498.394) (-500.168) (-501.103) * (-500.201) (-499.194) [-500.144] (-498.506) -- 0:00:22

      Average standard deviation of split frequencies: 0.010423

      630500 -- (-499.871) (-500.706) [-498.287] (-499.350) * (-497.776) (-497.330) (-497.491) [-497.181] -- 0:00:22
      631000 -- (-498.771) (-504.542) [-500.343] (-498.556) * (-499.000) (-498.773) [-498.181] (-498.131) -- 0:00:22
      631500 -- (-497.702) [-497.316] (-499.933) (-497.127) * [-497.548] (-500.835) (-497.889) (-498.773) -- 0:00:22
      632000 -- [-500.004] (-497.695) (-499.212) (-498.682) * [-501.211] (-500.782) (-500.301) (-499.489) -- 0:00:22
      632500 -- (-498.087) (-500.151) [-498.294] (-497.661) * (-503.236) (-502.235) (-499.995) [-499.363] -- 0:00:22
      633000 -- (-497.246) (-499.141) (-498.306) [-497.471] * (-499.520) [-498.376] (-499.701) (-499.430) -- 0:00:22
      633500 -- [-497.420] (-497.725) (-496.949) (-503.057) * (-497.892) (-498.490) [-499.528] (-498.620) -- 0:00:21
      634000 -- (-497.322) (-498.107) (-497.482) [-502.017] * (-500.351) (-498.545) (-501.743) [-500.713] -- 0:00:21
      634500 -- (-499.720) (-498.142) [-497.410] (-497.164) * (-504.040) [-498.238] (-505.819) (-497.871) -- 0:00:21
      635000 -- (-501.978) (-499.466) (-502.593) [-499.696] * [-498.764] (-500.283) (-505.143) (-499.427) -- 0:00:21

      Average standard deviation of split frequencies: 0.009810

      635500 -- [-499.868] (-499.603) (-504.489) (-499.196) * (-498.415) [-502.647] (-499.220) (-498.734) -- 0:00:21
      636000 -- [-498.824] (-505.222) (-500.189) (-498.703) * [-498.265] (-497.883) (-497.337) (-498.420) -- 0:00:21
      636500 -- (-498.298) (-502.101) (-499.249) [-497.682] * (-499.536) (-499.131) (-499.054) [-503.875] -- 0:00:21
      637000 -- (-498.009) (-498.150) [-498.327] (-499.900) * (-498.630) (-498.844) (-498.322) [-499.732] -- 0:00:21
      637500 -- (-501.197) (-499.564) [-500.079] (-497.266) * (-498.849) (-499.672) (-497.018) [-497.739] -- 0:00:21
      638000 -- [-498.128] (-502.324) (-500.530) (-501.460) * (-497.547) [-497.684] (-502.759) (-500.221) -- 0:00:21
      638500 -- (-499.607) (-498.800) (-502.091) [-499.935] * [-499.307] (-506.379) (-500.554) (-497.978) -- 0:00:21
      639000 -- [-497.862] (-499.120) (-500.953) (-500.223) * (-497.135) [-497.313] (-500.849) (-500.567) -- 0:00:21
      639500 -- (-498.385) [-498.462] (-499.603) (-498.843) * (-502.169) (-499.612) (-497.708) [-501.864] -- 0:00:21
      640000 -- (-497.659) [-499.191] (-498.017) (-504.950) * (-503.833) (-503.511) [-498.493] (-497.085) -- 0:00:21

      Average standard deviation of split frequencies: 0.009912

      640500 -- [-498.145] (-502.346) (-496.946) (-500.697) * (-497.605) (-499.904) [-497.862] (-500.717) -- 0:00:21
      641000 -- [-502.112] (-497.635) (-497.088) (-508.011) * (-498.040) [-501.444] (-501.120) (-501.835) -- 0:00:21
      641500 -- (-499.847) (-499.125) [-499.155] (-500.500) * [-498.013] (-499.780) (-497.845) (-502.304) -- 0:00:21
      642000 -- (-497.820) [-499.095] (-500.424) (-499.674) * (-499.154) (-500.295) (-497.549) [-499.618] -- 0:00:21
      642500 -- (-500.290) (-499.913) (-497.247) [-499.584] * (-499.123) [-498.007] (-497.280) (-499.326) -- 0:00:21
      643000 -- (-498.540) [-498.117] (-498.251) (-501.338) * [-497.102] (-497.364) (-498.076) (-499.727) -- 0:00:21
      643500 -- (-498.835) [-499.331] (-498.023) (-497.658) * [-501.867] (-502.499) (-500.616) (-499.072) -- 0:00:21
      644000 -- (-498.984) [-500.227] (-497.163) (-497.192) * (-499.980) (-501.604) (-499.545) [-502.336] -- 0:00:21
      644500 -- (-498.361) (-500.998) [-498.493] (-499.321) * (-502.237) (-500.198) (-498.212) [-498.530] -- 0:00:21
      645000 -- (-501.878) (-498.368) [-498.484] (-498.802) * (-504.336) (-498.645) [-498.943] (-497.022) -- 0:00:21

      Average standard deviation of split frequencies: 0.011108

      645500 -- (-500.535) (-500.509) [-498.472] (-498.192) * (-503.396) (-498.458) (-500.151) [-498.443] -- 0:00:21
      646000 -- (-502.164) (-497.617) [-500.076] (-501.606) * (-501.168) (-498.288) [-498.465] (-501.595) -- 0:00:21
      646500 -- [-498.917] (-498.965) (-503.250) (-498.375) * (-497.686) (-501.334) (-499.013) [-499.881] -- 0:00:21
      647000 -- (-498.972) (-500.081) (-501.114) [-501.877] * (-498.673) [-496.821] (-499.372) (-498.075) -- 0:00:21
      647500 -- [-498.041] (-501.955) (-504.258) (-499.197) * [-499.173] (-497.591) (-499.838) (-497.387) -- 0:00:21
      648000 -- (-500.191) (-498.152) [-499.711] (-497.403) * [-500.127] (-499.585) (-498.743) (-500.631) -- 0:00:21
      648500 -- [-498.486] (-497.342) (-497.568) (-497.526) * (-498.143) (-500.320) (-498.492) [-497.772] -- 0:00:21
      649000 -- [-499.792] (-499.773) (-497.958) (-497.733) * (-497.634) (-498.879) [-500.505] (-499.941) -- 0:00:21
      649500 -- (-504.876) [-497.723] (-499.804) (-497.352) * [-497.205] (-501.054) (-500.574) (-498.989) -- 0:00:21
      650000 -- (-498.186) [-498.842] (-500.193) (-499.151) * (-496.908) (-500.352) [-497.061] (-500.071) -- 0:00:21

      Average standard deviation of split frequencies: 0.010827

      650500 -- (-498.668) (-501.119) (-499.822) [-498.649] * (-502.021) (-497.579) [-498.415] (-501.786) -- 0:00:20
      651000 -- (-498.116) (-498.284) (-498.886) [-498.368] * [-500.455] (-498.970) (-498.735) (-501.898) -- 0:00:20
      651500 -- (-497.401) [-498.726] (-499.447) (-499.548) * (-498.480) [-498.165] (-499.217) (-501.735) -- 0:00:20
      652000 -- (-501.036) (-499.523) (-500.048) [-500.932] * (-497.980) (-499.097) [-498.011] (-499.241) -- 0:00:20
      652500 -- (-498.042) [-499.023] (-500.667) (-497.687) * (-498.447) (-497.394) [-500.473] (-498.376) -- 0:00:20
      653000 -- (-497.397) (-498.802) (-499.794) [-497.518] * (-498.285) [-498.118] (-497.743) (-499.329) -- 0:00:20
      653500 -- (-498.614) [-498.263] (-498.373) (-500.269) * (-498.667) [-499.608] (-500.003) (-498.923) -- 0:00:20
      654000 -- [-498.933] (-499.428) (-497.666) (-498.162) * (-498.235) (-501.171) [-498.617] (-498.549) -- 0:00:20
      654500 -- (-502.252) (-499.261) [-498.313] (-499.468) * (-497.931) [-498.657] (-499.178) (-498.211) -- 0:00:20
      655000 -- (-503.078) (-501.264) (-499.963) [-497.417] * (-499.191) (-500.114) (-498.587) [-497.651] -- 0:00:20

      Average standard deviation of split frequencies: 0.011098

      655500 -- [-498.651] (-501.710) (-499.966) (-498.666) * (-499.295) [-497.229] (-498.968) (-497.591) -- 0:00:20
      656000 -- (-498.637) (-499.944) [-496.809] (-497.576) * (-498.576) (-500.177) (-499.344) [-502.991] -- 0:00:20
      656500 -- (-501.153) [-498.599] (-499.850) (-500.016) * [-499.365] (-498.934) (-499.638) (-499.676) -- 0:00:20
      657000 -- (-499.494) [-498.164] (-498.756) (-501.569) * (-498.465) [-497.552] (-497.819) (-504.742) -- 0:00:20
      657500 -- (-499.411) (-498.705) (-500.392) [-500.551] * [-500.363] (-497.438) (-498.228) (-498.198) -- 0:00:20
      658000 -- (-498.526) [-498.841] (-499.938) (-498.484) * (-499.208) (-497.307) [-497.731] (-498.924) -- 0:00:20
      658500 -- (-499.644) (-497.493) (-499.941) [-497.650] * (-500.818) (-497.282) (-499.164) [-498.404] -- 0:00:20
      659000 -- [-497.837] (-498.485) (-498.405) (-498.332) * (-498.510) [-497.983] (-499.671) (-503.858) -- 0:00:20
      659500 -- (-498.631) (-497.861) (-501.170) [-497.246] * (-502.908) [-499.747] (-500.767) (-498.760) -- 0:00:20
      660000 -- (-497.588) [-498.482] (-498.530) (-498.628) * (-497.783) [-500.181] (-503.401) (-497.791) -- 0:00:20

      Average standard deviation of split frequencies: 0.010031

      660500 -- (-498.131) (-498.332) (-496.990) [-498.837] * (-498.009) [-499.920] (-503.687) (-497.859) -- 0:00:20
      661000 -- (-498.370) (-500.376) [-498.255] (-499.767) * (-498.169) [-499.166] (-500.056) (-497.592) -- 0:00:20
      661500 -- (-500.042) (-503.788) (-502.681) [-499.727] * (-499.031) (-497.783) (-498.811) [-500.525] -- 0:00:20
      662000 -- (-503.628) [-499.420] (-502.066) (-498.505) * (-497.430) [-497.995] (-499.174) (-501.371) -- 0:00:20
      662500 -- [-498.516] (-509.500) (-500.175) (-498.207) * (-497.849) (-500.799) [-498.691] (-499.898) -- 0:00:20
      663000 -- (-497.278) (-497.957) (-500.889) [-499.289] * (-498.738) (-498.775) [-499.570] (-502.327) -- 0:00:20
      663500 -- (-497.885) (-503.268) [-497.245] (-498.733) * (-499.937) (-497.103) [-500.474] (-499.850) -- 0:00:20
      664000 -- (-501.888) (-503.958) (-499.293) [-499.783] * (-502.169) [-501.511] (-497.660) (-501.332) -- 0:00:20
      664500 -- [-496.971] (-506.978) (-501.525) (-498.104) * (-501.894) [-497.365] (-498.522) (-506.217) -- 0:00:20
      665000 -- (-500.573) (-507.582) [-499.973] (-497.750) * (-503.961) [-502.238] (-498.251) (-501.236) -- 0:00:20

      Average standard deviation of split frequencies: 0.010499

      665500 -- (-499.893) (-499.100) (-497.404) [-497.247] * (-501.772) (-497.915) [-498.376] (-502.515) -- 0:00:20
      666000 -- (-499.115) [-497.987] (-498.653) (-499.308) * (-497.324) (-497.887) [-500.409] (-502.047) -- 0:00:20
      666500 -- (-498.042) (-498.734) (-498.631) [-499.986] * (-499.178) (-496.950) (-498.992) [-497.275] -- 0:00:20
      667000 -- (-497.257) [-498.179] (-499.334) (-504.642) * (-496.990) (-497.778) [-498.224] (-500.909) -- 0:00:19
      667500 -- (-496.986) (-499.817) [-499.663] (-499.481) * (-499.383) (-500.036) (-500.581) [-497.925] -- 0:00:19
      668000 -- (-497.129) [-498.715] (-500.667) (-498.276) * [-497.405] (-498.170) (-498.548) (-499.578) -- 0:00:19
      668500 -- [-498.083] (-498.402) (-498.031) (-500.009) * (-500.833) [-497.403] (-500.135) (-502.550) -- 0:00:19
      669000 -- (-498.575) (-500.783) [-497.679] (-498.340) * (-503.984) (-500.439) [-498.467] (-500.667) -- 0:00:19
      669500 -- (-500.260) (-500.666) (-498.047) [-498.367] * (-497.570) (-500.252) [-502.432] (-499.764) -- 0:00:19
      670000 -- [-498.841] (-506.706) (-498.398) (-500.975) * (-500.939) (-499.997) (-498.633) [-498.783] -- 0:00:19

      Average standard deviation of split frequencies: 0.010006

      670500 -- [-497.030] (-500.179) (-499.398) (-498.076) * (-500.663) [-499.640] (-498.711) (-501.850) -- 0:00:19
      671000 -- (-496.904) [-497.864] (-500.192) (-497.928) * (-500.625) [-499.437] (-498.858) (-505.908) -- 0:00:19
      671500 -- [-498.521] (-501.777) (-499.126) (-501.290) * [-499.407] (-500.770) (-500.507) (-501.302) -- 0:00:19
      672000 -- (-498.327) (-499.717) [-497.709] (-501.975) * (-498.745) (-499.999) [-500.541] (-501.881) -- 0:00:19
      672500 -- (-500.898) (-501.218) (-501.014) [-499.103] * (-496.633) (-498.158) [-498.063] (-500.103) -- 0:00:19
      673000 -- (-500.107) (-505.867) [-498.339] (-508.225) * [-497.287] (-502.175) (-503.442) (-498.126) -- 0:00:19
      673500 -- (-499.482) (-497.932) (-498.702) [-503.042] * [-500.563] (-497.836) (-500.920) (-498.093) -- 0:00:19
      674000 -- (-501.182) (-497.418) [-497.255] (-498.162) * (-500.751) (-496.982) (-500.904) [-498.352] -- 0:00:19
      674500 -- [-500.660] (-497.923) (-501.274) (-498.521) * (-501.311) [-498.077] (-499.549) (-498.044) -- 0:00:19
      675000 -- (-497.869) (-499.589) (-499.690) [-501.721] * (-497.306) [-498.804] (-501.941) (-500.144) -- 0:00:19

      Average standard deviation of split frequencies: 0.009640

      675500 -- (-499.818) (-497.381) (-499.203) [-500.006] * (-498.464) (-502.927) [-497.646] (-499.913) -- 0:00:19
      676000 -- [-498.352] (-498.293) (-498.939) (-501.737) * (-500.855) (-497.640) (-501.095) [-498.282] -- 0:00:19
      676500 -- [-498.964] (-499.444) (-499.379) (-498.753) * (-497.758) [-497.736] (-506.839) (-497.445) -- 0:00:19
      677000 -- (-500.425) [-497.585] (-499.133) (-497.143) * (-500.311) (-502.014) (-498.225) [-497.256] -- 0:00:19
      677500 -- (-501.653) (-501.865) (-500.185) [-499.302] * (-503.836) (-500.175) [-499.792] (-501.887) -- 0:00:19
      678000 -- (-499.553) (-499.669) [-500.440] (-497.756) * [-499.075] (-503.166) (-502.654) (-498.675) -- 0:00:19
      678500 -- (-497.227) (-500.696) (-499.262) [-500.585] * (-500.719) (-497.309) (-500.760) [-498.193] -- 0:00:19
      679000 -- [-497.132] (-501.459) (-497.680) (-497.884) * [-499.777] (-499.511) (-501.750) (-498.299) -- 0:00:19
      679500 -- (-500.266) (-499.877) (-498.574) [-498.416] * [-499.329] (-499.901) (-503.753) (-502.059) -- 0:00:19
      680000 -- (-504.671) (-502.175) [-501.268] (-498.112) * (-498.199) (-498.683) [-497.200] (-498.973) -- 0:00:19

      Average standard deviation of split frequencies: 0.009777

      680500 -- [-497.300] (-497.737) (-502.093) (-499.520) * (-498.615) (-497.506) (-500.057) [-498.559] -- 0:00:19
      681000 -- (-498.353) (-497.106) [-501.118] (-499.757) * (-500.440) (-499.338) [-499.949] (-497.725) -- 0:00:19
      681500 -- (-497.853) (-497.467) [-501.421] (-499.743) * (-497.361) [-499.685] (-498.162) (-497.310) -- 0:00:19
      682000 -- (-497.684) (-499.004) (-502.385) [-498.598] * (-498.096) (-501.364) [-497.156] (-496.997) -- 0:00:19
      682500 -- [-499.724] (-499.546) (-503.024) (-497.768) * [-499.813] (-500.108) (-499.462) (-497.731) -- 0:00:19
      683000 -- [-496.747] (-501.032) (-505.579) (-498.674) * (-499.856) [-498.198] (-502.506) (-497.997) -- 0:00:19
      683500 -- (-496.870) (-504.059) [-500.686] (-499.751) * (-497.442) (-499.481) (-499.075) [-498.720] -- 0:00:18
      684000 -- [-496.965] (-499.153) (-504.295) (-499.898) * (-498.983) (-498.232) (-497.202) [-499.018] -- 0:00:18
      684500 -- (-499.271) [-499.320] (-501.585) (-499.547) * [-498.432] (-498.052) (-500.318) (-498.991) -- 0:00:18
      685000 -- (-501.747) [-499.372] (-499.261) (-498.191) * [-498.632] (-499.772) (-499.489) (-497.291) -- 0:00:18

      Average standard deviation of split frequencies: 0.010025

      685500 -- (-502.966) [-499.061] (-504.753) (-500.541) * [-496.752] (-498.342) (-498.703) (-499.764) -- 0:00:18
      686000 -- [-500.112] (-496.966) (-499.639) (-500.885) * [-497.158] (-501.931) (-496.905) (-499.557) -- 0:00:18
      686500 -- (-498.300) [-498.160] (-496.952) (-498.062) * [-497.695] (-500.114) (-499.994) (-497.535) -- 0:00:18
      687000 -- (-498.020) (-497.995) [-497.668] (-499.440) * (-499.055) (-508.710) (-504.260) [-498.124] -- 0:00:18
      687500 -- (-497.033) (-499.083) (-497.908) [-498.122] * (-504.354) [-500.008] (-501.394) (-501.607) -- 0:00:18
      688000 -- (-499.534) (-499.605) [-497.863] (-497.878) * (-499.162) (-498.798) [-500.773] (-499.614) -- 0:00:18
      688500 -- (-497.913) (-501.072) (-499.365) [-498.962] * (-498.218) (-499.680) [-500.981] (-500.494) -- 0:00:18
      689000 -- [-497.118] (-499.500) (-499.960) (-498.306) * (-496.640) [-500.461] (-504.878) (-498.027) -- 0:00:18
      689500 -- (-498.430) (-500.344) [-500.743] (-497.650) * (-497.438) [-500.518] (-501.589) (-497.468) -- 0:00:18
      690000 -- (-501.306) [-499.332] (-501.321) (-498.041) * (-498.563) (-499.144) (-502.357) [-497.109] -- 0:00:18

      Average standard deviation of split frequencies: 0.010633

      690500 -- (-499.267) (-500.880) (-499.217) [-499.419] * (-497.479) (-498.750) [-497.506] (-499.294) -- 0:00:18
      691000 -- [-499.752] (-499.773) (-500.500) (-499.054) * (-499.311) (-498.665) (-498.635) [-499.718] -- 0:00:18
      691500 -- [-498.534] (-499.609) (-503.225) (-497.452) * (-499.716) [-499.369] (-499.578) (-498.056) -- 0:00:18
      692000 -- (-497.197) (-498.057) (-497.612) [-498.677] * [-497.994] (-498.725) (-499.827) (-497.353) -- 0:00:18
      692500 -- (-501.971) (-499.490) (-497.418) [-501.828] * (-501.955) (-501.113) [-501.858] (-500.681) -- 0:00:18
      693000 -- (-499.931) (-499.579) [-497.503] (-499.182) * (-499.597) (-497.838) (-498.956) [-502.582] -- 0:00:18
      693500 -- (-500.517) (-498.377) (-497.713) [-498.332] * (-499.061) (-498.589) (-497.682) [-497.392] -- 0:00:18
      694000 -- [-499.396] (-498.171) (-500.210) (-498.371) * [-498.446] (-499.313) (-499.111) (-503.006) -- 0:00:18
      694500 -- (-498.104) [-499.168] (-500.144) (-499.283) * [-500.562] (-508.894) (-500.219) (-500.926) -- 0:00:18
      695000 -- (-497.857) (-500.996) [-497.909] (-499.925) * (-504.265) (-500.194) (-502.264) [-496.862] -- 0:00:18

      Average standard deviation of split frequencies: 0.010409

      695500 -- [-498.011] (-502.440) (-499.430) (-498.430) * (-500.013) [-499.185] (-498.021) (-497.907) -- 0:00:18
      696000 -- (-498.424) (-499.193) [-499.168] (-499.600) * [-498.211] (-498.123) (-500.496) (-501.075) -- 0:00:18
      696500 -- (-498.178) (-499.285) [-500.320] (-497.581) * [-502.201] (-500.615) (-498.970) (-499.561) -- 0:00:18
      697000 -- (-497.563) [-500.316] (-501.305) (-497.047) * (-498.273) (-503.791) (-500.968) [-500.684] -- 0:00:18
      697500 -- (-502.064) (-499.601) (-497.676) [-497.261] * (-498.632) (-503.240) [-500.626] (-500.220) -- 0:00:18
      698000 -- (-500.508) (-498.660) [-499.097] (-502.171) * [-497.375] (-501.240) (-498.422) (-497.236) -- 0:00:18
      698500 -- [-498.430] (-498.623) (-505.109) (-500.675) * (-499.080) [-497.512] (-498.451) (-501.601) -- 0:00:18
      699000 -- (-498.357) [-499.112] (-501.852) (-500.531) * (-499.117) (-497.857) (-498.698) [-499.719] -- 0:00:18
      699500 -- (-496.737) [-501.073] (-500.395) (-498.947) * (-497.582) [-497.448] (-496.831) (-497.427) -- 0:00:18
      700000 -- [-498.935] (-497.346) (-498.796) (-502.879) * (-497.358) (-497.452) [-499.377] (-498.346) -- 0:00:18

      Average standard deviation of split frequencies: 0.010340

      700500 -- (-500.149) [-498.014] (-498.447) (-500.484) * (-497.746) (-498.244) (-502.132) [-496.995] -- 0:00:17
      701000 -- (-499.354) (-497.167) (-498.200) [-498.781] * (-499.640) (-499.150) (-500.800) [-499.532] -- 0:00:17
      701500 -- (-499.575) (-497.640) [-498.001] (-498.277) * (-497.456) (-501.641) (-503.231) [-500.996] -- 0:00:17
      702000 -- (-500.696) [-498.551] (-502.207) (-499.264) * (-499.839) [-497.980] (-500.007) (-498.806) -- 0:00:17
      702500 -- [-499.055] (-499.141) (-499.085) (-498.648) * [-497.210] (-498.629) (-500.179) (-497.517) -- 0:00:17
      703000 -- (-502.180) (-502.718) (-505.626) [-498.344] * [-497.591] (-498.298) (-497.997) (-497.767) -- 0:00:17
      703500 -- (-499.946) (-498.768) [-498.686] (-498.040) * (-500.338) (-497.407) [-500.026] (-502.006) -- 0:00:17
      704000 -- (-498.805) [-497.213] (-497.192) (-502.523) * (-501.680) (-499.491) (-498.398) [-501.950] -- 0:00:17
      704500 -- [-501.092] (-499.971) (-500.010) (-503.128) * (-499.836) (-498.641) (-499.538) [-499.549] -- 0:00:17
      705000 -- (-500.895) (-499.892) [-499.855] (-502.672) * [-497.518] (-497.685) (-497.855) (-500.119) -- 0:00:17

      Average standard deviation of split frequencies: 0.009875

      705500 -- [-501.061] (-499.558) (-499.735) (-498.813) * [-498.164] (-498.837) (-497.782) (-499.265) -- 0:00:17
      706000 -- (-498.964) (-502.439) (-497.902) [-500.395] * [-499.692] (-499.266) (-500.156) (-499.610) -- 0:00:17
      706500 -- (-498.530) (-498.226) (-498.841) [-498.767] * (-498.304) [-503.941] (-500.859) (-502.684) -- 0:00:17
      707000 -- (-499.682) (-498.110) (-497.481) [-498.539] * [-498.290] (-499.622) (-498.758) (-498.969) -- 0:00:17
      707500 -- (-500.553) [-498.761] (-498.277) (-498.154) * (-498.980) (-497.278) [-500.863] (-497.430) -- 0:00:17
      708000 -- (-499.157) (-498.770) (-497.608) [-498.312] * (-502.667) (-497.971) (-500.140) [-498.795] -- 0:00:17
      708500 -- (-499.052) (-498.571) (-499.629) [-497.630] * (-501.164) (-500.744) (-498.849) [-498.312] -- 0:00:17
      709000 -- [-498.332] (-498.433) (-499.562) (-497.333) * (-500.386) (-502.298) [-499.739] (-500.652) -- 0:00:17
      709500 -- [-499.224] (-497.686) (-502.516) (-499.860) * (-501.420) (-499.692) [-497.988] (-503.758) -- 0:00:17
      710000 -- [-497.781] (-500.970) (-500.386) (-500.981) * (-499.535) [-498.038] (-498.316) (-499.340) -- 0:00:17

      Average standard deviation of split frequencies: 0.009740

      710500 -- (-498.468) (-498.924) [-498.185] (-500.106) * (-500.342) (-497.713) [-505.446] (-497.295) -- 0:00:17
      711000 -- (-497.496) (-501.124) (-498.558) [-499.873] * [-500.128] (-499.971) (-498.834) (-497.428) -- 0:00:17
      711500 -- (-497.218) (-498.814) [-498.780] (-499.278) * [-500.485] (-501.526) (-498.068) (-505.125) -- 0:00:17
      712000 -- (-504.310) (-502.970) (-500.884) [-497.040] * [-499.773] (-498.550) (-498.271) (-501.274) -- 0:00:17
      712500 -- (-500.019) [-499.180] (-502.843) (-501.190) * (-501.242) (-500.424) [-500.068] (-500.325) -- 0:00:17
      713000 -- [-499.470] (-501.639) (-498.636) (-502.645) * (-499.217) (-500.879) [-498.588] (-497.376) -- 0:00:17
      713500 -- (-497.966) (-498.562) (-501.147) [-502.081] * (-497.425) (-498.862) [-499.762] (-496.806) -- 0:00:17
      714000 -- (-497.678) [-498.732] (-498.126) (-497.750) * (-498.132) (-500.292) [-501.259] (-496.776) -- 0:00:17
      714500 -- [-497.752] (-498.908) (-500.804) (-506.471) * (-501.143) [-498.894] (-501.002) (-498.271) -- 0:00:17
      715000 -- (-497.878) (-499.163) (-502.114) [-504.398] * (-500.437) [-498.880] (-503.097) (-497.930) -- 0:00:17

      Average standard deviation of split frequencies: 0.009391

      715500 -- (-497.327) (-501.033) (-505.622) [-497.648] * (-499.553) [-497.995] (-498.832) (-500.287) -- 0:00:17
      716000 -- [-497.834] (-501.509) (-500.962) (-498.515) * (-500.172) (-497.571) (-501.565) [-499.080] -- 0:00:17
      716500 -- (-497.769) (-499.667) (-502.322) [-501.951] * (-500.244) (-498.358) (-506.384) [-499.500] -- 0:00:17
      717000 -- [-497.178] (-503.342) (-499.503) (-501.466) * [-497.913] (-498.607) (-501.625) (-498.619) -- 0:00:16
      717500 -- [-501.206] (-504.222) (-498.456) (-500.685) * (-498.731) (-501.285) (-502.154) [-500.156] -- 0:00:16
      718000 -- (-501.413) (-500.866) [-500.700] (-498.855) * (-500.755) (-497.266) [-498.275] (-505.283) -- 0:00:16
      718500 -- (-498.288) [-498.111] (-499.620) (-500.457) * (-499.268) [-498.342] (-497.851) (-503.129) -- 0:00:16
      719000 -- (-499.044) (-498.001) (-501.478) [-503.229] * (-499.501) [-497.015] (-499.137) (-500.233) -- 0:00:16
      719500 -- (-500.867) [-500.132] (-498.560) (-499.562) * (-504.249) (-497.108) [-497.722] (-501.831) -- 0:00:16
      720000 -- (-499.163) [-500.138] (-501.394) (-500.643) * (-503.858) [-497.108] (-497.835) (-498.104) -- 0:00:16

      Average standard deviation of split frequencies: 0.009605

      720500 -- (-497.936) (-499.328) (-499.843) [-499.577] * [-500.071] (-499.922) (-499.151) (-504.814) -- 0:00:16
      721000 -- (-498.985) [-499.903] (-500.778) (-499.280) * [-502.547] (-499.416) (-497.716) (-498.144) -- 0:00:16
      721500 -- (-499.223) (-499.942) [-498.161] (-499.964) * (-501.043) (-498.233) [-498.124] (-499.251) -- 0:00:16
      722000 -- (-498.287) (-497.676) (-498.759) [-498.552] * (-499.088) (-498.627) [-499.194] (-497.716) -- 0:00:16
      722500 -- (-498.942) [-499.357] (-499.576) (-501.694) * [-499.341] (-502.568) (-504.654) (-498.968) -- 0:00:16
      723000 -- (-501.193) (-498.697) [-498.270] (-501.014) * (-501.751) [-500.605] (-503.055) (-497.414) -- 0:00:16
      723500 -- (-497.671) (-498.184) (-499.179) [-499.002] * (-497.941) (-501.364) [-504.408] (-498.185) -- 0:00:16
      724000 -- (-500.804) (-496.737) (-498.876) [-503.211] * (-496.833) [-502.516] (-503.943) (-499.419) -- 0:00:16
      724500 -- (-502.156) [-497.264] (-498.471) (-506.843) * [-500.298] (-500.693) (-500.722) (-500.601) -- 0:00:16
      725000 -- (-498.383) (-503.352) (-498.353) [-497.403] * (-500.073) [-500.576] (-498.033) (-499.798) -- 0:00:16

      Average standard deviation of split frequencies: 0.009808

      725500 -- [-497.432] (-501.087) (-501.983) (-498.375) * (-500.462) (-501.281) (-501.115) [-498.614] -- 0:00:16
      726000 -- (-499.389) (-506.683) (-505.120) [-497.109] * (-500.081) [-497.857] (-502.293) (-499.698) -- 0:00:16
      726500 -- [-497.995] (-500.436) (-501.973) (-499.621) * (-498.060) (-498.578) (-498.022) [-501.544] -- 0:00:16
      727000 -- [-500.251] (-501.014) (-498.176) (-501.502) * [-499.367] (-500.965) (-497.947) (-499.017) -- 0:00:16
      727500 -- (-500.706) [-503.918] (-498.169) (-501.847) * (-499.535) (-499.653) (-497.692) [-499.785] -- 0:00:16
      728000 -- (-499.035) (-499.830) (-497.066) [-499.190] * [-498.662] (-498.074) (-502.324) (-499.499) -- 0:00:16
      728500 -- (-499.253) (-499.128) [-499.159] (-498.898) * (-499.573) (-499.045) (-500.809) [-498.100] -- 0:00:16
      729000 -- [-497.660] (-497.383) (-500.764) (-502.242) * (-502.982) [-498.106] (-501.390) (-499.057) -- 0:00:16
      729500 -- (-500.643) [-497.361] (-498.920) (-501.563) * (-499.694) [-496.874] (-499.088) (-500.182) -- 0:00:16
      730000 -- (-503.501) (-499.228) [-499.122] (-499.134) * (-500.081) [-501.881] (-499.803) (-498.879) -- 0:00:16

      Average standard deviation of split frequencies: 0.008638

      730500 -- (-499.113) [-498.964] (-500.385) (-501.107) * (-499.769) (-500.387) (-496.915) [-499.167] -- 0:00:16
      731000 -- (-500.452) [-496.862] (-502.468) (-502.709) * (-498.494) [-498.494] (-496.944) (-499.635) -- 0:00:16
      731500 -- (-500.664) [-498.839] (-505.936) (-497.918) * (-497.231) (-508.082) [-500.858] (-497.902) -- 0:00:16
      732000 -- (-501.045) [-497.653] (-501.052) (-498.590) * [-497.412] (-501.275) (-500.143) (-498.980) -- 0:00:16
      732500 -- [-500.294] (-500.454) (-497.936) (-504.320) * (-498.703) (-498.176) [-498.152] (-500.071) -- 0:00:16
      733000 -- (-498.487) (-498.694) [-497.803] (-504.394) * (-499.258) (-500.282) [-498.686] (-499.135) -- 0:00:16
      733500 -- [-499.412] (-498.772) (-499.078) (-501.329) * (-497.146) (-498.022) [-497.255] (-498.013) -- 0:00:15
      734000 -- (-498.119) (-504.147) [-497.216] (-499.246) * (-498.824) [-499.382] (-500.835) (-497.914) -- 0:00:15
      734500 -- (-500.059) (-499.235) [-499.868] (-502.110) * [-501.736] (-497.662) (-499.263) (-498.947) -- 0:00:15
      735000 -- (-497.690) (-499.130) [-501.319] (-499.103) * (-501.878) (-497.903) [-497.336] (-499.521) -- 0:00:15

      Average standard deviation of split frequencies: 0.009038

      735500 -- (-498.575) [-498.286] (-500.812) (-500.571) * (-497.569) (-500.523) (-497.780) [-497.398] -- 0:00:15
      736000 -- [-499.719] (-502.758) (-499.402) (-497.878) * (-498.074) (-498.989) (-497.082) [-497.480] -- 0:00:15
      736500 -- (-499.512) (-502.254) [-503.682] (-498.097) * (-500.179) [-499.429] (-498.385) (-499.690) -- 0:00:15
      737000 -- (-498.327) (-499.280) [-499.247] (-501.343) * (-500.392) (-501.733) [-499.969] (-499.256) -- 0:00:15
      737500 -- (-500.996) [-499.051] (-499.223) (-500.476) * [-498.674] (-500.587) (-498.370) (-501.186) -- 0:00:15
      738000 -- (-500.420) (-498.951) (-498.606) [-498.947] * (-499.530) [-500.007] (-499.683) (-499.260) -- 0:00:15
      738500 -- (-498.681) (-498.014) [-496.773] (-502.067) * (-499.818) (-499.526) (-499.515) [-499.692] -- 0:00:15
      739000 -- [-498.128] (-498.209) (-500.244) (-501.195) * (-500.076) [-501.229] (-498.539) (-499.222) -- 0:00:15
      739500 -- (-497.890) [-498.157] (-498.187) (-499.849) * (-497.364) [-497.979] (-497.867) (-496.979) -- 0:00:15
      740000 -- (-500.139) (-500.226) [-501.624] (-500.693) * [-498.614] (-498.845) (-500.704) (-499.815) -- 0:00:15

      Average standard deviation of split frequencies: 0.009441

      740500 -- (-501.128) (-500.619) (-498.072) [-498.181] * (-499.678) (-499.039) [-501.890] (-500.958) -- 0:00:15
      741000 -- (-499.692) (-503.016) (-498.341) [-498.273] * (-501.261) (-498.894) [-499.733] (-500.340) -- 0:00:15
      741500 -- (-498.606) (-498.700) [-498.392] (-497.491) * (-502.759) [-497.787] (-499.997) (-498.937) -- 0:00:15
      742000 -- (-498.057) (-500.590) [-498.522] (-500.065) * [-498.573] (-497.978) (-501.151) (-499.377) -- 0:00:15
      742500 -- (-498.030) (-498.181) [-496.883] (-499.255) * (-498.289) [-499.563] (-500.193) (-498.010) -- 0:00:15
      743000 -- (-497.228) [-497.710] (-500.732) (-499.678) * (-501.323) [-499.078] (-499.915) (-499.954) -- 0:00:15
      743500 -- [-497.855] (-499.057) (-501.847) (-499.260) * [-498.043] (-497.377) (-498.131) (-499.427) -- 0:00:15
      744000 -- [-500.434] (-500.089) (-497.803) (-497.291) * [-499.158] (-501.320) (-500.445) (-503.260) -- 0:00:15
      744500 -- (-514.295) (-497.830) (-497.286) [-499.359] * (-502.628) (-499.789) (-500.316) [-497.978] -- 0:00:15
      745000 -- [-496.922] (-500.204) (-500.091) (-499.675) * (-501.435) (-501.412) [-499.697] (-499.557) -- 0:00:15

      Average standard deviation of split frequencies: 0.009689

      745500 -- [-500.431] (-504.316) (-500.194) (-497.437) * (-501.149) (-499.109) [-497.294] (-497.366) -- 0:00:15
      746000 -- [-499.657] (-502.265) (-502.286) (-497.816) * [-497.853] (-505.228) (-500.169) (-498.105) -- 0:00:15
      746500 -- (-497.626) (-500.170) (-497.368) [-497.679] * (-499.587) [-502.015] (-499.529) (-498.865) -- 0:00:15
      747000 -- (-498.941) [-498.877] (-497.440) (-497.235) * [-501.562] (-501.181) (-498.258) (-505.799) -- 0:00:15
      747500 -- (-497.975) [-499.069] (-502.195) (-498.056) * (-497.578) (-498.877) (-500.283) [-501.442] -- 0:00:15
      748000 -- (-498.175) [-499.096] (-497.263) (-499.215) * (-499.293) (-500.294) (-499.959) [-498.841] -- 0:00:15
      748500 -- (-497.678) [-497.571] (-500.066) (-497.689) * (-502.737) (-499.665) (-498.629) [-499.626] -- 0:00:15
      749000 -- (-500.380) [-499.155] (-502.325) (-497.930) * (-499.852) (-499.646) (-498.043) [-507.802] -- 0:00:15
      749500 -- (-500.383) [-499.974] (-498.701) (-500.811) * (-498.047) (-498.180) (-500.719) [-498.192] -- 0:00:15
      750000 -- (-499.581) (-499.687) [-497.629] (-501.683) * (-498.901) [-500.337] (-497.042) (-499.258) -- 0:00:15

      Average standard deviation of split frequencies: 0.009943

      750500 -- [-497.397] (-500.288) (-498.461) (-500.466) * (-501.236) [-497.547] (-501.887) (-499.236) -- 0:00:14
      751000 -- [-502.619] (-498.659) (-499.859) (-498.254) * (-498.887) [-499.209] (-498.319) (-498.016) -- 0:00:14
      751500 -- [-504.201] (-501.220) (-501.438) (-498.054) * (-498.734) (-497.662) (-499.000) [-497.871] -- 0:00:14
      752000 -- [-497.226] (-499.146) (-498.319) (-499.989) * (-498.208) (-499.686) [-497.323] (-499.809) -- 0:00:14
      752500 -- (-501.791) (-501.369) (-498.537) [-500.020] * (-497.898) (-504.381) (-497.204) [-504.266] -- 0:00:14
      753000 -- (-498.762) (-503.405) (-502.284) [-500.033] * (-499.534) (-498.434) [-498.843] (-499.267) -- 0:00:14
      753500 -- (-498.240) (-504.157) (-501.000) [-498.883] * (-499.939) [-500.838] (-496.680) (-501.412) -- 0:00:14
      754000 -- [-500.814] (-505.971) (-503.019) (-498.196) * (-501.344) (-499.340) [-502.826] (-499.079) -- 0:00:14
      754500 -- (-498.966) [-498.119] (-500.032) (-497.578) * [-498.100] (-501.224) (-499.467) (-499.460) -- 0:00:14
      755000 -- (-498.576) (-497.592) (-498.296) [-498.576] * [-498.437] (-498.477) (-499.170) (-500.188) -- 0:00:14

      Average standard deviation of split frequencies: 0.009908

      755500 -- (-498.392) (-499.671) [-497.959] (-498.650) * (-497.837) (-498.396) (-498.937) [-499.968] -- 0:00:14
      756000 -- (-498.415) [-497.376] (-497.510) (-499.030) * (-500.209) (-499.654) [-497.909] (-501.098) -- 0:00:14
      756500 -- (-498.602) [-499.418] (-503.518) (-500.721) * (-499.274) [-500.382] (-499.833) (-498.977) -- 0:00:14
      757000 -- [-498.450] (-498.960) (-501.960) (-499.520) * (-503.284) (-498.400) [-503.437] (-501.722) -- 0:00:14
      757500 -- (-498.106) [-498.684] (-498.817) (-501.721) * (-499.549) (-497.761) (-499.951) [-497.472] -- 0:00:14
      758000 -- (-499.837) (-498.784) [-498.304] (-500.953) * [-497.432] (-499.300) (-497.909) (-501.528) -- 0:00:14
      758500 -- (-497.963) (-497.795) [-496.968] (-499.856) * (-499.983) (-499.015) [-498.650] (-497.687) -- 0:00:14
      759000 -- [-497.982] (-500.565) (-497.709) (-498.595) * (-499.489) [-500.379] (-498.593) (-498.011) -- 0:00:14
      759500 -- (-499.521) (-499.322) (-497.591) [-500.888] * (-501.255) (-497.630) [-500.357] (-498.762) -- 0:00:14
      760000 -- (-496.675) (-501.979) [-499.427] (-498.151) * [-499.435] (-498.840) (-500.797) (-501.044) -- 0:00:14

      Average standard deviation of split frequencies: 0.009778

      760500 -- [-498.238] (-498.879) (-498.233) (-499.139) * (-497.328) (-501.128) (-499.456) [-500.475] -- 0:00:14
      761000 -- (-499.481) (-502.471) (-497.081) [-500.998] * (-501.481) (-499.064) (-497.479) [-496.908] -- 0:00:14
      761500 -- [-497.731] (-498.009) (-497.943) (-497.347) * (-501.594) [-498.100] (-497.453) (-496.927) -- 0:00:14
      762000 -- (-498.604) [-499.104] (-503.677) (-499.833) * [-504.945] (-497.920) (-500.189) (-500.870) -- 0:00:14
      762500 -- [-498.943] (-501.387) (-499.340) (-506.220) * (-502.912) (-497.881) (-503.329) [-497.075] -- 0:00:14
      763000 -- (-499.778) (-504.460) (-498.242) [-499.216] * (-502.758) (-498.781) (-499.447) [-497.223] -- 0:00:14
      763500 -- (-498.422) (-503.479) [-498.857] (-498.845) * [-498.448] (-499.533) (-500.129) (-499.333) -- 0:00:14
      764000 -- (-497.906) (-502.309) (-500.956) [-500.832] * (-498.020) (-500.654) [-497.353] (-499.488) -- 0:00:14
      764500 -- (-498.307) (-498.614) [-497.598] (-499.348) * (-498.315) (-501.778) (-498.122) [-498.271] -- 0:00:14
      765000 -- (-506.778) [-500.887] (-497.630) (-500.344) * (-497.493) (-500.077) (-498.822) [-497.457] -- 0:00:14

      Average standard deviation of split frequencies: 0.009744

      765500 -- [-503.265] (-497.891) (-496.891) (-499.494) * (-500.423) (-498.944) (-499.172) [-497.209] -- 0:00:14
      766000 -- [-499.633] (-498.155) (-499.829) (-498.134) * (-498.963) (-497.597) (-501.225) [-497.969] -- 0:00:14
      766500 -- (-497.694) (-500.265) [-500.171] (-497.732) * (-497.409) [-498.871] (-502.929) (-497.665) -- 0:00:14
      767000 -- (-500.995) (-501.475) (-500.870) [-497.738] * (-499.529) [-498.029] (-501.567) (-497.775) -- 0:00:13
      767500 -- (-503.707) (-504.840) (-505.576) [-496.729] * (-502.228) (-499.518) (-503.797) [-498.225] -- 0:00:13
      768000 -- (-497.519) (-5