--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:02:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1601/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.34 -503.24
2 -498.32 -501.93
--------------------------------------
TOTAL -498.33 -502.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888159 0.091511 0.360387 1.507989 0.846695 1250.57 1375.78 1.000
r(A<->C){all} 0.158117 0.019518 0.000036 0.430564 0.119452 159.46 181.65 1.000
r(A<->G){all} 0.160248 0.018713 0.000084 0.434343 0.124168 178.59 289.32 1.001
r(A<->T){all} 0.167585 0.019467 0.000106 0.438838 0.131672 207.47 226.47 1.001
r(C<->G){all} 0.171949 0.020159 0.000015 0.469343 0.133989 353.35 354.18 1.000
r(C<->T){all} 0.178545 0.021979 0.000511 0.474935 0.138798 135.05 138.28 1.008
r(G<->T){all} 0.163556 0.019291 0.000054 0.443488 0.125110 188.51 212.18 1.009
pi(A){all} 0.174719 0.000373 0.137815 0.214599 0.174025 1282.00 1290.20 1.001
pi(C){all} 0.297434 0.000557 0.251474 0.345225 0.298029 1255.92 1316.84 1.000
pi(G){all} 0.268970 0.000540 0.224531 0.315153 0.268440 1303.54 1380.83 1.000
pi(T){all} 0.258877 0.000527 0.216353 0.306348 0.258117 1325.35 1340.74 1.000
alpha{1,2} 0.400447 0.225700 0.000204 1.349713 0.230246 1292.43 1381.88 1.001
alpha{3} 0.455155 0.232612 0.000259 1.418819 0.299917 1129.68 1156.68 1.000
pinvar{all} 0.995459 0.000032 0.985288 0.999992 0.997331 1250.63 1265.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -482.661467
Model 2: PositiveSelection -482.661466
Model 0: one-ratio -482.661465
Model 7: beta -482.661467
Model 8: beta&w>1 -482.661467
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 0.0
>C1
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C2
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C3
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C4
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C5
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C6
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=121
C1 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C2 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C3 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C4 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C5 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C6 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
**************************************************
C1 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C2 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C3 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C4 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C5 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C6 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
**************************************************
C1 RDDDLVTSVPPCGRASVVHRS
C2 RDDDLVTSVPPCGRASVVHRS
C3 RDDDLVTSVPPCGRASVVHRS
C4 RDDDLVTSVPPCGRASVVHRS
C5 RDDDLVTSVPPCGRASVVHRS
C6 RDDDLVTSVPPCGRASVVHRS
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3630]--->[3630]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.459 Mb, Max= 30.649 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C2 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C3 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C4 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C5 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
C6 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
**************************************************
C1 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C2 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C3 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C4 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C5 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
C6 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
**************************************************
C1 RDDDLVTSVPPCGRASVVHRS
C2 RDDDLVTSVPPCGRASVVHRS
C3 RDDDLVTSVPPCGRASVVHRS
C4 RDDDLVTSVPPCGRASVVHRS
C5 RDDDLVTSVPPCGRASVVHRS
C6 RDDDLVTSVPPCGRASVVHRS
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C2 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C3 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C4 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C5 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
C6 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
**************************************************
C1 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C2 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C3 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C4 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C5 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
C6 GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
**************************************************
C1 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C2 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C3 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C4 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C5 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
C6 TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
**************************************************
C1 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C2 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C3 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C4 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C5 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
C6 CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
**************************************************
C1 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C2 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C3 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C4 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C5 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
C6 GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
**************************************************
C1 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C2 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C3 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C4 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C5 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
C6 TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
**************************************************
C1 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C2 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C3 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C4 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C5 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
C6 CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
**************************************************
C1 GGTCCACCGGTCC
C2 GGTCCACCGGTCC
C3 GGTCCACCGGTCC
C4 GGTCCACCGGTCC
C5 GGTCCACCGGTCC
C6 GGTCCACCGGTCC
*************
>C1
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C2
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C3
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C4
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C5
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C6
GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT
GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT
TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT
CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA
GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA
TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC
CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT
GGTCCACCGGTCC
>C1
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C2
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C3
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C4
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C5
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
>C6
VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
RDDDLVTSVPPCGRASVVHRS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856451
Setting output file names to "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 948280401
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5166904393
Seed = 358619291
Swapseed = 1579856451
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -812.411402 -- -24.965149
Chain 2 -- -812.411402 -- -24.965149
Chain 3 -- -812.411278 -- -24.965149
Chain 4 -- -812.411402 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -812.411402 -- -24.965149
Chain 2 -- -812.411402 -- -24.965149
Chain 3 -- -812.411402 -- -24.965149
Chain 4 -- -812.411402 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-812.411] (-812.411) (-812.411) (-812.411) * [-812.411] (-812.411) (-812.411) (-812.411)
500 -- (-507.305) (-513.283) (-509.452) [-512.544] * (-510.330) [-504.084] (-509.514) (-510.148) -- 0:00:00
1000 -- (-510.039) (-511.688) [-509.521] (-510.225) * [-504.933] (-513.099) (-509.806) (-506.831) -- 0:00:00
1500 -- (-510.024) (-510.056) (-506.373) [-501.483] * (-507.786) (-505.717) [-504.248] (-510.105) -- 0:00:00
2000 -- (-508.596) (-506.765) (-510.745) [-508.045] * (-513.403) (-508.930) (-513.802) [-505.195] -- 0:00:00
2500 -- (-505.878) [-507.457] (-507.900) (-504.310) * (-513.554) (-505.642) (-510.787) [-509.414] -- 0:00:00
3000 -- (-526.161) (-509.595) (-508.883) [-504.972] * (-510.440) (-505.327) (-511.009) [-505.405] -- 0:00:00
3500 -- (-509.570) (-504.601) [-503.834] (-506.709) * (-507.895) (-516.809) [-503.285] (-507.415) -- 0:00:00
4000 -- (-506.790) (-509.206) [-501.062] (-518.792) * (-511.708) (-507.994) (-507.147) [-503.005] -- 0:00:00
4500 -- (-513.494) (-515.041) [-506.077] (-509.121) * (-510.328) (-513.547) (-503.796) [-505.608] -- 0:00:00
5000 -- (-512.415) [-505.591] (-509.786) (-508.452) * (-505.128) (-508.567) [-504.870] (-519.892) -- 0:00:00
Average standard deviation of split frequencies: 0.102479
5500 -- [-515.560] (-508.395) (-509.441) (-504.693) * (-508.571) [-509.762] (-505.046) (-507.831) -- 0:00:00
6000 -- (-510.128) (-505.214) (-504.788) [-503.610] * (-499.223) (-521.229) [-503.572] (-509.370) -- 0:00:00
6500 -- [-504.885] (-518.201) (-515.776) (-503.507) * (-504.729) (-508.282) [-506.431] (-509.562) -- 0:00:00
7000 -- [-515.025] (-506.210) (-506.538) (-510.148) * (-518.853) [-505.500] (-507.004) (-509.199) -- 0:00:00
7500 -- (-521.954) (-508.918) [-506.498] (-515.117) * (-507.414) (-510.592) (-505.234) [-503.859] -- 0:00:00
8000 -- (-513.113) (-505.028) [-502.838] (-509.154) * (-517.624) [-506.123] (-510.830) (-513.393) -- 0:00:00
8500 -- (-516.965) (-515.638) (-514.320) [-506.371] * (-512.750) (-510.838) [-502.864] (-508.710) -- 0:00:00
9000 -- (-508.323) (-507.505) (-509.159) [-504.939] * [-520.247] (-517.135) (-502.576) (-511.250) -- 0:00:00
9500 -- [-507.820] (-505.662) (-509.524) (-511.059) * (-505.785) (-511.512) (-509.566) [-505.579] -- 0:00:00
10000 -- (-512.481) (-504.580) (-515.262) [-505.008] * (-509.389) [-505.784] (-520.786) (-509.067) -- 0:00:00
Average standard deviation of split frequencies: 0.072318
10500 -- (-506.731) [-505.114] (-511.870) (-519.094) * (-508.787) (-509.414) (-506.875) [-502.359] -- 0:00:00
11000 -- (-503.534) [-501.730] (-511.183) (-504.614) * (-514.933) (-510.102) [-507.740] (-505.039) -- 0:01:29
11500 -- (-505.555) (-511.973) [-503.966] (-501.319) * (-507.325) (-506.075) (-506.857) [-507.290] -- 0:01:25
12000 -- (-506.324) (-512.619) [-508.130] (-500.703) * (-507.154) (-505.982) [-510.769] (-511.115) -- 0:01:22
12500 -- (-505.105) (-507.578) (-504.812) [-499.081] * (-507.950) (-515.601) (-509.256) [-502.003] -- 0:01:19
13000 -- (-509.034) (-511.219) (-509.495) [-498.809] * (-506.487) [-503.459] (-509.074) (-510.255) -- 0:01:15
13500 -- (-506.144) (-509.519) [-503.476] (-499.355) * (-514.232) (-505.307) [-502.815] (-511.229) -- 0:01:13
14000 -- [-506.027] (-512.578) (-505.921) (-498.420) * [-510.707] (-502.013) (-513.383) (-510.969) -- 0:01:10
14500 -- (-509.546) (-511.182) [-509.396] (-498.888) * [-508.614] (-516.889) (-504.023) (-508.737) -- 0:01:07
15000 -- (-511.898) [-512.308] (-505.791) (-500.275) * (-510.361) (-511.453) [-505.442] (-507.726) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-509.415) [-505.053] (-508.079) (-501.162) * (-506.477) [-503.447] (-510.470) (-512.720) -- 0:01:03
16000 -- (-514.398) [-505.471] (-505.938) (-497.663) * [-504.170] (-503.103) (-512.806) (-520.660) -- 0:01:01
16500 -- (-512.664) [-510.202] (-513.851) (-497.661) * (-516.835) [-506.568] (-509.326) (-505.388) -- 0:00:59
17000 -- [-508.860] (-510.261) (-514.981) (-497.724) * (-506.870) (-508.939) (-510.415) [-498.373] -- 0:00:57
17500 -- (-506.781) (-511.795) [-510.690] (-499.743) * (-505.050) (-504.623) (-504.419) [-498.256] -- 0:00:56
18000 -- (-511.010) [-509.400] (-505.044) (-498.367) * (-513.305) [-503.138] (-510.620) (-500.837) -- 0:00:54
18500 -- (-512.146) (-514.202) [-507.442] (-498.119) * (-507.953) [-508.750] (-509.714) (-500.025) -- 0:00:53
19000 -- (-509.612) (-508.210) [-507.593] (-497.950) * [-510.462] (-507.672) (-511.304) (-499.504) -- 0:00:51
19500 -- [-506.278] (-507.217) (-505.937) (-498.103) * (-504.429) (-509.566) (-507.023) [-500.648] -- 0:00:50
20000 -- (-511.263) (-506.653) [-504.229] (-499.001) * (-506.759) (-512.283) (-507.045) [-502.402] -- 0:00:49
Average standard deviation of split frequencies: 0.050689
20500 -- [-504.764] (-501.439) (-510.324) (-497.703) * [-510.727] (-509.410) (-510.635) (-500.960) -- 0:00:47
21000 -- (-513.551) (-501.383) [-505.948] (-500.077) * [-503.144] (-509.066) (-507.409) (-499.526) -- 0:00:46
21500 -- (-507.069) (-504.661) (-505.971) [-498.051] * (-506.197) (-506.429) (-510.942) [-498.525] -- 0:00:45
22000 -- (-506.374) (-514.028) (-510.205) [-498.187] * (-507.393) (-504.344) (-504.785) [-497.787] -- 0:00:44
22500 -- (-507.626) (-507.159) [-508.687] (-498.600) * [-510.495] (-518.001) (-508.936) (-498.572) -- 0:00:43
23000 -- (-514.491) (-504.802) [-500.370] (-500.327) * [-507.190] (-505.664) (-512.962) (-499.033) -- 0:00:42
23500 -- (-510.762) (-511.466) (-511.135) [-501.425] * (-507.195) (-505.477) (-515.386) [-499.989] -- 0:00:41
24000 -- [-501.802] (-516.342) (-511.930) (-497.779) * (-507.013) (-505.804) (-512.896) [-497.603] -- 0:00:40
24500 -- (-510.852) [-508.539] (-517.304) (-497.202) * (-510.252) [-507.639] (-513.876) (-501.809) -- 0:00:39
25000 -- [-505.223] (-519.613) (-514.987) (-497.356) * [-511.279] (-507.857) (-501.034) (-498.391) -- 0:00:39
Average standard deviation of split frequencies: 0.044032
25500 -- (-503.020) (-512.628) [-509.140] (-498.667) * [-502.102] (-510.093) (-498.561) (-497.611) -- 0:00:38
26000 -- [-505.994] (-515.111) (-509.637) (-498.749) * (-512.364) (-509.510) [-500.649] (-498.856) -- 0:00:37
26500 -- (-508.117) (-510.037) (-504.706) [-497.770] * (-505.818) [-507.449] (-500.765) (-500.609) -- 0:00:36
27000 -- (-510.331) [-508.167] (-519.338) (-501.054) * (-507.358) [-503.019] (-498.996) (-500.053) -- 0:00:36
27500 -- (-506.353) (-524.850) [-507.490] (-500.503) * (-517.480) (-502.568) (-501.467) [-501.557] -- 0:01:10
28000 -- [-504.048] (-516.855) (-516.094) (-499.552) * (-509.773) [-509.332] (-502.235) (-498.420) -- 0:01:09
28500 -- (-507.390) (-498.468) (-511.888) [-503.979] * [-505.442] (-508.137) (-500.337) (-498.505) -- 0:01:08
29000 -- (-507.782) [-496.953] (-503.718) (-497.314) * (-508.347) [-503.271] (-505.378) (-500.555) -- 0:01:06
29500 -- (-503.217) [-497.388] (-509.630) (-498.219) * (-507.630) [-510.629] (-500.795) (-499.052) -- 0:01:05
30000 -- (-507.317) (-497.485) [-503.855] (-498.370) * (-508.855) (-512.877) [-497.204] (-498.471) -- 0:01:04
Average standard deviation of split frequencies: 0.034085
30500 -- (-508.630) (-497.321) (-520.048) [-502.651] * (-504.637) (-516.795) [-499.232] (-497.510) -- 0:01:03
31000 -- [-508.166] (-498.840) (-506.913) (-497.585) * (-506.063) (-504.598) (-497.906) [-503.106] -- 0:01:02
31500 -- (-510.494) (-502.504) [-505.811] (-499.309) * (-510.879) (-507.537) [-501.178] (-502.391) -- 0:01:01
32000 -- (-510.654) (-498.588) [-503.047] (-500.710) * (-508.105) [-503.547] (-500.859) (-498.512) -- 0:01:00
32500 -- (-506.167) [-501.871] (-506.641) (-499.753) * (-513.665) (-505.503) [-498.556] (-500.233) -- 0:00:59
33000 -- (-508.159) (-499.459) [-506.560] (-499.803) * (-523.447) (-504.543) [-497.130] (-504.578) -- 0:00:58
33500 -- (-505.817) (-497.601) [-507.514] (-503.611) * (-509.096) (-504.162) (-501.533) [-502.443] -- 0:00:57
34000 -- [-507.636] (-499.319) (-508.992) (-497.678) * [-506.729] (-505.961) (-498.930) (-501.664) -- 0:00:56
34500 -- (-504.704) [-498.192] (-507.209) (-499.574) * (-506.675) (-507.577) (-498.467) [-497.937] -- 0:00:55
35000 -- [-507.490] (-502.881) (-519.995) (-497.937) * (-509.706) (-514.056) [-499.561] (-500.148) -- 0:00:55
Average standard deviation of split frequencies: 0.029307
35500 -- (-509.312) (-501.421) (-516.310) [-499.685] * (-512.285) (-514.419) [-499.219] (-498.216) -- 0:00:54
36000 -- [-504.550] (-500.804) (-501.079) (-503.968) * (-513.313) [-506.787] (-499.279) (-502.673) -- 0:00:53
36500 -- (-507.726) (-500.253) [-500.063] (-499.135) * (-510.293) (-511.434) (-501.571) [-499.027] -- 0:00:52
37000 -- (-518.288) (-497.444) [-498.308] (-497.134) * (-507.774) (-509.099) [-499.145] (-497.005) -- 0:00:52
37500 -- (-513.288) [-497.252] (-498.683) (-497.723) * (-501.167) [-505.964] (-500.035) (-499.221) -- 0:00:51
38000 -- (-506.516) [-499.187] (-498.611) (-498.957) * (-499.710) (-511.258) (-498.767) [-505.025] -- 0:00:50
38500 -- (-508.313) (-500.098) (-501.044) [-497.546] * (-501.365) (-512.189) (-499.189) [-500.413] -- 0:00:49
39000 -- (-515.755) [-501.245] (-497.552) (-497.346) * (-500.908) [-506.751] (-502.345) (-499.320) -- 0:00:49
39500 -- (-520.801) [-497.299] (-498.880) (-497.764) * (-505.217) (-511.502) [-500.221] (-499.650) -- 0:00:48
40000 -- (-507.806) (-501.664) [-498.057] (-497.074) * (-498.878) (-507.587) [-499.068] (-501.122) -- 0:00:48
Average standard deviation of split frequencies: 0.023866
40500 -- (-506.369) (-498.870) (-497.827) [-499.214] * (-497.419) (-503.903) (-499.296) [-497.932] -- 0:00:47
41000 -- [-503.446] (-497.839) (-498.029) (-498.867) * (-501.775) (-511.979) [-498.808] (-500.249) -- 0:00:46
41500 -- (-509.431) (-498.956) [-502.174] (-498.339) * [-499.202] (-506.911) (-500.108) (-505.004) -- 0:00:46
42000 -- (-509.837) (-505.376) [-498.853] (-499.399) * [-499.112] (-511.533) (-499.839) (-504.516) -- 0:00:45
42500 -- (-515.100) [-500.703] (-499.327) (-502.763) * (-499.097) [-501.704] (-500.912) (-499.106) -- 0:00:45
43000 -- [-508.503] (-501.160) (-497.803) (-502.629) * (-500.514) (-508.555) [-498.322] (-501.031) -- 0:00:44
43500 -- [-503.692] (-497.953) (-500.031) (-502.175) * (-499.242) (-502.405) [-498.108] (-499.973) -- 0:00:43
44000 -- [-515.220] (-499.389) (-503.145) (-499.522) * (-497.279) (-509.526) (-497.529) [-497.664] -- 0:01:05
44500 -- (-520.334) (-497.557) [-498.941] (-498.751) * (-500.004) (-518.234) [-498.362] (-500.708) -- 0:01:04
45000 -- (-512.057) (-498.259) [-499.434] (-498.349) * (-499.305) (-506.621) (-501.869) [-498.561] -- 0:01:03
Average standard deviation of split frequencies: 0.030231
45500 -- (-506.737) [-497.668] (-496.847) (-506.269) * (-497.233) [-512.976] (-503.582) (-498.435) -- 0:01:02
46000 -- (-507.704) (-502.276) [-500.765] (-501.098) * (-499.149) (-503.796) (-508.205) [-501.902] -- 0:01:02
46500 -- (-509.003) (-499.288) (-500.248) [-497.156] * (-501.957) (-511.661) [-501.849] (-497.146) -- 0:01:01
47000 -- (-517.073) [-498.079] (-497.024) (-501.645) * [-498.563] (-507.114) (-500.624) (-501.125) -- 0:01:00
47500 -- (-509.219) (-498.596) (-499.161) [-500.948] * [-498.819] (-510.763) (-498.979) (-501.348) -- 0:01:00
48000 -- [-517.802] (-501.275) (-497.490) (-498.836) * (-499.385) (-509.603) (-500.152) [-501.599] -- 0:00:59
48500 -- [-506.687] (-499.597) (-498.143) (-498.429) * (-497.770) [-506.121] (-500.140) (-502.952) -- 0:00:58
49000 -- (-510.613) (-499.463) [-498.394] (-505.805) * [-499.190] (-511.189) (-499.114) (-499.415) -- 0:00:58
49500 -- (-507.323) [-498.294] (-497.550) (-504.583) * (-497.097) (-509.712) (-499.418) [-498.440] -- 0:00:57
50000 -- (-518.414) (-501.868) [-498.435] (-499.935) * (-497.048) (-508.186) (-502.521) [-502.214] -- 0:00:57
Average standard deviation of split frequencies: 0.031169
50500 -- (-499.047) [-498.646] (-502.629) (-497.717) * (-497.196) [-505.143] (-500.655) (-498.280) -- 0:00:56
51000 -- (-499.689) (-499.734) [-498.083] (-500.001) * (-499.358) (-506.014) (-504.014) [-499.576] -- 0:00:55
51500 -- (-498.853) [-499.152] (-498.024) (-500.668) * (-498.811) (-505.801) [-500.905] (-498.460) -- 0:00:55
52000 -- (-497.687) [-499.574] (-498.379) (-500.063) * (-498.930) (-516.173) [-497.788] (-502.012) -- 0:00:54
52500 -- (-497.860) [-497.959] (-497.139) (-496.895) * (-497.477) (-509.200) [-497.543] (-499.170) -- 0:00:54
53000 -- (-500.064) (-499.492) [-498.124] (-497.875) * [-498.469] (-505.624) (-499.746) (-498.306) -- 0:00:53
53500 -- [-498.195] (-498.070) (-497.463) (-497.737) * (-497.981) [-508.261] (-497.060) (-500.369) -- 0:00:53
54000 -- (-500.250) (-497.564) (-497.840) [-498.032] * [-498.838] (-511.776) (-498.906) (-497.299) -- 0:00:52
54500 -- (-502.249) (-500.048) [-499.741] (-500.848) * (-500.309) (-505.057) [-501.220] (-497.473) -- 0:00:52
55000 -- [-499.219] (-499.097) (-501.844) (-498.552) * [-498.589] (-508.445) (-499.645) (-498.871) -- 0:00:51
Average standard deviation of split frequencies: 0.027592
55500 -- (-497.713) (-500.295) [-499.339] (-497.649) * (-498.407) (-510.420) [-498.643] (-499.106) -- 0:00:51
56000 -- (-500.760) (-499.284) [-500.327] (-498.575) * (-498.071) (-520.687) [-497.424] (-501.550) -- 0:00:50
56500 -- (-500.769) (-499.742) (-497.952) [-498.315] * (-497.188) (-515.907) (-497.990) [-499.925] -- 0:00:50
57000 -- (-499.616) (-500.556) (-497.821) [-500.054] * (-497.125) [-502.953] (-498.308) (-497.498) -- 0:00:49
57500 -- (-498.021) [-498.827] (-498.104) (-498.217) * (-497.870) (-521.421) [-499.555] (-497.009) -- 0:00:49
58000 -- (-498.268) [-499.816] (-496.881) (-498.019) * (-498.170) (-516.605) [-501.930] (-500.074) -- 0:00:48
58500 -- (-497.748) (-498.690) (-499.707) [-497.921] * (-500.165) (-510.049) [-498.189] (-498.023) -- 0:00:48
59000 -- [-497.447] (-499.390) (-499.709) (-501.408) * (-500.600) (-508.164) (-500.439) [-498.033] -- 0:00:47
59500 -- (-498.449) [-498.891] (-500.416) (-500.360) * (-499.251) [-508.473] (-499.755) (-501.278) -- 0:00:47
60000 -- (-498.539) (-498.683) (-498.479) [-500.677] * [-498.563] (-516.420) (-500.800) (-501.220) -- 0:00:47
Average standard deviation of split frequencies: 0.029355
60500 -- [-498.127] (-497.429) (-498.843) (-499.236) * (-499.562) (-519.551) (-500.888) [-500.193] -- 0:01:02
61000 -- (-499.089) (-497.215) (-500.397) [-498.821] * (-498.607) [-500.464] (-499.688) (-498.514) -- 0:01:01
61500 -- (-497.445) [-497.425] (-502.325) (-498.215) * (-498.575) (-499.238) [-499.381] (-498.183) -- 0:01:01
62000 -- (-504.564) (-497.588) (-500.103) [-498.180] * (-502.864) (-499.207) (-498.799) [-502.633] -- 0:01:00
62500 -- (-502.338) [-498.905] (-500.578) (-500.108) * (-504.454) (-497.270) [-496.987] (-498.944) -- 0:01:00
63000 -- (-501.947) [-498.008] (-499.122) (-499.480) * [-497.837] (-499.343) (-497.488) (-500.084) -- 0:00:59
63500 -- [-499.814] (-497.397) (-497.033) (-499.856) * [-502.542] (-498.351) (-499.490) (-501.056) -- 0:00:58
64000 -- (-503.885) [-497.982] (-497.705) (-498.874) * (-500.098) [-502.012] (-502.078) (-498.196) -- 0:00:58
64500 -- (-500.044) (-500.313) [-503.927] (-500.850) * [-498.458] (-504.643) (-500.093) (-501.500) -- 0:00:58
65000 -- [-498.191] (-497.890) (-498.153) (-497.553) * [-498.638] (-499.148) (-500.156) (-500.473) -- 0:00:57
Average standard deviation of split frequencies: 0.028173
65500 -- [-499.255] (-499.429) (-497.300) (-505.993) * (-503.064) (-499.756) (-500.884) [-498.103] -- 0:00:57
66000 -- [-498.951] (-499.070) (-503.158) (-504.624) * (-501.354) [-498.163] (-499.274) (-496.990) -- 0:00:56
66500 -- (-499.275) (-500.443) (-499.187) [-497.654] * [-502.989] (-498.321) (-499.591) (-498.290) -- 0:00:56
67000 -- (-498.297) (-498.357) (-497.151) [-498.444] * (-501.076) [-498.039] (-500.157) (-498.343) -- 0:00:55
67500 -- (-497.855) (-499.609) (-500.365) [-498.173] * (-499.247) (-502.426) (-498.713) [-497.670] -- 0:00:55
68000 -- [-499.170] (-499.602) (-507.261) (-497.088) * (-499.023) (-497.483) [-497.551] (-499.663) -- 0:00:54
68500 -- (-497.251) (-500.060) [-506.074] (-497.094) * (-500.857) (-500.631) [-498.166] (-499.759) -- 0:00:54
69000 -- (-497.485) [-498.919] (-500.865) (-502.956) * (-498.930) [-499.594] (-499.484) (-501.097) -- 0:00:53
69500 -- (-498.411) [-499.345] (-503.712) (-500.054) * (-500.021) (-500.904) (-497.444) [-500.308] -- 0:00:53
70000 -- (-496.986) (-497.481) [-500.786] (-498.612) * [-497.473] (-500.744) (-497.741) (-499.525) -- 0:00:53
Average standard deviation of split frequencies: 0.030019
70500 -- [-497.348] (-498.875) (-501.205) (-498.363) * (-497.952) [-496.987] (-498.775) (-498.079) -- 0:00:52
71000 -- [-499.044] (-498.360) (-499.014) (-501.163) * (-498.953) [-500.996] (-500.479) (-496.750) -- 0:00:52
71500 -- [-499.633] (-499.357) (-499.669) (-501.356) * (-497.196) [-497.427] (-501.415) (-497.757) -- 0:00:51
72000 -- (-497.274) (-497.618) [-499.517] (-499.513) * [-499.702] (-498.292) (-499.733) (-497.373) -- 0:00:51
72500 -- (-501.189) (-500.843) [-498.922] (-498.017) * (-498.740) (-497.360) (-501.106) [-500.806] -- 0:00:51
73000 -- (-497.393) (-499.534) [-499.131] (-499.307) * (-498.357) [-497.235] (-500.114) (-499.375) -- 0:00:50
73500 -- [-497.637] (-500.363) (-497.567) (-503.061) * (-497.362) (-497.243) [-498.501] (-500.042) -- 0:00:50
74000 -- [-498.598] (-500.065) (-498.502) (-499.967) * (-498.115) [-498.682] (-499.800) (-497.624) -- 0:00:50
74500 -- (-498.473) (-497.984) (-498.338) [-502.474] * [-497.785] (-503.889) (-498.096) (-498.678) -- 0:00:49
75000 -- [-500.253] (-497.840) (-498.633) (-498.354) * (-496.962) (-499.977) [-498.622] (-497.721) -- 0:00:49
Average standard deviation of split frequencies: 0.026878
75500 -- (-501.077) (-504.699) [-500.602] (-499.758) * [-497.538] (-504.715) (-502.022) (-498.233) -- 0:00:48
76000 -- (-503.242) (-499.412) (-497.969) [-498.718] * (-500.427) (-497.907) (-503.175) [-499.480] -- 0:00:48
76500 -- [-497.877] (-501.729) (-499.029) (-502.242) * [-499.288] (-498.516) (-498.996) (-502.310) -- 0:00:48
77000 -- (-498.381) (-497.783) (-500.042) [-500.030] * (-501.194) (-502.835) [-499.440] (-500.053) -- 0:00:47
77500 -- (-498.075) (-498.780) [-498.423] (-497.573) * (-498.238) (-498.429) [-500.230] (-497.894) -- 0:00:59
78000 -- [-498.691] (-498.176) (-500.429) (-497.417) * [-497.943] (-499.384) (-498.897) (-499.211) -- 0:00:59
78500 -- (-498.518) (-501.143) [-499.164] (-497.405) * [-498.143] (-500.835) (-503.155) (-498.033) -- 0:00:58
79000 -- (-499.936) (-498.639) [-498.447] (-502.864) * [-498.510] (-498.150) (-502.924) (-497.944) -- 0:00:58
79500 -- (-499.594) (-498.297) [-498.042] (-498.105) * (-499.026) [-497.980] (-502.516) (-500.149) -- 0:00:57
80000 -- [-499.450] (-499.770) (-499.818) (-504.255) * (-498.187) [-497.754] (-503.671) (-499.353) -- 0:00:57
Average standard deviation of split frequencies: 0.029219
80500 -- (-501.074) (-497.722) [-499.756] (-503.292) * [-497.786] (-500.786) (-498.855) (-500.187) -- 0:00:57
81000 -- (-502.215) (-497.769) [-498.214] (-500.819) * [-498.060] (-497.164) (-501.860) (-499.055) -- 0:00:56
81500 -- (-502.561) (-496.924) (-499.481) [-498.964] * [-498.191] (-497.491) (-501.908) (-501.466) -- 0:00:56
82000 -- (-498.065) [-497.915] (-502.065) (-497.638) * (-497.337) (-498.448) [-501.067] (-499.454) -- 0:00:55
82500 -- (-499.467) [-497.344] (-496.976) (-497.960) * [-499.200] (-499.485) (-503.202) (-498.966) -- 0:00:55
83000 -- [-502.290] (-501.017) (-497.514) (-499.498) * [-497.816] (-497.592) (-499.725) (-499.523) -- 0:00:55
83500 -- [-500.594] (-503.491) (-497.630) (-498.478) * [-498.062] (-499.574) (-497.769) (-500.092) -- 0:00:54
84000 -- (-500.122) (-499.241) [-497.282] (-499.862) * (-498.129) (-499.364) [-498.658] (-502.374) -- 0:00:54
84500 -- (-499.969) (-497.080) (-498.910) [-498.315] * (-498.038) (-498.320) (-500.920) [-499.249] -- 0:00:54
85000 -- (-500.425) [-497.819] (-498.220) (-499.044) * (-499.528) [-499.321] (-502.300) (-499.189) -- 0:00:53
Average standard deviation of split frequencies: 0.024234
85500 -- [-503.887] (-497.731) (-498.764) (-499.670) * (-498.536) [-498.146] (-497.760) (-498.145) -- 0:00:53
86000 -- (-502.747) (-499.678) (-498.733) [-499.629] * (-498.914) (-497.862) [-502.321] (-500.452) -- 0:00:53
86500 -- (-497.750) (-498.697) (-500.318) [-498.223] * (-498.328) [-498.658] (-498.969) (-499.894) -- 0:00:52
87000 -- (-498.076) (-498.262) [-499.905] (-498.952) * (-498.089) [-497.366] (-504.181) (-501.284) -- 0:00:52
87500 -- (-499.832) (-499.445) (-499.668) [-497.945] * (-499.789) (-499.237) [-500.731] (-497.930) -- 0:00:52
88000 -- (-498.252) (-498.774) [-497.609] (-497.406) * [-498.291] (-497.353) (-499.040) (-498.713) -- 0:00:51
88500 -- (-497.954) (-498.130) (-497.532) [-498.340] * [-497.785] (-497.784) (-498.342) (-497.225) -- 0:00:51
89000 -- (-498.844) (-500.435) (-499.291) [-498.855] * [-497.148] (-500.014) (-499.865) (-497.703) -- 0:00:51
89500 -- (-500.757) (-500.355) [-500.029] (-499.141) * [-497.776] (-501.082) (-497.575) (-496.723) -- 0:00:50
90000 -- (-500.906) (-502.375) [-499.454] (-498.431) * (-501.103) [-499.033] (-499.941) (-500.150) -- 0:00:50
Average standard deviation of split frequencies: 0.024355
90500 -- [-503.626] (-500.801) (-499.918) (-501.262) * (-502.957) [-499.796] (-498.993) (-497.360) -- 0:00:50
91000 -- (-504.658) (-503.534) [-498.709] (-500.603) * (-499.767) (-500.168) [-497.791] (-500.638) -- 0:00:49
91500 -- (-502.402) (-498.809) [-497.901] (-498.734) * [-498.439] (-501.481) (-499.759) (-500.646) -- 0:00:49
92000 -- (-500.168) (-498.333) [-497.348] (-499.945) * (-497.031) (-498.837) [-497.784] (-497.012) -- 0:00:49
92500 -- [-501.643] (-501.151) (-501.654) (-501.409) * (-497.281) (-498.481) (-498.033) [-497.552] -- 0:00:49
93000 -- (-499.089) (-505.128) (-500.338) [-499.793] * (-498.216) (-499.217) (-499.885) [-497.004] -- 0:00:48
93500 -- (-497.453) (-503.752) (-500.457) [-500.639] * (-497.768) (-499.458) (-501.378) [-498.095] -- 0:00:48
94000 -- (-498.195) (-501.292) [-498.432] (-497.340) * (-500.740) (-500.498) (-501.476) [-497.683] -- 0:00:48
94500 -- [-498.639] (-500.461) (-502.638) (-498.044) * [-499.624] (-500.091) (-501.106) (-498.832) -- 0:00:57
95000 -- [-497.928] (-496.688) (-513.449) (-499.676) * (-498.596) (-505.620) (-497.585) [-497.733] -- 0:00:57
Average standard deviation of split frequencies: 0.023002
95500 -- (-497.379) [-496.909] (-499.735) (-498.281) * [-499.054] (-499.311) (-501.178) (-498.716) -- 0:00:56
96000 -- [-498.435] (-497.542) (-504.311) (-497.123) * (-499.300) [-498.955] (-502.474) (-499.911) -- 0:00:56
96500 -- (-500.817) (-498.251) (-506.443) [-498.397] * (-499.804) (-500.020) (-499.732) [-499.692] -- 0:00:56
97000 -- (-502.363) (-497.682) (-499.407) [-498.349] * (-498.311) (-498.808) [-498.753] (-497.308) -- 0:00:55
97500 -- (-497.808) (-497.027) [-499.983] (-498.104) * (-499.655) (-499.510) [-498.143] (-497.320) -- 0:00:55
98000 -- [-497.162] (-498.270) (-500.260) (-500.606) * (-499.348) (-498.328) [-498.078] (-498.074) -- 0:00:55
98500 -- (-497.859) [-496.852] (-501.543) (-501.828) * (-500.783) (-499.548) (-497.846) [-500.723] -- 0:00:54
99000 -- [-500.041] (-498.699) (-498.116) (-498.032) * (-498.511) (-498.333) [-497.600] (-500.639) -- 0:00:54
99500 -- [-500.146] (-499.871) (-498.337) (-500.638) * (-498.004) (-498.749) [-498.854] (-499.901) -- 0:00:54
100000 -- (-504.990) [-498.543] (-499.965) (-499.113) * (-497.561) [-500.654] (-500.028) (-497.443) -- 0:00:54
Average standard deviation of split frequencies: 0.024455
100500 -- (-499.433) (-497.483) (-498.067) [-497.731] * (-503.728) (-498.514) [-499.626] (-498.807) -- 0:00:53
101000 -- (-498.300) (-497.184) (-499.888) [-498.891] * (-500.379) [-497.170] (-500.829) (-498.358) -- 0:00:53
101500 -- (-500.613) (-497.785) (-500.182) [-498.802] * (-497.934) [-500.411] (-499.062) (-497.803) -- 0:00:53
102000 -- (-501.917) (-497.059) (-498.796) [-498.837] * (-497.839) (-498.264) (-496.920) [-498.543] -- 0:00:52
102500 -- (-504.324) (-497.429) (-498.470) [-498.681] * (-498.230) (-499.136) (-497.834) [-498.563] -- 0:00:52
103000 -- (-499.641) (-498.491) (-498.960) [-497.394] * (-504.916) (-497.377) (-497.311) [-499.875] -- 0:00:52
103500 -- (-499.139) (-499.224) [-499.810] (-501.558) * (-497.576) [-497.587] (-502.312) (-501.993) -- 0:00:51
104000 -- (-498.030) (-499.002) (-498.776) [-501.086] * (-498.450) [-498.137] (-496.846) (-502.130) -- 0:00:51
104500 -- (-500.362) (-500.438) (-500.915) [-498.036] * (-497.905) (-497.159) (-498.716) [-504.922] -- 0:00:51
105000 -- [-497.460] (-498.675) (-500.796) (-497.370) * [-497.639] (-498.068) (-498.787) (-498.647) -- 0:00:51
Average standard deviation of split frequencies: 0.022903
105500 -- [-498.703] (-499.094) (-503.210) (-497.333) * (-500.985) (-499.624) (-499.350) [-500.731] -- 0:00:50
106000 -- (-499.978) [-497.049] (-502.852) (-497.932) * (-500.195) (-498.139) (-498.444) [-497.583] -- 0:00:50
106500 -- (-498.385) (-500.466) (-502.496) [-497.631] * (-500.199) [-499.134] (-498.697) (-497.733) -- 0:00:50
107000 -- [-498.732] (-499.034) (-497.968) (-499.286) * [-499.729] (-498.577) (-498.763) (-498.480) -- 0:00:50
107500 -- [-497.991] (-498.896) (-497.266) (-499.818) * (-498.898) [-500.525] (-500.823) (-497.879) -- 0:00:49
108000 -- (-498.563) (-499.959) [-497.243] (-498.115) * (-501.417) [-497.813] (-500.326) (-498.779) -- 0:00:49
108500 -- (-502.016) (-498.359) [-497.711] (-498.084) * [-499.146] (-498.397) (-499.428) (-499.034) -- 0:00:49
109000 -- (-499.499) (-497.490) (-497.224) [-497.982] * (-502.122) [-499.042] (-497.975) (-498.288) -- 0:00:49
109500 -- (-501.351) [-501.828] (-498.268) (-497.567) * [-497.537] (-499.749) (-497.953) (-499.541) -- 0:00:48
110000 -- (-498.291) [-501.392] (-497.792) (-497.721) * (-498.071) (-503.221) (-497.616) [-498.281] -- 0:00:48
Average standard deviation of split frequencies: 0.022718
110500 -- (-498.479) (-498.011) (-498.349) [-497.852] * [-499.101] (-500.884) (-499.776) (-499.921) -- 0:00:48
111000 -- (-497.982) (-501.426) (-499.855) [-497.404] * (-498.131) (-497.361) (-499.108) [-499.412] -- 0:00:48
111500 -- (-498.803) [-501.284] (-498.113) (-504.306) * [-498.560] (-496.900) (-499.865) (-498.292) -- 0:00:55
112000 -- [-500.880] (-498.649) (-508.159) (-499.923) * [-500.696] (-497.235) (-502.527) (-498.555) -- 0:00:55
112500 -- (-499.301) [-498.545] (-500.440) (-499.173) * (-498.015) (-498.001) [-500.540] (-502.554) -- 0:00:55
113000 -- [-498.606] (-499.392) (-498.482) (-498.359) * [-499.651] (-497.289) (-498.059) (-500.572) -- 0:00:54
113500 -- [-497.107] (-497.951) (-498.903) (-498.156) * [-498.024] (-499.837) (-499.022) (-498.062) -- 0:00:54
114000 -- [-498.078] (-498.831) (-496.895) (-497.188) * [-498.489] (-500.055) (-501.745) (-498.473) -- 0:00:54
114500 -- [-498.735] (-499.016) (-497.003) (-499.660) * (-498.156) (-500.109) (-498.186) [-500.322] -- 0:00:54
115000 -- (-499.767) (-500.737) (-499.338) [-500.181] * [-497.361] (-497.186) (-497.468) (-498.172) -- 0:00:53
Average standard deviation of split frequencies: 0.019250
115500 -- (-499.190) (-497.996) [-504.723] (-499.510) * (-499.211) [-497.490] (-498.721) (-496.761) -- 0:00:53
116000 -- (-497.769) (-497.483) (-499.455) [-501.484] * [-497.891] (-498.690) (-497.242) (-497.198) -- 0:00:53
116500 -- [-499.154] (-499.201) (-499.672) (-497.907) * (-499.472) [-499.476] (-497.528) (-498.697) -- 0:00:53
117000 -- (-497.206) (-497.970) [-499.333] (-502.100) * (-498.652) (-498.877) (-499.245) [-499.321] -- 0:00:52
117500 -- (-498.874) [-499.987] (-499.579) (-501.511) * [-498.123] (-499.424) (-502.402) (-499.439) -- 0:00:52
118000 -- [-498.279] (-501.145) (-500.786) (-498.309) * (-498.274) (-497.743) (-501.625) [-499.425] -- 0:00:52
118500 -- (-499.514) [-498.436] (-498.926) (-508.379) * (-498.172) (-498.630) (-499.191) [-498.725] -- 0:00:52
119000 -- (-500.301) [-497.541] (-499.231) (-499.103) * (-500.084) (-499.809) [-498.751] (-498.904) -- 0:00:51
119500 -- (-498.837) (-500.240) [-502.168] (-500.034) * (-499.396) (-500.479) [-497.093] (-497.482) -- 0:00:51
120000 -- (-498.867) (-497.386) [-499.798] (-498.223) * (-499.003) [-496.988] (-497.680) (-497.496) -- 0:00:51
Average standard deviation of split frequencies: 0.019099
120500 -- (-503.160) [-499.997] (-502.819) (-498.735) * [-501.697] (-497.617) (-499.091) (-502.672) -- 0:00:51
121000 -- (-500.945) (-497.434) (-497.966) [-498.199] * (-501.271) (-499.768) [-498.205] (-500.131) -- 0:00:50
121500 -- (-499.533) [-499.364] (-498.804) (-497.391) * (-497.545) [-500.278] (-498.611) (-504.243) -- 0:00:50
122000 -- (-500.018) (-502.506) (-503.897) [-497.683] * (-507.316) [-500.291] (-499.898) (-508.370) -- 0:00:50
122500 -- [-497.335] (-499.662) (-501.995) (-498.812) * (-499.250) (-498.031) [-496.970] (-499.698) -- 0:00:50
123000 -- (-498.485) (-499.010) (-499.964) [-498.674] * (-498.803) (-497.606) [-498.475] (-499.621) -- 0:00:49
123500 -- (-497.682) (-503.494) [-498.442] (-502.368) * (-499.433) (-498.623) (-498.997) [-497.961] -- 0:00:49
124000 -- (-500.590) [-497.564] (-502.229) (-498.425) * (-500.684) [-498.212] (-497.786) (-500.263) -- 0:00:49
124500 -- (-499.511) [-500.035] (-498.095) (-500.428) * [-499.942] (-505.009) (-497.302) (-498.285) -- 0:00:49
125000 -- (-502.164) (-499.430) (-499.336) [-498.192] * [-499.260] (-499.421) (-500.646) (-497.891) -- 0:00:49
Average standard deviation of split frequencies: 0.017722
125500 -- (-498.222) [-501.201] (-500.430) (-498.014) * (-500.260) (-499.122) (-500.648) [-497.516] -- 0:00:48
126000 -- [-503.460] (-499.584) (-498.761) (-497.241) * [-498.850] (-498.577) (-498.188) (-499.965) -- 0:00:48
126500 -- [-499.322] (-502.373) (-497.584) (-498.765) * [-502.339] (-501.884) (-498.140) (-500.688) -- 0:00:48
127000 -- (-499.304) (-500.023) (-501.312) [-499.465] * (-500.553) (-498.416) [-500.757] (-502.785) -- 0:00:48
127500 -- [-500.628] (-498.238) (-498.411) (-501.003) * (-500.752) (-498.776) [-499.309] (-497.751) -- 0:00:47
128000 -- (-500.884) (-500.248) (-500.305) [-498.393] * (-499.392) (-500.193) (-499.388) [-498.587] -- 0:00:54
128500 -- [-498.204] (-496.877) (-501.188) (-499.930) * (-499.283) (-497.570) [-502.029] (-499.366) -- 0:00:54
129000 -- (-501.198) [-497.709] (-501.687) (-500.013) * (-496.848) (-499.964) (-503.076) [-498.075] -- 0:00:54
129500 -- [-498.436] (-498.729) (-497.601) (-500.362) * (-500.851) [-499.703] (-497.452) (-500.047) -- 0:00:53
130000 -- [-497.497] (-497.903) (-500.216) (-500.996) * (-498.029) [-497.882] (-500.384) (-500.197) -- 0:00:53
Average standard deviation of split frequencies: 0.014431
130500 -- (-499.574) (-497.035) [-498.982] (-506.399) * (-499.941) (-499.589) [-500.822] (-499.714) -- 0:00:53
131000 -- (-498.206) (-496.850) [-497.043] (-500.976) * (-500.994) [-499.633] (-501.322) (-499.587) -- 0:00:53
131500 -- [-496.783] (-496.826) (-497.279) (-499.486) * [-498.574] (-500.170) (-501.352) (-500.709) -- 0:00:52
132000 -- [-499.432] (-497.915) (-501.899) (-500.284) * [-500.904] (-503.372) (-498.727) (-497.588) -- 0:00:52
132500 -- (-498.497) [-497.332] (-499.496) (-499.708) * (-500.359) (-499.453) [-501.207] (-498.037) -- 0:00:52
133000 -- (-499.088) (-497.361) (-504.495) [-497.693] * (-499.079) (-497.153) (-507.442) [-498.258] -- 0:00:52
133500 -- (-498.001) (-498.203) [-499.086] (-496.998) * (-498.741) (-497.959) (-500.038) [-502.560] -- 0:00:51
134000 -- (-501.151) (-499.048) (-499.311) [-497.947] * (-500.132) (-497.597) [-497.985] (-498.119) -- 0:00:51
134500 -- (-498.593) (-498.724) (-497.557) [-497.621] * (-499.490) [-500.110] (-499.760) (-498.616) -- 0:00:51
135000 -- (-498.760) (-503.886) [-499.388] (-500.508) * (-500.450) (-497.521) (-499.584) [-501.043] -- 0:00:51
Average standard deviation of split frequencies: 0.015020
135500 -- [-498.667] (-499.889) (-498.598) (-498.004) * [-498.154] (-497.617) (-497.890) (-501.123) -- 0:00:51
136000 -- (-498.030) [-499.515] (-507.683) (-498.203) * (-500.187) (-499.565) [-498.708] (-501.520) -- 0:00:50
136500 -- (-497.350) (-498.567) [-499.957] (-497.766) * [-499.729] (-497.874) (-497.515) (-501.016) -- 0:00:50
137000 -- [-497.212] (-497.163) (-499.132) (-498.084) * (-498.196) [-501.142] (-499.341) (-499.335) -- 0:00:50
137500 -- (-497.577) (-498.585) (-501.256) [-498.571] * (-503.799) [-500.765] (-500.751) (-499.975) -- 0:00:50
138000 -- (-500.281) (-497.681) (-498.445) [-499.512] * (-499.597) [-497.621] (-498.626) (-497.176) -- 0:00:49
138500 -- (-501.875) (-500.479) [-500.299] (-503.823) * (-497.118) [-497.797] (-498.444) (-498.727) -- 0:00:49
139000 -- (-502.624) (-498.126) (-499.826) [-500.727] * (-502.890) (-497.944) (-497.522) [-500.978] -- 0:00:49
139500 -- (-497.613) (-502.656) (-497.936) [-498.380] * (-500.404) (-499.126) (-498.480) [-498.736] -- 0:00:49
140000 -- (-499.201) [-497.214] (-498.233) (-501.021) * (-499.478) (-497.910) (-500.105) [-498.196] -- 0:00:49
Average standard deviation of split frequencies: 0.014150
140500 -- (-497.565) (-501.963) [-498.460] (-499.139) * [-497.895] (-500.132) (-499.214) (-500.221) -- 0:00:48
141000 -- (-500.655) [-500.248] (-497.518) (-501.391) * (-500.959) (-497.744) (-501.063) [-499.485] -- 0:00:48
141500 -- (-499.605) [-497.826] (-500.452) (-498.625) * (-500.969) (-497.232) [-498.819] (-497.880) -- 0:00:48
142000 -- (-497.570) (-500.246) (-500.743) [-497.344] * (-497.795) [-497.037] (-499.873) (-497.951) -- 0:00:48
142500 -- [-502.047] (-498.330) (-501.275) (-498.158) * [-497.741] (-502.195) (-501.481) (-497.261) -- 0:00:48
143000 -- [-502.955] (-498.767) (-501.016) (-505.359) * (-497.846) (-501.886) [-501.117] (-497.965) -- 0:00:47
143500 -- [-498.248] (-499.746) (-498.273) (-497.960) * (-499.730) (-497.901) [-499.131] (-499.249) -- 0:00:47
144000 -- (-499.657) (-500.995) (-500.014) [-505.505] * (-497.111) (-497.945) (-497.749) [-498.982] -- 0:00:47
144500 -- (-501.673) (-499.718) (-498.678) [-498.679] * (-499.213) (-496.762) (-500.257) [-500.273] -- 0:00:53
145000 -- [-497.353] (-500.115) (-499.127) (-497.773) * [-499.228] (-498.064) (-498.414) (-500.449) -- 0:00:53
Average standard deviation of split frequencies: 0.014275
145500 -- (-501.355) (-499.632) (-498.717) [-499.905] * [-500.089] (-498.575) (-500.171) (-503.160) -- 0:00:52
146000 -- (-499.120) [-499.273] (-500.567) (-500.044) * (-498.934) (-497.383) [-498.531] (-499.220) -- 0:00:52
146500 -- (-497.389) [-500.183] (-501.973) (-503.529) * [-499.542] (-497.065) (-497.226) (-498.609) -- 0:00:52
147000 -- (-498.530) (-498.352) [-500.234] (-499.187) * (-498.258) (-499.328) (-498.268) [-499.533] -- 0:00:52
147500 -- (-499.549) (-497.962) (-499.829) [-497.304] * (-501.078) (-498.818) [-498.032] (-497.897) -- 0:00:52
148000 -- [-500.173] (-500.259) (-500.023) (-499.483) * (-500.578) (-500.588) [-498.194] (-497.968) -- 0:00:51
148500 -- (-500.472) (-497.311) (-498.783) [-501.259] * [-500.172] (-500.637) (-497.781) (-498.488) -- 0:00:51
149000 -- (-496.753) (-497.580) (-502.084) [-500.612] * [-498.879] (-499.707) (-504.100) (-499.196) -- 0:00:51
149500 -- (-496.838) [-500.639] (-503.259) (-497.995) * (-498.367) (-499.623) [-498.443] (-499.446) -- 0:00:51
150000 -- (-499.078) [-498.874] (-498.360) (-498.087) * (-499.228) (-501.444) [-498.309] (-499.974) -- 0:00:51
Average standard deviation of split frequencies: 0.012515
150500 -- (-500.446) (-497.249) [-501.577] (-497.477) * (-497.622) (-499.834) [-500.168] (-503.018) -- 0:00:50
151000 -- (-503.670) [-497.742] (-499.804) (-498.410) * (-500.094) (-499.185) [-497.304] (-499.874) -- 0:00:50
151500 -- (-502.055) (-497.993) (-500.993) [-497.882] * [-500.118] (-500.864) (-498.389) (-500.731) -- 0:00:50
152000 -- (-500.171) [-499.382] (-500.965) (-497.571) * (-499.719) (-500.884) (-498.331) [-498.802] -- 0:00:50
152500 -- (-498.619) (-498.968) [-501.607] (-499.118) * (-500.472) (-502.042) [-502.843] (-497.607) -- 0:00:50
153000 -- [-499.332] (-506.820) (-498.750) (-499.717) * (-500.799) (-501.121) [-499.148] (-497.074) -- 0:00:49
153500 -- [-499.957] (-498.370) (-501.110) (-498.488) * [-498.962] (-501.320) (-498.365) (-498.797) -- 0:00:49
154000 -- (-498.121) [-498.213] (-499.616) (-501.752) * (-497.701) (-499.322) [-499.864] (-497.822) -- 0:00:49
154500 -- (-500.913) [-497.784] (-501.495) (-500.835) * (-500.064) (-499.020) [-500.457] (-496.989) -- 0:00:49
155000 -- (-500.889) (-498.472) [-500.839] (-501.224) * (-498.744) (-497.910) (-498.023) [-499.057] -- 0:00:49
Average standard deviation of split frequencies: 0.012255
155500 -- (-497.271) (-497.633) (-498.598) [-500.954] * (-498.781) [-499.168] (-502.546) (-497.537) -- 0:00:48
156000 -- (-497.765) [-497.450] (-502.593) (-506.128) * (-498.556) [-499.527] (-498.825) (-502.482) -- 0:00:48
156500 -- [-499.150] (-499.146) (-502.933) (-501.751) * (-498.243) (-498.153) (-498.312) [-499.681] -- 0:00:48
157000 -- (-500.282) (-501.518) [-498.552] (-498.120) * (-500.032) (-497.066) (-501.564) [-497.119] -- 0:00:48
157500 -- (-501.234) [-499.802] (-497.787) (-499.809) * [-499.216] (-498.101) (-500.446) (-498.227) -- 0:00:48
158000 -- (-497.869) [-497.317] (-499.337) (-498.313) * (-499.501) [-498.513] (-502.050) (-501.092) -- 0:00:47
158500 -- [-497.459] (-497.969) (-498.756) (-499.508) * [-498.976] (-500.604) (-498.794) (-503.558) -- 0:00:47
159000 -- [-498.459] (-497.951) (-502.874) (-498.591) * (-498.147) (-497.714) (-497.731) [-502.489] -- 0:00:47
159500 -- [-498.303] (-497.626) (-499.251) (-499.232) * (-498.762) [-499.123] (-499.162) (-501.575) -- 0:00:47
160000 -- [-498.950] (-497.789) (-497.405) (-497.875) * (-498.228) (-498.389) (-497.765) [-501.622] -- 0:00:47
Average standard deviation of split frequencies: 0.012714
160500 -- [-498.326] (-497.936) (-499.775) (-496.946) * (-499.422) (-498.497) (-497.898) [-501.628] -- 0:00:47
161000 -- (-498.628) (-501.749) [-497.788] (-497.262) * (-498.075) (-498.281) [-500.251] (-499.677) -- 0:00:52
161500 -- (-501.137) (-502.639) [-497.570] (-504.875) * [-497.616] (-498.421) (-500.655) (-500.905) -- 0:00:51
162000 -- (-498.091) (-498.525) (-499.983) [-499.553] * (-498.613) (-500.206) (-500.407) [-498.833] -- 0:00:51
162500 -- [-498.062] (-498.154) (-500.980) (-499.544) * (-499.287) (-500.522) [-498.208] (-504.618) -- 0:00:51
163000 -- (-500.987) [-498.160] (-500.040) (-498.419) * (-500.081) (-501.068) (-500.738) [-498.667] -- 0:00:51
163500 -- (-498.054) [-497.391] (-499.074) (-498.702) * (-500.240) (-498.491) [-498.891] (-500.599) -- 0:00:51
164000 -- (-499.793) [-501.041] (-497.920) (-497.695) * [-497.590] (-498.421) (-497.473) (-500.988) -- 0:00:50
164500 -- (-498.989) (-499.422) (-501.973) [-498.828] * [-498.842] (-498.619) (-500.205) (-501.802) -- 0:00:50
165000 -- (-498.307) (-497.249) (-498.119) [-499.964] * (-499.161) (-499.230) [-500.602] (-498.009) -- 0:00:50
Average standard deviation of split frequencies: 0.011359
165500 -- (-499.156) (-501.818) (-502.242) [-499.685] * [-501.712] (-498.335) (-497.668) (-497.236) -- 0:00:50
166000 -- (-498.284) (-503.421) [-501.368] (-499.802) * (-500.422) [-500.096] (-498.572) (-497.459) -- 0:00:50
166500 -- [-498.267] (-500.408) (-498.381) (-498.280) * (-501.084) (-496.853) [-498.970] (-499.822) -- 0:00:50
167000 -- (-499.005) (-498.603) [-499.391] (-498.162) * [-498.713] (-499.115) (-499.269) (-498.755) -- 0:00:49
167500 -- (-497.422) [-501.052] (-503.109) (-499.115) * (-499.419) (-498.222) [-500.406] (-498.923) -- 0:00:49
168000 -- (-496.987) (-499.342) (-500.841) [-498.221] * (-499.703) (-499.787) (-501.258) [-501.996] -- 0:00:49
168500 -- (-497.645) (-500.911) (-499.961) [-497.543] * (-497.392) (-501.199) (-502.055) [-500.871] -- 0:00:49
169000 -- (-502.480) (-499.391) (-501.292) [-498.987] * (-506.621) (-498.650) (-501.282) [-500.568] -- 0:00:49
169500 -- [-498.248] (-503.587) (-500.136) (-499.970) * (-500.185) (-498.616) (-504.580) [-501.241] -- 0:00:48
170000 -- (-500.512) [-499.392] (-500.382) (-504.001) * [-499.984] (-502.164) (-497.958) (-500.180) -- 0:00:48
Average standard deviation of split frequencies: 0.012276
170500 -- (-502.494) [-497.202] (-499.662) (-507.103) * (-499.609) [-498.421] (-500.066) (-499.793) -- 0:00:48
171000 -- (-498.127) [-496.854] (-497.797) (-500.416) * (-498.895) (-498.948) (-502.511) [-499.346] -- 0:00:48
171500 -- [-499.110] (-496.805) (-497.730) (-497.476) * (-499.147) (-497.255) [-498.821] (-499.340) -- 0:00:48
172000 -- [-496.876] (-497.205) (-498.948) (-498.796) * (-501.840) (-498.595) (-501.340) [-497.416] -- 0:00:48
172500 -- [-498.666] (-498.692) (-501.120) (-498.339) * (-498.021) (-497.692) [-496.968] (-499.559) -- 0:00:47
173000 -- (-497.848) [-499.456] (-498.694) (-500.119) * [-497.442] (-498.776) (-500.142) (-497.866) -- 0:00:47
173500 -- (-498.804) [-499.699] (-501.339) (-499.819) * [-499.277] (-497.956) (-499.642) (-499.470) -- 0:00:47
174000 -- (-497.494) (-499.641) (-499.599) [-499.147] * (-502.571) (-497.624) [-497.288] (-499.689) -- 0:00:47
174500 -- (-499.676) (-498.304) [-498.576] (-497.980) * (-499.493) [-497.635] (-497.455) (-498.171) -- 0:00:47
175000 -- (-500.242) (-501.546) (-496.847) [-497.201] * (-501.382) (-498.357) (-498.599) [-498.748] -- 0:00:47
Average standard deviation of split frequencies: 0.013707
175500 -- (-498.741) [-497.026] (-501.450) (-498.296) * (-502.328) [-499.056] (-498.123) (-499.316) -- 0:00:46
176000 -- (-497.750) (-501.065) (-501.343) [-499.436] * (-498.633) [-498.398] (-501.037) (-498.918) -- 0:00:46
176500 -- (-498.596) (-497.348) [-501.048] (-500.967) * (-499.961) [-497.947] (-499.494) (-500.891) -- 0:00:46
177000 -- (-497.303) (-499.536) [-498.656] (-500.722) * (-498.581) (-500.599) [-502.812] (-497.341) -- 0:00:46
177500 -- (-499.699) (-497.730) (-499.357) [-501.441] * (-503.933) (-503.491) (-500.414) [-499.137] -- 0:00:46
178000 -- (-497.234) (-505.092) (-498.855) [-502.902] * (-499.325) [-498.826] (-499.378) (-499.195) -- 0:00:46
178500 -- (-499.411) [-498.141] (-498.703) (-500.468) * [-500.120] (-506.716) (-502.496) (-498.843) -- 0:00:50
179000 -- [-499.251] (-499.679) (-498.512) (-497.817) * (-497.365) (-502.188) (-498.278) [-499.082] -- 0:00:50
179500 -- (-498.365) [-497.857] (-500.464) (-500.567) * (-498.209) (-502.258) (-500.727) [-497.457] -- 0:00:50
180000 -- (-497.038) [-498.823] (-499.966) (-500.940) * (-498.566) (-498.085) (-498.961) [-498.213] -- 0:00:50
Average standard deviation of split frequencies: 0.013660
180500 -- [-497.936] (-500.317) (-501.297) (-500.436) * (-499.923) [-497.186] (-502.359) (-497.424) -- 0:00:49
181000 -- (-500.575) (-500.317) (-498.607) [-498.947] * (-499.858) (-499.671) [-497.889] (-499.193) -- 0:00:49
181500 -- (-502.984) (-498.995) (-499.450) [-500.208] * (-499.647) (-498.543) [-497.095] (-499.607) -- 0:00:49
182000 -- (-503.601) (-498.179) (-498.779) [-499.081] * [-498.115] (-497.546) (-500.217) (-501.396) -- 0:00:49
182500 -- (-497.597) [-497.257] (-499.268) (-498.991) * [-497.339] (-499.001) (-498.204) (-502.025) -- 0:00:49
183000 -- [-499.320] (-500.475) (-499.184) (-500.079) * (-499.555) (-498.377) (-500.317) [-498.943] -- 0:00:49
183500 -- (-501.679) [-499.593] (-498.039) (-497.226) * [-499.602] (-499.179) (-502.381) (-500.569) -- 0:00:48
184000 -- (-503.625) (-499.799) (-501.193) [-499.460] * (-498.546) [-499.555] (-498.558) (-499.972) -- 0:00:48
184500 -- (-501.159) (-499.730) [-497.761] (-500.642) * (-500.678) [-498.963] (-499.057) (-497.541) -- 0:00:48
185000 -- (-504.477) [-499.499] (-497.288) (-500.095) * (-499.749) (-502.056) [-498.933] (-497.673) -- 0:00:48
Average standard deviation of split frequencies: 0.013072
185500 -- (-499.109) (-499.604) (-500.104) [-501.047] * (-500.610) (-498.680) (-499.023) [-497.099] -- 0:00:48
186000 -- (-498.742) (-499.355) [-497.110] (-501.044) * (-501.133) [-501.991] (-498.304) (-498.616) -- 0:00:48
186500 -- (-497.478) (-498.557) [-501.915] (-500.424) * (-497.664) [-498.577] (-499.063) (-497.239) -- 0:00:47
187000 -- [-499.626] (-500.188) (-499.667) (-498.912) * (-501.902) (-498.677) [-500.164] (-500.996) -- 0:00:47
187500 -- (-500.318) (-503.486) [-498.593] (-499.664) * [-498.434] (-497.931) (-498.926) (-499.012) -- 0:00:47
188000 -- (-499.318) [-498.624] (-501.365) (-499.842) * (-498.860) (-497.433) [-498.403] (-499.154) -- 0:00:47
188500 -- (-499.221) (-497.205) [-501.062] (-498.329) * (-502.965) [-499.578] (-500.121) (-497.960) -- 0:00:47
189000 -- [-497.280] (-501.491) (-498.230) (-498.222) * [-499.823] (-498.802) (-498.952) (-498.476) -- 0:00:47
189500 -- [-497.560] (-506.582) (-498.914) (-497.804) * (-499.135) (-498.197) [-501.224] (-498.203) -- 0:00:47
190000 -- (-497.115) [-498.793] (-500.141) (-497.411) * (-498.840) (-500.988) (-499.722) [-498.669] -- 0:00:46
Average standard deviation of split frequencies: 0.012492
190500 -- (-498.104) (-500.363) (-497.473) [-500.635] * [-499.774] (-502.352) (-498.512) (-498.067) -- 0:00:46
191000 -- (-498.372) [-498.290] (-497.760) (-499.568) * (-498.283) (-498.805) (-498.720) [-498.452] -- 0:00:46
191500 -- (-496.847) [-497.166] (-497.839) (-499.280) * (-498.812) [-499.160] (-503.572) (-499.380) -- 0:00:46
192000 -- (-500.613) [-497.332] (-501.359) (-499.065) * (-497.409) (-498.867) (-497.647) [-498.482] -- 0:00:46
192500 -- [-496.933] (-498.192) (-502.367) (-498.746) * (-497.612) (-499.465) (-498.720) [-497.730] -- 0:00:46
193000 -- (-499.135) (-501.577) [-502.716] (-498.283) * [-499.659] (-497.693) (-499.256) (-497.097) -- 0:00:45
193500 -- [-499.264] (-501.804) (-497.905) (-498.855) * [-499.983] (-499.203) (-497.271) (-496.818) -- 0:00:45
194000 -- (-499.961) (-498.581) [-500.709] (-497.665) * (-499.325) (-497.001) [-498.030] (-498.089) -- 0:00:45
194500 -- (-500.834) (-497.599) [-497.804] (-499.225) * (-497.690) [-497.690] (-498.887) (-497.541) -- 0:00:45
195000 -- (-497.708) (-497.046) (-498.332) [-501.994] * [-500.871] (-499.168) (-498.240) (-497.007) -- 0:00:45
Average standard deviation of split frequencies: 0.012167
195500 -- [-500.271] (-500.004) (-497.847) (-497.779) * (-502.207) (-499.896) (-498.400) [-498.430] -- 0:00:49
196000 -- (-500.350) (-503.215) [-497.541] (-497.977) * [-497.152] (-500.118) (-498.214) (-499.731) -- 0:00:49
196500 -- (-499.020) (-500.499) (-497.562) [-497.893] * (-497.382) (-497.821) (-497.179) [-502.886] -- 0:00:49
197000 -- (-504.622) (-501.317) [-497.938] (-498.886) * [-497.611] (-503.008) (-497.831) (-501.785) -- 0:00:48
197500 -- [-500.728] (-499.681) (-499.597) (-501.047) * [-497.783] (-507.020) (-497.366) (-500.625) -- 0:00:48
198000 -- [-498.885] (-497.220) (-499.110) (-502.912) * [-498.052] (-499.018) (-501.069) (-498.506) -- 0:00:48
198500 -- (-502.012) [-497.100] (-499.607) (-500.374) * (-498.923) (-500.484) (-501.017) [-500.061] -- 0:00:48
199000 -- [-501.636] (-498.669) (-498.175) (-500.878) * (-500.014) (-498.068) [-501.983] (-499.194) -- 0:00:48
199500 -- (-500.442) (-500.742) [-498.756] (-497.167) * (-498.135) [-497.539] (-499.942) (-505.468) -- 0:00:48
200000 -- (-497.951) (-501.269) (-497.615) [-498.929] * (-498.314) (-500.746) (-500.518) [-497.722] -- 0:00:48
Average standard deviation of split frequencies: 0.013128
200500 -- (-500.269) (-500.822) [-497.639] (-502.485) * (-498.282) (-498.392) [-499.364] (-497.826) -- 0:00:47
201000 -- (-504.541) (-499.708) (-501.037) [-497.989] * [-501.448] (-501.968) (-501.912) (-503.168) -- 0:00:47
201500 -- (-499.347) (-500.037) [-498.116] (-498.774) * [-500.923] (-500.576) (-501.656) (-506.855) -- 0:00:47
202000 -- (-502.388) (-500.495) [-499.153] (-497.644) * [-498.259] (-501.090) (-502.355) (-503.149) -- 0:00:47
202500 -- (-500.156) [-497.581] (-499.797) (-498.135) * (-500.951) [-498.487] (-499.046) (-502.115) -- 0:00:47
203000 -- (-498.848) (-500.250) (-499.879) [-499.690] * (-501.222) (-498.527) [-498.967] (-498.249) -- 0:00:47
203500 -- (-498.333) (-500.087) [-502.985] (-502.246) * (-506.278) (-499.137) (-498.326) [-498.573] -- 0:00:46
204000 -- (-499.794) [-499.664] (-501.450) (-498.441) * [-498.177] (-498.628) (-498.311) (-499.522) -- 0:00:46
204500 -- (-497.424) (-501.633) [-499.645] (-498.165) * (-498.742) (-497.339) [-497.962] (-500.224) -- 0:00:46
205000 -- (-499.396) (-500.048) (-500.911) [-497.162] * (-498.940) [-497.536] (-496.978) (-499.095) -- 0:00:46
Average standard deviation of split frequencies: 0.011803
205500 -- (-498.934) (-500.614) (-500.520) [-500.047] * (-501.660) (-497.490) (-498.470) [-500.888] -- 0:00:46
206000 -- (-497.223) (-499.649) (-500.346) [-499.864] * [-496.781] (-498.983) (-499.009) (-499.709) -- 0:00:46
206500 -- [-497.309] (-499.531) (-498.421) (-497.475) * (-500.521) (-500.436) [-498.793] (-497.807) -- 0:00:46
207000 -- [-497.786] (-501.172) (-496.927) (-497.800) * (-503.117) (-506.694) [-499.948] (-499.608) -- 0:00:45
207500 -- [-498.031] (-506.202) (-497.666) (-499.598) * [-499.947] (-502.527) (-499.852) (-499.374) -- 0:00:45
208000 -- (-500.793) (-499.062) [-497.739] (-499.605) * (-502.109) [-502.528] (-501.607) (-499.374) -- 0:00:45
208500 -- [-497.819] (-497.039) (-498.351) (-504.592) * (-498.392) [-497.543] (-499.757) (-497.366) -- 0:00:45
209000 -- (-498.466) [-499.621] (-502.589) (-498.879) * (-504.285) [-498.429] (-497.044) (-498.720) -- 0:00:45
209500 -- [-496.886] (-498.853) (-502.802) (-498.184) * (-503.062) (-499.198) (-497.174) [-498.920] -- 0:00:45
210000 -- [-497.003] (-499.970) (-497.237) (-498.642) * [-499.733] (-500.820) (-500.880) (-501.069) -- 0:00:45
Average standard deviation of split frequencies: 0.013302
210500 -- (-497.722) (-498.747) [-502.080] (-502.437) * (-499.771) (-500.347) (-497.581) [-500.150] -- 0:00:45
211000 -- (-497.071) (-497.199) (-499.337) [-498.340] * (-499.763) (-500.827) (-498.418) [-499.880] -- 0:00:44
211500 -- (-499.377) [-497.306] (-497.882) (-500.780) * (-500.795) [-498.992] (-497.486) (-499.232) -- 0:00:44
212000 -- [-499.187] (-499.384) (-498.714) (-499.034) * (-501.438) [-503.266] (-497.762) (-501.765) -- 0:00:44
212500 -- [-499.690] (-501.137) (-497.180) (-498.140) * (-498.042) [-501.008] (-497.955) (-498.530) -- 0:00:48
213000 -- [-504.430] (-497.652) (-499.176) (-498.397) * (-499.954) (-499.264) [-499.638] (-498.256) -- 0:00:48
213500 -- (-501.078) (-499.442) (-499.773) [-498.828] * (-497.516) (-499.303) (-500.848) [-499.476] -- 0:00:47
214000 -- (-501.278) (-497.825) (-497.189) [-498.038] * [-498.742] (-498.974) (-504.460) (-497.990) -- 0:00:47
214500 -- [-499.383] (-499.537) (-498.040) (-499.534) * (-497.997) (-500.732) [-500.824] (-498.593) -- 0:00:47
215000 -- (-499.874) (-501.892) (-498.653) [-497.250] * (-506.365) [-505.891] (-498.901) (-499.776) -- 0:00:47
Average standard deviation of split frequencies: 0.014892
215500 -- (-501.324) (-498.501) (-499.239) [-499.167] * (-497.649) (-500.618) [-498.145] (-501.061) -- 0:00:47
216000 -- (-498.370) [-498.890] (-498.236) (-501.098) * (-498.494) (-502.990) [-499.994] (-503.909) -- 0:00:47
216500 -- (-498.394) (-501.971) [-500.219] (-499.021) * [-498.050] (-501.304) (-499.858) (-503.758) -- 0:00:47
217000 -- (-499.442) [-497.723] (-499.177) (-498.139) * (-497.678) (-499.957) [-501.793] (-500.688) -- 0:00:46
217500 -- (-497.602) [-499.200] (-500.315) (-502.403) * (-500.214) (-496.931) [-498.276] (-498.319) -- 0:00:46
218000 -- (-498.944) (-500.435) [-497.628] (-500.981) * [-501.289] (-502.168) (-496.726) (-498.478) -- 0:00:46
218500 -- (-499.943) (-500.272) [-497.369] (-500.346) * [-498.315] (-499.984) (-497.280) (-499.841) -- 0:00:46
219000 -- [-501.220] (-498.571) (-498.006) (-501.215) * (-502.541) (-497.668) [-498.127] (-498.531) -- 0:00:46
219500 -- [-498.181] (-498.526) (-502.926) (-500.775) * (-499.724) [-498.716] (-500.808) (-499.471) -- 0:00:46
220000 -- [-499.355] (-500.546) (-500.121) (-498.380) * (-498.236) (-503.624) [-497.397] (-498.815) -- 0:00:46
Average standard deviation of split frequencies: 0.012943
220500 -- (-497.841) (-499.186) (-497.993) [-503.783] * (-500.078) (-498.763) (-499.643) [-500.234] -- 0:00:45
221000 -- [-502.882] (-497.098) (-500.909) (-500.515) * (-497.378) (-498.659) [-497.567] (-496.871) -- 0:00:45
221500 -- (-499.610) (-499.842) (-500.695) [-498.907] * (-498.905) [-497.048] (-498.030) (-496.797) -- 0:00:45
222000 -- (-503.732) (-498.120) [-497.998] (-497.909) * (-498.463) [-497.898] (-498.233) (-498.641) -- 0:00:45
222500 -- [-502.143] (-498.063) (-498.773) (-501.937) * (-498.075) (-498.899) [-497.931] (-499.990) -- 0:00:45
223000 -- (-500.335) (-497.267) [-497.412] (-502.596) * [-500.374] (-501.991) (-498.868) (-497.650) -- 0:00:45
223500 -- [-497.242] (-498.200) (-500.420) (-499.901) * (-499.939) (-498.862) [-497.361] (-499.949) -- 0:00:45
224000 -- [-497.862] (-498.007) (-500.618) (-499.997) * (-499.321) (-497.725) [-499.940] (-500.448) -- 0:00:45
224500 -- [-499.005] (-502.229) (-498.168) (-501.589) * (-500.475) (-498.996) (-501.158) [-498.351] -- 0:00:44
225000 -- (-498.840) (-499.307) (-498.401) [-499.985] * [-497.761] (-498.575) (-505.132) (-499.441) -- 0:00:44
Average standard deviation of split frequencies: 0.011088
225500 -- (-500.927) [-498.047] (-498.709) (-498.284) * [-497.208] (-498.646) (-499.341) (-498.865) -- 0:00:44
226000 -- (-500.952) [-497.402] (-499.399) (-498.653) * (-498.268) [-499.867] (-499.107) (-499.924) -- 0:00:44
226500 -- (-500.029) (-499.357) [-499.543] (-501.790) * [-498.573] (-498.848) (-501.132) (-499.452) -- 0:00:44
227000 -- (-500.994) (-497.289) (-498.887) [-502.209] * [-499.107] (-498.084) (-503.527) (-498.908) -- 0:00:44
227500 -- (-500.654) [-497.462] (-497.278) (-498.343) * (-500.623) [-500.767] (-503.684) (-498.292) -- 0:00:44
228000 -- (-503.829) [-500.674] (-498.652) (-499.442) * [-499.350] (-499.037) (-497.085) (-502.444) -- 0:00:44
228500 -- [-497.229] (-501.117) (-497.368) (-499.077) * (-497.203) (-498.118) (-501.866) [-500.551] -- 0:00:43
229000 -- (-497.797) (-499.197) (-497.388) [-497.905] * [-497.347] (-498.076) (-497.808) (-503.789) -- 0:00:43
229500 -- [-498.429] (-498.804) (-497.512) (-501.136) * (-498.947) (-498.303) [-501.305] (-502.503) -- 0:00:47
230000 -- (-502.676) [-497.723] (-498.788) (-504.819) * (-497.984) [-499.795] (-498.556) (-501.078) -- 0:00:46
Average standard deviation of split frequencies: 0.011724
230500 -- [-498.067] (-497.745) (-497.733) (-500.342) * [-497.352] (-499.202) (-499.046) (-500.753) -- 0:00:46
231000 -- (-498.860) (-498.396) [-500.196] (-497.574) * (-499.718) (-499.082) [-498.301] (-502.436) -- 0:00:46
231500 -- [-498.528] (-498.239) (-498.361) (-496.746) * [-499.112] (-501.426) (-499.991) (-497.567) -- 0:00:46
232000 -- (-499.780) (-497.805) (-501.211) [-496.888] * (-500.152) [-504.746] (-498.499) (-498.731) -- 0:00:46
232500 -- (-500.147) (-500.097) [-497.522] (-496.974) * (-498.345) (-499.335) (-497.366) [-498.609] -- 0:00:46
233000 -- [-498.942] (-499.580) (-497.718) (-498.916) * (-498.835) (-498.540) [-497.473] (-499.184) -- 0:00:46
233500 -- [-498.001] (-499.561) (-500.411) (-498.077) * [-497.449] (-499.542) (-497.258) (-501.235) -- 0:00:45
234000 -- (-499.738) [-498.908] (-502.269) (-496.993) * (-498.869) (-497.978) [-501.904] (-496.903) -- 0:00:45
234500 -- [-498.339] (-498.810) (-498.116) (-498.848) * [-499.216] (-500.085) (-500.014) (-498.830) -- 0:00:45
235000 -- [-499.291] (-496.642) (-499.557) (-499.057) * [-497.939] (-503.975) (-499.498) (-500.175) -- 0:00:45
Average standard deviation of split frequencies: 0.011354
235500 -- (-497.831) (-497.580) [-499.232] (-499.232) * [-497.797] (-501.099) (-498.635) (-501.273) -- 0:00:45
236000 -- (-498.161) (-499.646) (-498.295) [-499.912] * (-500.233) (-500.977) [-498.203] (-499.667) -- 0:00:45
236500 -- [-501.846] (-497.946) (-501.099) (-498.759) * (-503.024) (-498.794) [-497.635] (-502.242) -- 0:00:45
237000 -- [-499.825] (-501.553) (-497.858) (-500.166) * (-500.300) (-500.201) [-500.739] (-497.985) -- 0:00:45
237500 -- (-501.392) [-497.960] (-499.202) (-501.055) * (-503.318) [-497.617] (-500.977) (-498.375) -- 0:00:44
238000 -- (-497.664) [-498.531] (-503.640) (-498.150) * (-500.496) [-497.883] (-500.368) (-498.261) -- 0:00:44
238500 -- (-498.174) (-500.167) [-498.002] (-501.016) * (-498.030) [-503.689] (-499.218) (-499.994) -- 0:00:44
239000 -- [-499.266] (-499.759) (-498.541) (-503.717) * [-502.345] (-501.048) (-497.393) (-497.843) -- 0:00:44
239500 -- [-498.901] (-498.003) (-499.238) (-498.339) * (-497.592) (-502.638) (-497.083) [-498.840] -- 0:00:44
240000 -- (-498.795) (-497.196) (-498.384) [-496.902] * (-497.713) (-505.987) [-499.267] (-499.484) -- 0:00:44
Average standard deviation of split frequencies: 0.012623
240500 -- (-499.165) (-497.336) (-498.911) [-501.492] * (-498.606) (-499.620) (-497.102) [-499.082] -- 0:00:44
241000 -- (-497.944) [-498.848] (-500.359) (-500.589) * (-502.290) (-498.913) [-498.452] (-498.773) -- 0:00:44
241500 -- [-499.373] (-506.078) (-498.873) (-502.246) * (-502.982) (-501.948) (-497.369) [-502.014] -- 0:00:43
242000 -- (-497.979) [-498.446] (-497.643) (-500.958) * (-501.940) (-499.806) [-499.411] (-500.469) -- 0:00:43
242500 -- (-497.359) [-497.720] (-502.562) (-498.261) * (-498.595) (-502.016) (-501.513) [-497.684] -- 0:00:43
243000 -- (-501.709) (-500.633) (-500.448) [-498.372] * (-500.892) (-499.189) [-498.740] (-499.465) -- 0:00:43
243500 -- (-498.507) (-497.888) [-499.343] (-501.198) * [-498.752] (-500.446) (-498.273) (-497.780) -- 0:00:43
244000 -- (-498.873) (-497.666) (-498.208) [-501.736] * [-502.758] (-497.381) (-498.441) (-499.979) -- 0:00:43
244500 -- (-498.215) (-499.609) (-500.430) [-501.942] * (-500.884) [-498.193] (-497.947) (-503.672) -- 0:00:43
245000 -- (-499.745) [-499.487] (-497.375) (-499.578) * (-497.512) [-498.418] (-497.412) (-499.168) -- 0:00:43
Average standard deviation of split frequencies: 0.012243
245500 -- (-498.206) [-498.686] (-500.216) (-502.080) * [-500.458] (-502.400) (-498.308) (-500.643) -- 0:00:43
246000 -- (-497.590) (-501.547) [-498.565] (-502.658) * (-498.878) [-500.090] (-497.090) (-496.848) -- 0:00:42
246500 -- (-499.923) [-497.216] (-499.985) (-499.455) * (-499.333) [-503.669] (-499.529) (-500.612) -- 0:00:45
247000 -- (-500.653) (-499.972) [-503.473] (-499.653) * [-496.956] (-499.562) (-499.764) (-498.796) -- 0:00:45
247500 -- (-497.705) [-499.136] (-497.226) (-502.584) * (-497.243) [-498.466] (-502.924) (-500.283) -- 0:00:45
248000 -- (-498.459) (-498.660) (-499.923) [-497.592] * (-503.450) [-500.597] (-497.861) (-499.361) -- 0:00:45
248500 -- (-500.231) (-499.747) (-498.532) [-497.630] * (-498.473) [-500.009] (-501.259) (-497.200) -- 0:00:45
249000 -- (-498.378) (-498.983) (-496.909) [-498.555] * (-498.084) [-497.382] (-498.475) (-497.307) -- 0:00:45
249500 -- [-498.162] (-499.529) (-501.003) (-505.419) * [-502.024] (-498.146) (-497.971) (-498.063) -- 0:00:45
250000 -- [-497.642] (-497.133) (-501.282) (-501.668) * (-501.561) [-498.841] (-498.316) (-498.114) -- 0:00:45
Average standard deviation of split frequencies: 0.012500
250500 -- (-498.746) (-497.754) (-504.959) [-500.264] * (-498.346) (-501.871) [-496.879] (-507.198) -- 0:00:44
251000 -- (-501.539) (-500.685) (-499.182) [-498.576] * [-497.720] (-499.827) (-498.793) (-498.637) -- 0:00:44
251500 -- (-508.243) (-499.048) (-499.567) [-499.029] * (-499.685) [-500.003] (-500.851) (-498.846) -- 0:00:44
252000 -- (-499.529) (-499.864) (-499.912) [-498.146] * (-500.138) (-500.591) (-498.566) [-497.831] -- 0:00:44
252500 -- (-501.805) (-500.295) (-499.309) [-498.422] * (-501.828) (-497.870) (-497.297) [-499.691] -- 0:00:44
253000 -- (-497.178) [-499.843] (-496.819) (-496.839) * [-500.703] (-497.228) (-500.101) (-497.639) -- 0:00:44
253500 -- (-500.604) [-500.522] (-497.926) (-498.090) * [-500.168] (-500.705) (-498.868) (-497.099) -- 0:00:44
254000 -- [-499.559] (-501.365) (-499.312) (-499.062) * (-503.873) [-497.449] (-497.591) (-497.440) -- 0:00:44
254500 -- (-502.880) (-500.177) (-501.524) [-499.788] * (-510.167) (-501.529) (-499.622) [-498.124] -- 0:00:43
255000 -- (-498.385) (-499.730) [-499.377] (-499.055) * (-501.554) (-497.415) (-498.232) [-501.689] -- 0:00:43
Average standard deviation of split frequencies: 0.012132
255500 -- [-497.699] (-501.727) (-499.363) (-498.210) * (-500.770) (-500.299) [-497.039] (-502.045) -- 0:00:43
256000 -- (-497.887) (-497.571) [-499.512] (-498.269) * (-500.943) [-507.594] (-498.532) (-499.413) -- 0:00:43
256500 -- (-500.078) [-498.894] (-501.113) (-497.760) * (-499.150) [-499.301] (-498.730) (-499.735) -- 0:00:43
257000 -- (-501.642) (-500.326) (-498.716) [-498.986] * (-499.245) (-498.995) (-499.398) [-499.879] -- 0:00:43
257500 -- [-497.322] (-500.418) (-498.268) (-498.794) * (-497.101) (-497.457) (-498.827) [-500.667] -- 0:00:43
258000 -- (-498.476) (-502.848) (-497.397) [-497.256] * (-497.353) (-498.282) [-497.500] (-500.625) -- 0:00:43
258500 -- (-500.610) (-504.533) [-498.921] (-497.502) * (-499.407) (-497.737) [-497.579] (-503.236) -- 0:00:43
259000 -- (-498.419) [-499.468] (-500.438) (-498.174) * (-501.153) [-498.933] (-500.756) (-506.518) -- 0:00:42
259500 -- [-497.836] (-497.928) (-499.096) (-503.964) * (-498.636) (-499.842) [-499.496] (-499.417) -- 0:00:42
260000 -- (-498.562) [-499.968] (-504.309) (-499.525) * (-498.297) (-501.581) (-500.241) [-500.842] -- 0:00:42
Average standard deviation of split frequencies: 0.013191
260500 -- [-501.854] (-500.976) (-500.525) (-501.120) * [-500.707] (-502.402) (-501.427) (-500.174) -- 0:00:42
261000 -- (-499.660) [-498.753] (-499.036) (-499.384) * (-499.289) (-497.241) (-499.247) [-500.698] -- 0:00:42
261500 -- (-499.015) [-504.950] (-498.414) (-498.135) * [-502.296] (-500.954) (-501.369) (-499.015) -- 0:00:42
262000 -- [-500.212] (-499.442) (-499.871) (-497.937) * (-498.285) (-497.438) (-499.955) [-499.203] -- 0:00:42
262500 -- (-500.353) (-497.381) [-500.283] (-501.226) * (-498.163) [-497.185] (-497.436) (-499.787) -- 0:00:42
263000 -- (-501.099) (-497.975) [-498.901] (-501.332) * (-501.237) [-497.679] (-499.223) (-497.420) -- 0:00:42
263500 -- (-499.360) [-497.573] (-501.763) (-500.369) * (-499.679) (-498.204) (-497.876) [-498.693] -- 0:00:44
264000 -- (-502.214) [-498.446] (-499.692) (-503.072) * (-498.106) (-499.834) [-498.091] (-500.239) -- 0:00:44
264500 -- (-498.035) (-501.052) (-503.221) [-501.930] * (-498.275) (-498.874) [-499.000] (-498.198) -- 0:00:44
265000 -- (-501.970) [-498.122] (-501.709) (-499.079) * [-499.010] (-499.847) (-497.540) (-498.429) -- 0:00:44
Average standard deviation of split frequencies: 0.012718
265500 -- (-500.111) (-502.858) (-498.634) [-497.088] * (-498.514) (-501.390) [-500.563] (-498.243) -- 0:00:44
266000 -- (-499.722) (-498.288) (-497.275) [-497.773] * (-500.374) [-499.424] (-497.445) (-500.540) -- 0:00:44
266500 -- (-504.729) (-499.181) [-498.075] (-498.531) * (-500.232) [-498.964] (-500.539) (-496.998) -- 0:00:44
267000 -- (-502.803) (-502.515) (-501.285) [-500.827] * (-499.342) (-500.735) (-500.101) [-500.029] -- 0:00:43
267500 -- [-500.451] (-506.496) (-498.521) (-500.309) * (-498.802) (-502.413) [-500.169] (-499.412) -- 0:00:43
268000 -- (-498.829) [-497.015] (-498.707) (-501.202) * (-498.489) (-499.676) (-498.190) [-502.516] -- 0:00:43
268500 -- (-500.054) (-498.938) (-498.777) [-498.333] * (-502.079) [-499.004] (-497.977) (-497.691) -- 0:00:43
269000 -- (-497.243) [-499.920] (-500.967) (-498.109) * (-500.146) (-499.646) [-498.635] (-498.043) -- 0:00:43
269500 -- (-500.643) (-502.167) [-504.953] (-498.794) * [-497.165] (-498.722) (-499.387) (-498.708) -- 0:00:43
270000 -- [-499.717] (-504.157) (-500.653) (-504.737) * (-498.427) [-498.085] (-499.182) (-497.220) -- 0:00:43
Average standard deviation of split frequencies: 0.012089
270500 -- (-498.871) [-496.870] (-501.079) (-501.438) * (-498.651) (-497.534) [-500.645] (-500.465) -- 0:00:43
271000 -- (-497.321) (-496.812) (-500.835) [-499.036] * (-499.998) (-497.420) [-501.747] (-497.863) -- 0:00:43
271500 -- (-498.783) [-499.353] (-505.893) (-497.204) * [-498.275] (-498.582) (-500.497) (-500.345) -- 0:00:42
272000 -- (-499.244) (-499.997) (-498.806) [-497.401] * (-501.073) [-502.085] (-498.009) (-500.271) -- 0:00:42
272500 -- [-497.662] (-500.270) (-499.340) (-500.554) * (-499.638) (-497.890) [-499.028] (-498.151) -- 0:00:42
273000 -- (-497.297) (-497.404) [-500.619] (-501.153) * (-503.025) [-498.063] (-496.695) (-498.495) -- 0:00:42
273500 -- [-498.525] (-497.818) (-497.820) (-501.660) * (-504.622) [-497.877] (-497.717) (-497.436) -- 0:00:42
274000 -- (-498.114) [-498.145] (-498.897) (-498.557) * (-499.550) (-497.655) [-500.875] (-498.273) -- 0:00:42
274500 -- [-498.114] (-497.423) (-501.583) (-498.649) * (-500.630) (-498.130) [-498.250] (-499.672) -- 0:00:42
275000 -- (-500.350) (-500.844) [-499.027] (-499.638) * [-499.066] (-497.488) (-497.517) (-498.717) -- 0:00:42
Average standard deviation of split frequencies: 0.012157
275500 -- (-498.504) (-505.344) [-497.556] (-501.716) * (-499.674) (-502.180) [-500.413] (-499.104) -- 0:00:42
276000 -- (-504.775) [-501.293] (-499.192) (-499.102) * (-497.968) (-498.455) (-498.001) [-497.509] -- 0:00:41
276500 -- (-501.331) (-501.986) (-500.322) [-498.612] * (-502.092) (-496.865) [-500.587] (-497.766) -- 0:00:41
277000 -- (-502.175) (-499.255) (-501.253) [-496.907] * (-499.720) [-497.929] (-498.860) (-500.324) -- 0:00:41
277500 -- (-496.753) [-499.706] (-499.768) (-497.634) * (-497.581) [-499.336] (-502.210) (-498.626) -- 0:00:41
278000 -- (-497.620) [-499.007] (-503.119) (-499.182) * (-499.799) [-498.996] (-498.717) (-499.959) -- 0:00:41
278500 -- (-499.832) (-499.449) [-499.111] (-497.885) * (-497.464) (-496.817) (-503.246) [-501.156] -- 0:00:41
279000 -- (-500.279) [-501.521] (-496.950) (-497.346) * [-499.770] (-496.909) (-500.321) (-502.775) -- 0:00:41
279500 -- [-497.931] (-498.526) (-503.256) (-497.684) * (-500.002) [-497.151] (-498.340) (-505.031) -- 0:00:43
280000 -- (-497.806) (-497.289) [-499.809] (-496.839) * (-499.545) [-497.738] (-499.500) (-497.869) -- 0:00:43
Average standard deviation of split frequencies: 0.012745
280500 -- (-498.846) [-496.881] (-497.436) (-498.463) * (-497.829) (-498.712) [-500.358] (-498.743) -- 0:00:43
281000 -- (-500.237) (-501.113) [-497.950] (-501.068) * (-499.305) [-498.231] (-499.572) (-498.768) -- 0:00:43
281500 -- (-497.293) (-498.767) (-498.648) [-497.223] * [-499.800] (-501.468) (-499.214) (-501.386) -- 0:00:43
282000 -- (-497.647) [-498.747] (-499.388) (-508.280) * (-501.365) (-499.631) (-497.434) [-498.258] -- 0:00:43
282500 -- [-499.824] (-499.119) (-500.674) (-503.200) * (-499.839) (-498.077) (-498.769) [-498.869] -- 0:00:43
283000 -- (-499.261) [-499.865] (-500.706) (-500.490) * [-497.474] (-501.525) (-499.381) (-497.602) -- 0:00:43
283500 -- [-498.150] (-498.796) (-506.587) (-498.946) * (-497.910) [-498.362] (-498.041) (-500.794) -- 0:00:42
284000 -- [-500.421] (-497.716) (-499.248) (-500.887) * (-498.331) [-497.885] (-499.938) (-498.643) -- 0:00:42
284500 -- [-500.293] (-497.978) (-499.122) (-498.717) * (-499.114) [-499.015] (-497.139) (-499.028) -- 0:00:42
285000 -- [-497.699] (-498.319) (-500.346) (-501.341) * (-501.111) [-498.194] (-500.513) (-498.382) -- 0:00:42
Average standard deviation of split frequencies: 0.012604
285500 -- (-498.546) (-502.333) (-501.395) [-497.223] * (-503.444) [-499.519] (-501.638) (-502.126) -- 0:00:42
286000 -- (-497.551) [-498.110] (-500.289) (-501.667) * (-500.438) (-499.487) [-498.150] (-499.352) -- 0:00:42
286500 -- (-499.232) [-497.901] (-498.227) (-500.457) * [-497.792] (-499.346) (-499.912) (-498.923) -- 0:00:42
287000 -- (-499.271) (-498.235) [-498.210] (-499.467) * (-501.048) (-497.817) [-497.914] (-501.306) -- 0:00:42
287500 -- (-498.379) [-501.074] (-502.778) (-501.098) * (-498.786) (-497.669) (-498.180) [-499.774] -- 0:00:42
288000 -- (-499.043) (-498.509) (-502.269) [-498.140] * [-499.370] (-501.665) (-498.045) (-499.066) -- 0:00:42
288500 -- [-499.231] (-500.979) (-498.263) (-498.815) * [-498.908] (-500.674) (-499.067) (-500.719) -- 0:00:41
289000 -- (-497.997) [-500.901] (-499.460) (-500.086) * [-499.493] (-497.737) (-498.935) (-500.484) -- 0:00:41
289500 -- (-500.211) (-501.818) (-500.435) [-498.411] * (-501.846) (-498.396) (-499.538) [-499.184] -- 0:00:41
290000 -- (-498.466) (-497.413) [-500.493] (-497.659) * [-498.313] (-498.296) (-503.688) (-497.227) -- 0:00:41
Average standard deviation of split frequencies: 0.012974
290500 -- (-500.711) [-497.867] (-498.149) (-497.244) * (-498.872) (-499.007) (-497.072) [-497.671] -- 0:00:41
291000 -- [-499.658] (-498.217) (-498.115) (-498.207) * (-498.819) (-500.626) (-497.635) [-497.646] -- 0:00:41
291500 -- [-496.923] (-498.695) (-497.173) (-503.511) * (-497.879) (-499.609) [-497.978] (-497.435) -- 0:00:41
292000 -- [-497.864] (-498.707) (-497.611) (-499.288) * (-498.305) [-501.142] (-498.772) (-497.984) -- 0:00:41
292500 -- (-497.532) (-499.014) [-498.597] (-498.758) * (-498.624) [-498.107] (-499.479) (-497.698) -- 0:00:41
293000 -- (-497.117) (-497.537) [-498.608] (-498.889) * (-503.096) [-499.219] (-499.532) (-497.455) -- 0:00:41
293500 -- (-496.758) (-499.659) [-498.907] (-499.056) * (-501.050) (-499.661) [-498.427] (-500.567) -- 0:00:40
294000 -- [-497.319] (-503.393) (-502.307) (-498.972) * [-497.864] (-498.255) (-496.976) (-498.740) -- 0:00:40
294500 -- (-497.171) [-497.024] (-500.112) (-497.567) * (-497.476) (-499.404) (-501.114) [-498.359] -- 0:00:40
295000 -- (-497.792) [-497.356] (-499.238) (-500.286) * (-499.283) [-498.846] (-499.606) (-497.236) -- 0:00:40
Average standard deviation of split frequencies: 0.011856
295500 -- (-499.243) (-497.912) [-497.409] (-499.070) * [-499.669] (-503.022) (-497.849) (-497.966) -- 0:00:40
296000 -- (-498.489) (-498.422) (-504.625) [-498.919] * [-497.979] (-501.443) (-499.057) (-498.789) -- 0:00:40
296500 -- (-498.087) (-499.080) (-500.834) [-498.768] * (-501.625) (-498.215) [-498.567] (-497.659) -- 0:00:40
297000 -- (-499.162) (-499.595) [-501.132] (-499.661) * [-501.573] (-499.441) (-498.919) (-502.393) -- 0:00:42
297500 -- (-500.283) [-500.405] (-497.911) (-498.249) * (-498.169) [-499.313] (-498.224) (-500.854) -- 0:00:42
298000 -- (-501.710) (-498.291) (-498.334) [-497.396] * (-500.695) (-498.642) (-497.470) [-499.004] -- 0:00:42
298500 -- [-497.546] (-498.077) (-498.783) (-498.336) * (-498.898) [-497.568] (-501.209) (-501.071) -- 0:00:42
299000 -- (-497.224) (-498.519) (-498.835) [-497.214] * [-498.732] (-501.343) (-499.750) (-500.908) -- 0:00:42
299500 -- (-500.169) (-498.036) (-498.221) [-499.903] * (-499.596) (-498.747) (-503.374) [-501.585] -- 0:00:42
300000 -- (-500.762) [-500.696] (-501.798) (-501.896) * (-497.209) [-498.071] (-497.276) (-498.874) -- 0:00:42
Average standard deviation of split frequencies: 0.011933
300500 -- (-497.480) [-497.483] (-505.514) (-499.733) * (-497.547) (-498.916) (-499.647) [-500.166] -- 0:00:41
301000 -- [-497.319] (-498.764) (-500.406) (-498.496) * (-498.374) (-498.176) [-499.776] (-502.750) -- 0:00:41
301500 -- [-498.230] (-501.460) (-498.634) (-498.533) * [-499.246] (-499.657) (-500.725) (-499.992) -- 0:00:41
302000 -- (-497.657) (-501.464) (-499.397) [-499.275] * (-500.921) [-501.220] (-502.539) (-509.727) -- 0:00:41
302500 -- (-498.390) (-497.551) (-503.790) [-508.539] * [-504.293] (-502.639) (-501.022) (-502.666) -- 0:00:41
303000 -- (-500.874) [-499.424] (-498.950) (-498.605) * (-503.062) (-502.942) (-498.612) [-499.072] -- 0:00:41
303500 -- (-499.241) (-497.649) [-499.450] (-497.866) * (-502.599) (-498.758) (-500.127) [-499.179] -- 0:00:41
304000 -- (-499.152) (-502.372) (-497.561) [-500.073] * (-504.869) [-497.920] (-506.164) (-500.942) -- 0:00:41
304500 -- (-500.449) (-503.896) (-500.438) [-497.438] * (-504.094) (-499.966) (-501.083) [-497.910] -- 0:00:41
305000 -- [-498.417] (-502.390) (-498.596) (-500.215) * [-498.367] (-506.294) (-498.155) (-499.094) -- 0:00:41
Average standard deviation of split frequencies: 0.011468
305500 -- [-498.921] (-498.221) (-498.004) (-499.511) * (-497.384) (-498.208) [-499.112] (-497.688) -- 0:00:40
306000 -- (-499.588) (-497.891) [-497.225] (-497.013) * (-496.793) (-497.132) (-497.516) [-498.099] -- 0:00:40
306500 -- [-498.859] (-498.148) (-500.923) (-499.190) * (-498.623) [-497.532] (-498.476) (-500.491) -- 0:00:40
307000 -- (-499.592) (-498.461) [-500.552] (-497.832) * (-500.670) [-498.224] (-498.476) (-498.061) -- 0:00:40
307500 -- (-500.942) [-499.310] (-501.196) (-497.912) * (-502.784) [-498.025] (-498.897) (-497.828) -- 0:00:40
308000 -- (-499.149) [-498.545] (-499.026) (-497.607) * [-497.725] (-501.465) (-498.084) (-498.765) -- 0:00:40
308500 -- (-498.382) [-498.578] (-498.917) (-502.608) * (-500.593) (-499.860) [-498.626] (-497.553) -- 0:00:40
309000 -- (-501.217) (-498.976) [-499.834] (-501.515) * (-498.561) [-497.723] (-497.436) (-500.573) -- 0:00:40
309500 -- [-498.192] (-498.928) (-499.753) (-498.507) * (-501.262) [-499.087] (-497.836) (-499.245) -- 0:00:40
310000 -- (-499.351) (-498.773) [-499.019] (-502.027) * (-501.003) (-499.743) [-498.140] (-497.656) -- 0:00:40
Average standard deviation of split frequencies: 0.012059
310500 -- (-498.314) (-503.492) (-499.200) [-499.841] * (-497.809) (-499.948) (-500.180) [-499.035] -- 0:00:39
311000 -- (-497.135) [-499.765] (-497.679) (-499.064) * [-498.595] (-498.170) (-499.867) (-498.611) -- 0:00:39
311500 -- (-497.784) (-499.298) (-503.524) [-498.874] * [-497.712] (-496.849) (-501.247) (-499.417) -- 0:00:39
312000 -- (-497.802) (-502.642) [-497.241] (-497.817) * [-498.827] (-499.391) (-500.128) (-503.320) -- 0:00:39
312500 -- (-498.934) (-501.651) (-501.013) [-499.219] * (-498.854) [-498.573] (-497.988) (-501.965) -- 0:00:39
313000 -- (-497.781) [-500.929] (-499.425) (-498.922) * (-498.908) [-498.980] (-500.404) (-497.269) -- 0:00:39
313500 -- (-498.674) [-500.324] (-505.361) (-498.049) * (-500.531) (-499.008) (-499.221) [-497.570] -- 0:00:41
314000 -- [-501.663] (-498.581) (-498.137) (-504.301) * (-498.273) (-497.228) (-502.095) [-498.733] -- 0:00:41
314500 -- (-499.434) (-499.325) (-503.018) [-498.654] * (-500.441) [-496.994] (-498.737) (-502.381) -- 0:00:41
315000 -- (-499.343) (-498.813) (-497.131) [-497.452] * [-499.456] (-498.319) (-501.179) (-501.088) -- 0:00:41
Average standard deviation of split frequencies: 0.013177
315500 -- (-498.172) (-500.087) (-499.440) [-498.295] * (-497.316) [-498.933] (-499.024) (-501.287) -- 0:00:41
316000 -- (-498.931) (-499.101) (-499.974) [-498.710] * (-499.665) (-498.112) (-501.581) [-497.650] -- 0:00:41
316500 -- [-498.948] (-498.633) (-497.769) (-508.466) * (-498.355) (-500.091) [-499.362] (-498.205) -- 0:00:41
317000 -- (-500.775) [-498.555] (-498.318) (-502.994) * (-498.877) (-502.225) [-501.116] (-499.509) -- 0:00:40
317500 -- [-500.810] (-498.332) (-496.881) (-500.308) * [-497.448] (-501.333) (-497.455) (-499.350) -- 0:00:40
318000 -- (-502.436) (-498.683) (-502.202) [-499.242] * (-498.371) (-498.285) (-498.502) [-498.916] -- 0:00:40
318500 -- [-498.897] (-497.580) (-504.216) (-504.511) * (-503.900) [-498.038] (-498.057) (-500.085) -- 0:00:40
319000 -- [-498.534] (-497.664) (-500.084) (-501.471) * (-502.466) (-502.687) [-497.505] (-499.762) -- 0:00:40
319500 -- (-499.390) (-500.568) (-499.517) [-497.477] * (-507.326) [-497.185] (-497.309) (-499.617) -- 0:00:40
320000 -- (-496.871) (-503.803) (-498.747) [-498.650] * (-501.429) (-499.641) (-500.567) [-498.576] -- 0:00:40
Average standard deviation of split frequencies: 0.013802
320500 -- (-498.539) (-498.529) (-498.958) [-497.540] * (-497.926) (-499.803) (-499.373) [-499.289] -- 0:00:40
321000 -- (-498.412) [-497.906] (-504.219) (-496.887) * (-500.982) (-497.211) (-498.337) [-498.756] -- 0:00:40
321500 -- [-500.146] (-497.538) (-500.172) (-497.409) * (-498.220) (-498.682) [-498.364] (-497.026) -- 0:00:40
322000 -- [-498.462] (-497.255) (-497.559) (-497.833) * [-498.240] (-497.772) (-500.277) (-497.574) -- 0:00:40
322500 -- (-500.167) (-499.337) (-498.306) [-498.676] * (-498.899) (-498.149) (-498.231) [-499.145] -- 0:00:39
323000 -- (-502.762) (-499.736) [-497.357] (-498.053) * (-498.065) (-499.030) [-497.330] (-500.814) -- 0:00:39
323500 -- (-499.871) (-499.936) [-497.141] (-497.752) * [-499.730] (-500.655) (-498.076) (-498.631) -- 0:00:39
324000 -- [-498.640] (-500.878) (-497.761) (-498.061) * (-500.564) [-497.695] (-496.942) (-500.533) -- 0:00:39
324500 -- (-502.292) [-500.526] (-499.516) (-499.587) * (-499.347) [-497.222] (-498.791) (-499.586) -- 0:00:39
325000 -- (-498.547) [-498.205] (-497.240) (-499.576) * (-499.711) [-498.315] (-500.537) (-502.281) -- 0:00:39
Average standard deviation of split frequencies: 0.013243
325500 -- [-497.699] (-500.112) (-497.744) (-502.075) * (-499.229) [-502.247] (-503.946) (-498.292) -- 0:00:39
326000 -- (-498.479) (-504.388) [-499.880] (-498.864) * (-497.230) (-499.731) [-500.243] (-497.521) -- 0:00:39
326500 -- (-499.534) (-500.705) [-497.877] (-500.129) * [-500.792] (-497.495) (-505.845) (-498.410) -- 0:00:39
327000 -- (-496.895) (-499.262) (-496.772) [-498.755] * (-498.289) [-497.672] (-499.250) (-511.738) -- 0:00:39
327500 -- (-502.183) (-500.361) (-498.469) [-497.101] * (-499.687) (-502.299) (-500.139) [-498.099] -- 0:00:39
328000 -- [-496.980] (-499.454) (-498.646) (-499.212) * [-501.483] (-499.711) (-501.298) (-497.222) -- 0:00:38
328500 -- (-497.918) [-501.507] (-497.931) (-499.080) * [-499.045] (-499.197) (-500.880) (-498.456) -- 0:00:38
329000 -- (-500.293) (-500.036) [-497.405] (-498.082) * (-503.498) (-500.037) (-502.698) [-500.754] -- 0:00:40
329500 -- [-500.765] (-498.106) (-499.159) (-504.550) * (-500.369) (-500.010) (-497.682) [-497.396] -- 0:00:40
330000 -- (-504.877) (-500.486) (-499.590) [-498.614] * (-502.669) (-497.222) [-498.584] (-497.458) -- 0:00:40
Average standard deviation of split frequencies: 0.013281
330500 -- [-497.653] (-497.472) (-499.608) (-499.642) * (-498.574) (-497.113) (-498.502) [-501.926] -- 0:00:40
331000 -- [-498.528] (-500.937) (-498.628) (-498.401) * (-497.327) (-497.659) [-498.906] (-502.504) -- 0:00:40
331500 -- (-498.889) (-500.071) (-498.334) [-499.719] * (-502.090) (-499.222) [-498.058] (-503.966) -- 0:00:40
332000 -- (-501.611) (-499.490) [-497.964] (-498.640) * (-498.088) [-498.198] (-499.070) (-499.507) -- 0:00:40
332500 -- (-497.705) [-497.614] (-498.603) (-498.213) * (-498.534) (-497.895) (-500.248) [-499.501] -- 0:00:40
333000 -- (-497.559) (-501.366) (-498.190) [-498.458] * [-499.417] (-498.104) (-501.503) (-497.728) -- 0:00:40
333500 -- (-497.955) [-503.609] (-502.359) (-497.040) * [-499.534] (-499.151) (-498.379) (-499.962) -- 0:00:39
334000 -- (-498.059) (-506.482) (-505.551) [-497.389] * [-498.426] (-500.580) (-501.291) (-499.856) -- 0:00:39
334500 -- (-498.776) [-497.659] (-498.095) (-499.549) * (-498.378) (-500.169) (-498.422) [-498.471] -- 0:00:39
335000 -- [-498.955] (-499.107) (-498.576) (-501.838) * [-499.002] (-499.189) (-501.189) (-501.342) -- 0:00:39
Average standard deviation of split frequencies: 0.013513
335500 -- (-497.558) (-498.649) [-498.115] (-498.871) * (-498.133) [-502.037] (-497.162) (-501.940) -- 0:00:39
336000 -- [-499.735] (-498.370) (-502.584) (-497.980) * (-498.657) (-497.401) [-496.992] (-499.656) -- 0:00:39
336500 -- [-500.288] (-500.756) (-501.091) (-497.898) * [-498.314] (-497.192) (-498.159) (-498.092) -- 0:00:39
337000 -- (-499.008) (-503.925) [-499.924] (-500.934) * (-498.529) [-500.629] (-497.441) (-501.371) -- 0:00:39
337500 -- (-499.811) (-500.235) [-499.262] (-498.055) * (-499.612) (-500.470) (-500.171) [-499.416] -- 0:00:39
338000 -- (-500.010) (-500.236) (-499.670) [-502.010] * [-498.766] (-501.803) (-500.389) (-498.107) -- 0:00:39
338500 -- (-501.723) [-498.442] (-500.627) (-500.862) * (-499.075) (-501.353) (-500.147) [-501.476] -- 0:00:39
339000 -- (-499.261) [-497.896] (-501.346) (-499.304) * (-498.689) (-498.144) (-497.638) [-499.104] -- 0:00:38
339500 -- (-499.693) (-499.564) [-498.239] (-496.824) * (-497.645) [-502.382] (-498.278) (-499.277) -- 0:00:38
340000 -- (-497.723) (-500.823) [-498.086] (-498.202) * (-498.033) (-499.038) (-497.260) [-500.211] -- 0:00:38
Average standard deviation of split frequencies: 0.012381
340500 -- (-499.581) [-496.794] (-498.984) (-497.507) * (-503.472) [-498.253] (-500.971) (-499.052) -- 0:00:38
341000 -- (-498.915) (-497.209) [-498.866] (-497.505) * (-497.349) [-499.439] (-499.468) (-497.720) -- 0:00:38
341500 -- [-497.673] (-500.170) (-501.395) (-502.360) * (-499.317) (-498.598) (-497.944) [-497.551] -- 0:00:38
342000 -- [-498.017] (-502.480) (-500.487) (-500.563) * (-500.116) (-499.876) [-497.179] (-497.565) -- 0:00:38
342500 -- (-498.139) (-500.313) (-497.832) [-497.959] * (-497.147) [-502.069] (-497.348) (-497.538) -- 0:00:38
343000 -- [-500.403] (-499.186) (-498.967) (-499.510) * (-498.322) (-498.003) [-497.402] (-499.550) -- 0:00:38
343500 -- (-498.806) [-497.888] (-498.680) (-497.289) * [-501.185] (-498.036) (-497.950) (-498.525) -- 0:00:38
344000 -- (-503.874) (-497.430) (-500.396) [-510.016] * (-501.615) [-501.803] (-501.716) (-498.858) -- 0:00:40
344500 -- [-499.244] (-497.940) (-502.085) (-500.724) * (-500.709) (-496.686) (-499.650) [-498.678] -- 0:00:39
345000 -- (-497.429) (-497.331) (-502.099) [-499.544] * (-497.689) (-497.759) (-501.014) [-498.841] -- 0:00:39
Average standard deviation of split frequencies: 0.011975
345500 -- (-498.774) (-500.016) [-500.334] (-499.653) * (-498.831) (-499.295) [-500.358] (-502.623) -- 0:00:39
346000 -- (-498.076) [-497.357] (-501.740) (-500.588) * (-501.376) (-498.838) (-497.553) [-497.660] -- 0:00:39
346500 -- (-497.998) (-497.708) (-502.338) [-500.480] * (-500.450) [-498.071] (-498.741) (-505.223) -- 0:00:39
347000 -- (-498.897) (-502.927) [-499.318] (-500.449) * (-500.447) (-499.143) [-498.016] (-499.087) -- 0:00:39
347500 -- (-501.781) [-498.610] (-498.928) (-499.582) * (-500.722) (-500.387) (-501.709) [-497.038] -- 0:00:39
348000 -- (-498.894) (-498.555) (-501.192) [-498.244] * [-496.910] (-498.227) (-500.362) (-500.627) -- 0:00:39
348500 -- (-499.528) (-499.589) (-497.127) [-500.295] * [-497.982] (-498.782) (-499.205) (-498.752) -- 0:00:39
349000 -- (-498.910) [-499.591] (-499.635) (-499.163) * (-499.721) [-498.578] (-497.418) (-499.081) -- 0:00:39
349500 -- [-498.795] (-500.748) (-501.362) (-498.688) * [-498.176] (-499.811) (-497.663) (-497.334) -- 0:00:39
350000 -- (-500.088) [-500.857] (-499.371) (-500.376) * (-501.077) (-500.344) (-498.851) [-497.043] -- 0:00:39
Average standard deviation of split frequencies: 0.011277
350500 -- (-496.975) (-499.661) [-497.034] (-497.557) * (-498.531) [-499.380] (-497.936) (-497.615) -- 0:00:38
351000 -- (-500.042) (-501.430) [-497.434] (-502.826) * (-498.438) [-499.599] (-502.657) (-497.413) -- 0:00:38
351500 -- (-499.970) (-500.497) [-496.900] (-498.746) * (-498.699) (-498.449) [-497.031] (-498.415) -- 0:00:38
352000 -- (-504.005) (-501.134) [-500.733] (-498.102) * [-499.222] (-499.077) (-504.690) (-497.822) -- 0:00:38
352500 -- (-502.997) [-498.930] (-500.184) (-497.752) * (-500.183) [-499.354] (-499.311) (-497.534) -- 0:00:38
353000 -- (-497.618) [-499.807] (-500.509) (-503.116) * (-498.686) (-499.422) (-497.525) [-497.403] -- 0:00:38
353500 -- (-497.592) (-500.761) [-497.684] (-498.908) * [-498.072] (-499.712) (-499.123) (-498.886) -- 0:00:38
354000 -- [-500.155] (-507.890) (-497.220) (-498.470) * (-498.424) (-499.476) (-498.875) [-498.489] -- 0:00:38
354500 -- (-503.552) (-498.925) (-497.992) [-499.137] * [-501.015] (-505.271) (-500.222) (-497.707) -- 0:00:38
355000 -- (-498.152) [-499.043] (-497.901) (-498.128) * (-499.031) (-501.594) [-500.116] (-498.219) -- 0:00:38
Average standard deviation of split frequencies: 0.010593
355500 -- [-499.360] (-498.020) (-502.169) (-499.852) * (-498.750) (-499.507) (-499.277) [-497.179] -- 0:00:38
356000 -- (-500.690) [-498.008] (-497.781) (-499.161) * (-500.118) (-501.989) (-498.873) [-498.987] -- 0:00:37
356500 -- (-500.298) [-498.084] (-497.715) (-499.264) * (-498.223) (-498.540) (-502.833) [-499.223] -- 0:00:37
357000 -- (-501.688) (-497.277) [-498.695] (-498.524) * (-503.017) [-496.868] (-505.843) (-500.859) -- 0:00:37
357500 -- (-500.109) [-499.749] (-497.948) (-496.935) * (-499.835) [-500.252] (-499.529) (-499.475) -- 0:00:37
358000 -- [-501.198] (-498.099) (-500.947) (-499.242) * (-497.724) (-499.958) (-502.007) [-499.690] -- 0:00:37
358500 -- (-499.004) (-498.683) (-500.385) [-498.263] * (-497.931) [-501.861] (-500.606) (-496.819) -- 0:00:37
359000 -- (-506.661) (-500.421) [-498.433] (-499.511) * (-497.512) (-500.408) (-500.325) [-498.510] -- 0:00:37
359500 -- (-499.086) (-499.431) [-501.453] (-500.841) * (-500.192) (-501.317) (-498.368) [-500.931] -- 0:00:39
360000 -- (-498.462) (-498.185) [-499.790] (-499.267) * [-499.377] (-500.864) (-498.942) (-497.416) -- 0:00:39
Average standard deviation of split frequencies: 0.009730
360500 -- (-497.622) (-501.309) [-497.661] (-500.072) * [-501.147] (-499.178) (-500.158) (-498.668) -- 0:00:39
361000 -- (-497.255) (-500.225) (-503.901) [-499.529] * (-500.975) (-500.473) (-500.541) [-498.104] -- 0:00:38
361500 -- (-499.070) [-498.537] (-500.288) (-505.037) * (-500.612) (-499.409) [-498.145] (-498.968) -- 0:00:38
362000 -- (-500.152) (-502.911) [-498.130] (-499.408) * (-499.361) (-502.902) (-498.636) [-498.693] -- 0:00:38
362500 -- (-499.301) (-499.839) (-497.302) [-497.810] * [-497.465] (-499.404) (-499.317) (-500.983) -- 0:00:38
363000 -- (-499.278) (-501.405) [-497.599] (-497.881) * [-497.546] (-499.030) (-498.653) (-497.139) -- 0:00:38
363500 -- (-498.292) (-501.484) (-502.312) [-497.623] * [-497.314] (-500.701) (-498.786) (-497.279) -- 0:00:38
364000 -- (-500.069) [-500.178] (-502.087) (-499.584) * (-498.440) (-500.555) [-497.353] (-499.861) -- 0:00:38
364500 -- (-498.072) (-498.938) (-504.125) [-502.154] * (-501.177) (-500.986) [-497.419] (-499.053) -- 0:00:38
365000 -- (-501.367) [-499.058] (-497.383) (-502.840) * (-498.204) (-498.857) [-501.150] (-497.244) -- 0:00:38
Average standard deviation of split frequencies: 0.010304
365500 -- (-501.035) [-500.145] (-497.927) (-496.992) * (-498.091) [-501.486] (-500.642) (-497.914) -- 0:00:38
366000 -- [-497.402] (-499.300) (-502.163) (-497.931) * (-498.027) (-499.085) [-497.577] (-497.329) -- 0:00:38
366500 -- [-498.348] (-498.048) (-501.910) (-498.861) * (-499.350) (-499.179) [-497.734] (-498.996) -- 0:00:38
367000 -- (-500.148) (-498.608) (-497.520) [-499.194] * [-499.650] (-502.367) (-502.502) (-497.314) -- 0:00:37
367500 -- (-499.678) (-500.504) [-498.841] (-498.990) * [-498.167] (-502.285) (-499.194) (-498.143) -- 0:00:37
368000 -- [-497.826] (-499.777) (-497.483) (-502.642) * (-501.335) (-498.475) (-503.645) [-497.164] -- 0:00:37
368500 -- (-497.480) [-504.139] (-502.983) (-502.028) * (-500.202) (-500.781) (-497.425) [-497.447] -- 0:00:37
369000 -- (-498.324) (-499.559) [-499.679] (-498.786) * (-501.059) [-501.060] (-497.728) (-496.958) -- 0:00:37
369500 -- (-499.970) [-497.718] (-500.465) (-500.387) * [-500.629] (-501.120) (-498.496) (-498.789) -- 0:00:37
370000 -- [-501.127] (-501.695) (-499.732) (-499.115) * [-500.833] (-500.768) (-498.361) (-498.419) -- 0:00:37
Average standard deviation of split frequencies: 0.009397
370500 -- (-499.442) (-498.933) [-499.665] (-498.653) * (-506.697) (-498.547) [-498.076] (-499.055) -- 0:00:37
371000 -- (-500.551) (-500.198) (-503.602) [-497.750] * (-498.065) [-497.641] (-497.768) (-499.120) -- 0:00:37
371500 -- [-502.331] (-499.228) (-497.559) (-501.662) * (-498.333) [-497.611] (-503.849) (-498.375) -- 0:00:37
372000 -- [-501.056] (-498.778) (-500.990) (-500.850) * [-502.122] (-501.058) (-500.340) (-502.681) -- 0:00:37
372500 -- (-500.083) [-499.011] (-506.220) (-500.485) * (-501.144) (-498.579) (-499.620) [-497.599] -- 0:00:37
373000 -- (-499.120) (-500.535) (-503.054) [-497.951] * [-497.698] (-498.437) (-499.806) (-499.063) -- 0:00:36
373500 -- (-499.704) (-503.317) [-500.783] (-498.281) * (-501.699) (-498.303) [-497.454] (-501.960) -- 0:00:36
374000 -- (-499.319) (-500.653) [-499.874] (-499.680) * (-502.147) (-497.400) (-498.433) [-498.029] -- 0:00:36
374500 -- (-499.941) (-498.812) (-498.550) [-497.453] * (-503.216) [-497.695] (-501.243) (-497.860) -- 0:00:36
375000 -- (-500.161) (-497.697) (-500.270) [-500.232] * (-498.914) (-499.066) (-498.151) [-498.311] -- 0:00:36
Average standard deviation of split frequencies: 0.009612
375500 -- (-496.999) (-500.304) (-498.362) [-499.219] * (-497.122) (-502.257) (-500.103) [-498.942] -- 0:00:38
376000 -- (-497.815) [-497.035] (-497.406) (-500.055) * (-497.500) (-498.564) (-499.457) [-499.138] -- 0:00:38
376500 -- [-497.107] (-498.133) (-498.852) (-497.800) * [-499.951] (-500.837) (-498.808) (-499.101) -- 0:00:38
377000 -- (-497.619) [-497.993] (-497.767) (-499.289) * [-502.759] (-498.451) (-499.795) (-498.018) -- 0:00:38
377500 -- [-497.465] (-498.061) (-500.434) (-501.890) * (-499.128) [-496.715] (-500.166) (-498.767) -- 0:00:37
378000 -- (-499.201) (-498.611) (-500.114) [-497.826] * (-498.081) [-499.362] (-500.488) (-500.666) -- 0:00:37
378500 -- (-502.229) (-498.635) (-499.366) [-498.896] * (-497.297) [-499.210] (-500.500) (-503.133) -- 0:00:37
379000 -- [-501.634] (-499.217) (-497.538) (-499.012) * [-497.679] (-500.992) (-500.727) (-500.942) -- 0:00:37
379500 -- (-499.811) (-497.770) (-500.805) [-497.923] * (-499.858) (-497.577) (-497.667) [-497.582] -- 0:00:37
380000 -- (-498.408) (-502.489) [-499.345] (-501.317) * [-500.753] (-501.750) (-497.592) (-500.491) -- 0:00:37
Average standard deviation of split frequencies: 0.009219
380500 -- [-499.022] (-501.706) (-498.365) (-500.599) * (-499.856) (-498.161) (-499.425) [-501.504] -- 0:00:37
381000 -- (-497.411) (-498.103) (-500.757) [-499.880] * (-498.630) (-497.195) [-497.895] (-501.296) -- 0:00:37
381500 -- [-503.141] (-498.003) (-503.273) (-499.039) * (-500.015) (-500.682) [-501.913] (-498.339) -- 0:00:37
382000 -- (-498.976) (-499.796) [-497.798] (-497.899) * [-497.635] (-497.489) (-498.428) (-500.434) -- 0:00:37
382500 -- (-499.676) [-498.062] (-499.209) (-500.199) * (-503.522) (-497.708) (-497.569) [-503.721] -- 0:00:37
383000 -- (-498.614) [-501.478] (-501.366) (-498.121) * (-500.925) (-497.145) (-500.482) [-497.722] -- 0:00:37
383500 -- (-497.827) [-500.381] (-501.020) (-498.102) * (-497.505) [-498.782] (-499.906) (-501.191) -- 0:00:36
384000 -- (-497.527) [-497.408] (-499.119) (-498.638) * (-497.991) (-497.363) (-502.199) [-498.622] -- 0:00:36
384500 -- (-499.231) (-499.010) [-497.709] (-498.588) * (-497.796) (-500.692) [-499.341] (-496.960) -- 0:00:36
385000 -- (-497.215) (-497.826) (-498.255) [-497.103] * (-499.156) (-501.983) (-501.089) [-496.939] -- 0:00:36
Average standard deviation of split frequencies: 0.009159
385500 -- (-498.070) (-497.953) [-499.372] (-498.403) * [-498.907] (-504.099) (-498.838) (-497.549) -- 0:00:36
386000 -- (-498.404) (-498.409) [-497.981] (-498.319) * (-501.100) (-500.556) (-497.737) [-500.181] -- 0:00:36
386500 -- (-499.185) (-499.626) [-498.721] (-501.726) * [-499.386] (-504.206) (-498.663) (-503.040) -- 0:00:36
387000 -- (-504.456) (-497.252) [-499.064] (-500.363) * (-499.137) [-499.271] (-498.333) (-499.709) -- 0:00:36
387500 -- [-498.474] (-499.410) (-498.302) (-506.222) * (-500.025) (-498.675) [-500.736] (-498.261) -- 0:00:36
388000 -- [-501.669] (-496.885) (-499.754) (-499.209) * [-498.556] (-497.613) (-497.572) (-501.508) -- 0:00:36
388500 -- (-502.672) (-497.918) [-498.003] (-497.662) * (-497.996) (-498.171) [-497.257] (-500.299) -- 0:00:36
389000 -- [-497.589] (-500.559) (-499.834) (-502.913) * (-498.043) (-499.184) (-500.229) [-504.076] -- 0:00:36
389500 -- (-497.840) [-503.578] (-499.053) (-498.363) * (-499.172) [-497.058] (-499.356) (-503.782) -- 0:00:36
390000 -- [-498.235] (-501.893) (-499.663) (-497.899) * [-498.376] (-497.645) (-502.151) (-501.429) -- 0:00:35
Average standard deviation of split frequencies: 0.009251
390500 -- (-497.358) (-498.446) [-498.257] (-498.594) * (-498.275) [-498.876] (-502.756) (-502.357) -- 0:00:35
391000 -- (-498.921) (-497.259) [-498.129] (-498.603) * (-498.139) [-497.693] (-503.560) (-497.909) -- 0:00:37
391500 -- (-496.798) (-497.427) [-496.828] (-497.475) * (-497.228) [-499.769] (-503.166) (-499.203) -- 0:00:37
392000 -- (-497.429) [-497.330] (-497.213) (-497.890) * [-497.562] (-500.768) (-498.894) (-503.529) -- 0:00:37
392500 -- (-499.975) (-500.403) (-497.866) [-497.309] * (-501.180) (-500.401) [-497.762] (-497.597) -- 0:00:37
393000 -- (-498.926) [-500.478] (-500.454) (-500.668) * (-503.800) [-498.429] (-497.784) (-499.890) -- 0:00:37
393500 -- (-498.433) (-500.407) (-501.459) [-500.209] * [-502.113] (-498.089) (-497.131) (-499.606) -- 0:00:36
394000 -- [-500.167] (-502.522) (-502.673) (-498.173) * (-497.715) (-499.006) (-498.125) [-497.387] -- 0:00:36
394500 -- (-498.388) (-501.708) [-499.249] (-499.309) * (-500.627) (-497.610) [-500.101] (-497.553) -- 0:00:36
395000 -- [-499.207] (-505.741) (-497.725) (-497.392) * [-499.212] (-496.835) (-497.539) (-498.478) -- 0:00:36
Average standard deviation of split frequencies: 0.009788
395500 -- (-502.531) [-498.427] (-503.714) (-498.798) * (-498.132) (-499.789) [-497.388] (-505.549) -- 0:00:36
396000 -- (-499.015) (-497.218) (-504.090) [-499.143] * (-500.866) (-497.206) [-499.290] (-501.263) -- 0:00:36
396500 -- (-497.073) (-499.732) [-498.163] (-498.918) * (-497.410) (-497.743) (-498.278) [-500.576] -- 0:00:36
397000 -- [-497.909] (-499.609) (-504.291) (-506.203) * (-498.398) (-502.510) (-500.729) [-499.969] -- 0:00:36
397500 -- [-499.570] (-500.373) (-498.020) (-498.132) * (-497.799) [-499.303] (-498.573) (-501.681) -- 0:00:36
398000 -- (-497.471) (-498.608) [-497.393] (-497.302) * (-498.051) [-498.211] (-498.624) (-497.154) -- 0:00:36
398500 -- (-506.039) [-500.823] (-499.082) (-497.700) * [-498.181] (-498.650) (-502.196) (-498.477) -- 0:00:36
399000 -- (-499.538) (-497.322) (-504.949) [-499.894] * (-501.049) (-499.572) (-500.792) [-499.730] -- 0:00:36
399500 -- (-500.136) (-500.485) (-501.985) [-500.127] * [-498.151] (-498.666) (-500.209) (-499.962) -- 0:00:36
400000 -- (-498.723) (-499.205) [-498.525] (-503.892) * [-497.909] (-496.694) (-498.747) (-498.835) -- 0:00:36
Average standard deviation of split frequencies: 0.009935
400500 -- (-497.137) (-499.720) [-498.375] (-499.008) * [-497.299] (-497.074) (-498.359) (-498.712) -- 0:00:35
401000 -- (-498.590) (-500.256) [-498.446] (-501.646) * [-498.292] (-497.413) (-501.822) (-498.110) -- 0:00:35
401500 -- (-499.827) [-497.158] (-499.866) (-500.732) * (-499.805) (-497.115) (-500.439) [-496.955] -- 0:00:35
402000 -- (-499.243) [-498.913] (-498.700) (-498.265) * (-497.907) (-497.065) [-496.861] (-502.484) -- 0:00:35
402500 -- [-498.669] (-498.938) (-497.284) (-500.848) * (-497.642) [-498.622] (-499.476) (-498.259) -- 0:00:35
403000 -- (-497.570) (-500.777) [-499.233] (-501.567) * (-506.220) (-498.396) (-500.075) [-497.380] -- 0:00:35
403500 -- [-500.746] (-498.737) (-498.209) (-499.949) * (-500.571) (-498.520) [-501.089] (-497.509) -- 0:00:35
404000 -- (-500.845) [-502.580] (-499.108) (-497.010) * [-502.836] (-499.269) (-500.910) (-498.241) -- 0:00:35
404500 -- [-499.389] (-500.584) (-499.097) (-497.665) * (-497.884) (-499.246) [-502.523] (-498.686) -- 0:00:35
405000 -- (-502.035) (-499.855) [-499.711] (-500.091) * (-499.742) [-498.555] (-500.160) (-497.406) -- 0:00:35
Average standard deviation of split frequencies: 0.010192
405500 -- (-499.181) (-500.964) (-499.886) [-501.956] * [-500.488] (-503.948) (-499.427) (-499.240) -- 0:00:35
406000 -- (-497.361) (-499.445) (-500.298) [-501.562] * [-501.182] (-502.853) (-497.642) (-498.222) -- 0:00:35
406500 -- [-497.836] (-500.720) (-501.890) (-499.212) * (-498.906) (-498.838) (-500.713) [-498.006] -- 0:00:35
407000 -- (-499.336) (-498.925) [-502.758] (-499.287) * (-497.666) (-499.071) (-500.020) [-504.061] -- 0:00:34
407500 -- [-500.729] (-497.852) (-498.349) (-502.124) * (-499.265) (-500.371) (-499.939) [-498.261] -- 0:00:36
408000 -- (-502.718) (-503.524) [-499.006] (-501.326) * [-499.014] (-507.418) (-499.849) (-498.783) -- 0:00:36
408500 -- [-501.847] (-508.327) (-499.867) (-498.592) * (-500.403) [-499.908] (-499.421) (-499.710) -- 0:00:36
409000 -- (-499.262) (-502.515) [-498.656] (-504.424) * (-501.868) (-497.348) (-499.596) [-497.628] -- 0:00:36
409500 -- (-498.076) (-499.305) (-498.681) [-503.192] * (-497.562) [-501.673] (-501.039) (-497.522) -- 0:00:36
410000 -- (-496.870) (-503.157) (-497.759) [-498.893] * [-499.961] (-501.208) (-498.212) (-497.652) -- 0:00:35
Average standard deviation of split frequencies: 0.010204
410500 -- [-498.755] (-498.569) (-499.634) (-502.062) * (-497.161) [-501.036] (-501.957) (-497.055) -- 0:00:35
411000 -- (-500.155) (-500.423) [-500.036] (-497.413) * (-501.210) (-501.222) (-500.879) [-498.161] -- 0:00:35
411500 -- (-498.000) [-499.172] (-498.612) (-499.862) * (-503.965) (-497.659) [-496.693] (-497.455) -- 0:00:35
412000 -- [-499.755] (-498.718) (-503.232) (-500.986) * (-502.066) [-499.350] (-497.051) (-501.771) -- 0:00:35
412500 -- [-498.086] (-498.516) (-500.137) (-497.185) * (-497.612) (-497.647) [-498.382] (-497.417) -- 0:00:35
413000 -- [-497.351] (-498.000) (-500.681) (-499.058) * (-498.152) [-498.302] (-498.454) (-496.865) -- 0:00:35
413500 -- (-499.521) [-500.114] (-498.440) (-500.243) * (-498.721) (-499.356) (-500.024) [-498.840] -- 0:00:35
414000 -- (-498.130) (-499.176) (-499.552) [-498.735] * (-500.088) (-497.292) [-507.550] (-498.657) -- 0:00:35
414500 -- (-499.082) (-499.828) [-498.546] (-505.081) * (-499.831) [-498.049] (-506.513) (-498.905) -- 0:00:35
415000 -- (-498.935) (-498.656) [-499.828] (-499.965) * [-501.549] (-499.636) (-497.756) (-500.114) -- 0:00:35
Average standard deviation of split frequencies: 0.010073
415500 -- (-500.849) (-501.574) (-500.677) [-499.122] * (-499.642) (-498.664) [-500.633] (-504.920) -- 0:00:35
416000 -- (-501.692) [-499.359] (-499.146) (-499.174) * (-498.404) (-500.048) [-496.905] (-501.645) -- 0:00:35
416500 -- (-499.816) (-498.403) (-496.669) [-497.937] * (-501.842) [-499.324] (-498.114) (-499.089) -- 0:00:35
417000 -- [-500.516] (-499.205) (-500.616) (-498.220) * (-504.412) [-498.028] (-499.141) (-497.163) -- 0:00:34
417500 -- (-501.215) [-497.941] (-501.916) (-498.352) * (-500.006) (-498.838) (-500.051) [-500.264] -- 0:00:34
418000 -- (-499.360) (-498.815) (-502.105) [-497.248] * (-500.677) [-498.270] (-501.505) (-499.457) -- 0:00:34
418500 -- [-499.174] (-499.365) (-500.940) (-497.493) * (-501.240) [-498.888] (-496.782) (-498.518) -- 0:00:34
419000 -- (-497.595) (-501.956) (-504.064) [-498.159] * (-499.024) (-500.356) (-500.891) [-498.694] -- 0:00:34
419500 -- (-499.250) (-498.223) [-505.010] (-498.736) * (-502.119) [-499.504] (-497.454) (-504.196) -- 0:00:34
420000 -- (-499.450) (-497.108) (-500.419) [-506.694] * (-504.648) (-499.637) [-499.664] (-500.257) -- 0:00:34
Average standard deviation of split frequencies: 0.009961
420500 -- (-498.164) (-497.559) (-502.188) [-499.207] * (-503.463) (-498.702) [-499.377] (-502.199) -- 0:00:34
421000 -- (-497.178) (-499.467) (-497.975) [-498.110] * [-502.142] (-499.745) (-502.367) (-499.638) -- 0:00:34
421500 -- (-498.657) [-497.160] (-502.313) (-501.151) * (-500.822) [-497.035] (-502.328) (-503.582) -- 0:00:34
422000 -- (-497.772) [-503.506] (-501.915) (-500.734) * (-497.988) (-497.677) [-497.309] (-499.059) -- 0:00:34
422500 -- (-500.177) (-498.840) [-499.641] (-497.169) * (-498.186) (-501.059) (-498.440) [-498.883] -- 0:00:34
423000 -- (-499.601) (-499.024) (-498.623) [-499.082] * (-501.084) (-499.852) [-498.258] (-497.684) -- 0:00:34
423500 -- (-498.454) [-499.558] (-498.627) (-500.125) * (-499.448) (-497.138) (-498.426) [-500.177] -- 0:00:34
424000 -- (-497.599) (-500.078) (-498.580) [-500.966] * (-498.548) [-498.200] (-499.741) (-508.053) -- 0:00:33
424500 -- (-505.847) (-503.314) [-500.545] (-503.465) * (-501.096) (-501.955) (-499.257) [-498.801] -- 0:00:35
425000 -- (-504.709) [-498.206] (-500.428) (-500.002) * [-500.617] (-497.325) (-499.784) (-498.435) -- 0:00:35
Average standard deviation of split frequencies: 0.009529
425500 -- (-499.940) (-498.303) [-497.256] (-498.098) * (-500.487) (-501.050) [-498.866] (-500.432) -- 0:00:35
426000 -- [-500.165] (-497.967) (-499.057) (-497.126) * (-499.629) [-498.967] (-498.804) (-503.789) -- 0:00:35
426500 -- (-498.374) (-498.127) (-500.914) [-497.107] * [-500.437] (-498.168) (-497.739) (-503.924) -- 0:00:34
427000 -- (-501.601) (-500.302) (-502.312) [-497.281] * (-500.131) [-499.183] (-497.449) (-498.333) -- 0:00:34
427500 -- [-501.018] (-501.376) (-506.953) (-499.184) * (-498.178) (-498.643) [-499.319] (-499.445) -- 0:00:34
428000 -- (-498.386) [-500.559] (-504.689) (-498.626) * (-498.579) (-498.696) (-497.880) [-498.249] -- 0:00:34
428500 -- (-498.848) (-498.613) [-503.589] (-497.974) * (-499.093) (-501.910) [-499.244] (-499.040) -- 0:00:34
429000 -- [-498.950] (-499.253) (-499.882) (-497.791) * (-497.272) (-497.937) [-498.680] (-501.830) -- 0:00:34
429500 -- (-496.980) [-499.640] (-498.030) (-499.192) * [-496.766] (-500.228) (-501.293) (-501.394) -- 0:00:34
430000 -- (-498.256) (-501.094) (-498.404) [-502.189] * (-497.128) (-498.583) [-500.067] (-499.217) -- 0:00:34
Average standard deviation of split frequencies: 0.008878
430500 -- (-501.523) (-499.178) (-498.740) [-500.356] * (-499.026) (-498.615) (-500.379) [-498.752] -- 0:00:34
431000 -- (-498.549) (-498.093) (-498.684) [-499.413] * (-497.904) (-496.989) [-498.535] (-501.154) -- 0:00:34
431500 -- (-499.803) (-498.781) (-497.649) [-498.178] * [-498.126] (-501.883) (-499.501) (-501.991) -- 0:00:34
432000 -- (-499.521) (-498.164) [-499.083] (-497.217) * (-498.206) (-500.725) [-498.174] (-500.346) -- 0:00:34
432500 -- [-499.017] (-497.436) (-501.921) (-498.934) * (-497.621) (-498.056) (-497.603) [-497.863] -- 0:00:34
433000 -- (-501.092) [-497.295] (-503.616) (-499.494) * [-499.001] (-501.502) (-500.239) (-501.665) -- 0:00:34
433500 -- (-499.337) (-498.287) [-497.662] (-498.066) * (-501.006) (-505.355) [-501.989] (-500.005) -- 0:00:33
434000 -- (-507.868) [-500.324] (-500.316) (-501.695) * (-504.958) (-498.584) (-500.211) [-497.965] -- 0:00:33
434500 -- (-501.654) (-501.826) (-498.070) [-498.909] * (-499.373) (-497.869) (-498.857) [-497.021] -- 0:00:33
435000 -- (-499.660) (-498.411) [-501.381] (-500.387) * [-498.186] (-499.766) (-500.308) (-502.493) -- 0:00:33
Average standard deviation of split frequencies: 0.008529
435500 -- (-498.792) [-501.246] (-497.537) (-499.130) * [-497.257] (-499.148) (-498.060) (-498.717) -- 0:00:33
436000 -- (-496.718) (-499.456) [-497.088] (-502.665) * [-497.960] (-498.889) (-497.449) (-498.587) -- 0:00:33
436500 -- (-498.939) (-500.578) (-498.627) [-498.393] * (-505.713) (-497.431) (-498.783) [-499.893] -- 0:00:33
437000 -- (-501.762) [-497.962] (-498.160) (-501.164) * (-502.965) [-499.480] (-498.451) (-498.110) -- 0:00:33
437500 -- (-497.740) (-497.390) [-499.776] (-497.965) * (-498.439) (-499.406) [-498.067] (-498.722) -- 0:00:33
438000 -- (-499.449) (-499.254) (-498.424) [-499.319] * (-497.853) [-500.527] (-498.107) (-500.168) -- 0:00:33
438500 -- (-500.422) (-502.719) [-496.659] (-498.284) * [-500.579] (-499.115) (-499.708) (-498.594) -- 0:00:33
439000 -- (-498.765) (-499.199) [-498.313] (-498.798) * [-499.059] (-500.869) (-497.644) (-498.234) -- 0:00:33
439500 -- [-499.066] (-497.248) (-498.904) (-497.474) * (-499.898) (-500.200) (-498.728) [-496.926] -- 0:00:33
440000 -- (-498.459) [-500.042] (-498.398) (-498.239) * (-497.459) (-500.007) [-501.788] (-499.343) -- 0:00:33
Average standard deviation of split frequencies: 0.007964
440500 -- (-499.519) [-499.364] (-499.338) (-498.959) * (-497.301) (-498.706) [-498.632] (-498.433) -- 0:00:33
441000 -- [-499.891] (-503.191) (-496.948) (-498.889) * (-499.388) (-497.777) [-500.482] (-498.409) -- 0:00:34
441500 -- (-498.199) (-503.901) [-498.102] (-499.540) * [-499.010] (-497.087) (-499.286) (-497.861) -- 0:00:34
442000 -- [-500.217] (-498.540) (-501.027) (-501.840) * (-498.394) (-497.446) (-498.447) [-499.544] -- 0:00:34
442500 -- (-500.952) (-501.497) (-498.173) [-498.349] * [-497.833] (-498.834) (-504.283) (-502.649) -- 0:00:34
443000 -- (-498.994) (-499.742) [-500.431] (-500.832) * (-499.051) (-498.452) [-498.827] (-500.479) -- 0:00:33
443500 -- (-499.564) (-498.405) (-502.533) [-499.336] * (-497.552) [-500.088] (-498.031) (-499.548) -- 0:00:33
444000 -- (-499.537) (-499.461) (-500.586) [-500.692] * (-499.343) [-497.427] (-498.004) (-501.761) -- 0:00:33
444500 -- (-500.613) (-501.822) (-501.449) [-500.438] * (-502.756) (-498.888) (-498.750) [-497.576] -- 0:00:33
445000 -- (-499.958) [-500.023] (-499.435) (-500.917) * (-504.050) (-498.411) [-499.632] (-497.490) -- 0:00:33
Average standard deviation of split frequencies: 0.008456
445500 -- (-497.232) (-500.926) [-498.829] (-498.368) * (-498.926) [-499.915] (-498.770) (-497.372) -- 0:00:33
446000 -- (-497.475) (-498.719) (-496.729) [-499.525] * (-497.224) (-498.219) (-497.588) [-497.986] -- 0:00:33
446500 -- [-498.732] (-498.675) (-496.887) (-499.965) * (-498.839) (-498.085) (-497.872) [-500.221] -- 0:00:33
447000 -- (-497.200) (-499.563) (-499.142) [-499.287] * (-500.382) (-500.027) (-499.600) [-504.870] -- 0:00:33
447500 -- (-497.775) (-501.323) [-500.679] (-499.731) * (-498.937) [-498.647] (-499.963) (-497.444) -- 0:00:33
448000 -- (-496.787) (-498.562) [-502.890] (-501.039) * (-499.572) (-498.235) [-502.514] (-500.745) -- 0:00:33
448500 -- (-499.605) (-498.382) [-498.218] (-497.817) * (-501.275) [-497.601] (-499.497) (-500.996) -- 0:00:33
449000 -- [-498.352] (-498.346) (-500.526) (-497.789) * [-499.028] (-498.094) (-499.661) (-498.127) -- 0:00:33
449500 -- [-499.229] (-499.707) (-499.218) (-499.644) * [-499.188] (-500.111) (-499.909) (-498.610) -- 0:00:33
450000 -- (-500.932) (-499.318) (-503.456) [-498.001] * (-498.518) (-501.775) (-499.486) [-499.583] -- 0:00:33
Average standard deviation of split frequencies: 0.008542
450500 -- (-499.518) (-499.515) (-497.480) [-498.162] * (-497.229) (-501.450) (-499.724) [-497.069] -- 0:00:32
451000 -- (-499.779) (-497.596) [-497.746] (-499.954) * [-501.204] (-498.124) (-497.875) (-500.669) -- 0:00:32
451500 -- (-498.796) (-497.631) [-497.173] (-502.151) * [-498.003] (-500.291) (-498.769) (-497.112) -- 0:00:32
452000 -- (-499.754) (-497.524) [-500.790] (-497.369) * (-501.913) (-497.319) [-497.155] (-498.102) -- 0:00:32
452500 -- (-506.625) (-498.116) (-502.659) [-497.766] * (-500.894) [-497.207] (-497.617) (-498.220) -- 0:00:32
453000 -- (-500.144) (-500.316) (-502.472) [-498.342] * (-500.518) (-497.154) [-503.696] (-499.517) -- 0:00:32
453500 -- (-498.256) (-499.125) [-502.206] (-498.001) * (-502.074) (-497.167) (-501.790) [-497.105] -- 0:00:32
454000 -- (-497.739) (-498.531) (-497.394) [-498.219] * (-500.634) (-497.379) [-497.764] (-498.361) -- 0:00:32
454500 -- [-504.617] (-500.984) (-497.169) (-497.462) * (-498.659) [-498.954] (-498.154) (-498.899) -- 0:00:32
455000 -- (-498.328) (-498.280) (-498.568) [-499.428] * (-498.005) (-498.183) [-497.958] (-499.707) -- 0:00:32
Average standard deviation of split frequencies: 0.008500
455500 -- (-497.571) (-497.070) (-504.057) [-501.463] * (-498.130) (-497.232) (-497.186) [-498.908] -- 0:00:32
456000 -- (-497.850) (-498.246) (-503.281) [-498.143] * (-499.079) (-502.542) [-498.363] (-498.245) -- 0:00:32
456500 -- (-497.856) (-497.377) (-507.205) [-498.556] * [-500.210] (-501.034) (-500.864) (-497.784) -- 0:00:32
457000 -- (-500.305) [-501.642] (-499.446) (-498.290) * (-504.896) (-503.993) [-499.589] (-499.038) -- 0:00:32
457500 -- (-497.886) (-498.442) [-500.690] (-499.013) * (-500.791) [-497.036] (-499.425) (-498.293) -- 0:00:32
458000 -- [-502.342] (-500.280) (-500.571) (-498.223) * [-499.313] (-500.954) (-499.256) (-498.197) -- 0:00:33
458500 -- (-500.521) [-497.360] (-502.403) (-498.975) * [-501.273] (-499.667) (-498.501) (-498.304) -- 0:00:33
459000 -- (-500.429) (-499.024) (-498.610) [-498.274] * (-500.230) (-502.367) [-497.395] (-498.656) -- 0:00:33
459500 -- (-501.982) (-499.997) [-498.056] (-499.938) * (-497.477) [-499.543] (-499.983) (-497.633) -- 0:00:32
460000 -- (-499.697) (-501.105) (-498.581) [-501.303] * (-500.360) [-499.292] (-499.979) (-497.309) -- 0:00:32
Average standard deviation of split frequencies: 0.008357
460500 -- [-498.877] (-499.207) (-497.656) (-499.083) * (-497.861) (-498.835) [-497.628] (-499.823) -- 0:00:32
461000 -- (-499.807) [-499.180] (-499.922) (-499.557) * (-501.462) (-503.262) [-497.749] (-502.859) -- 0:00:32
461500 -- (-501.449) (-499.073) (-499.846) [-498.672] * (-498.183) [-498.524] (-502.334) (-501.304) -- 0:00:32
462000 -- (-499.322) [-499.441] (-499.129) (-499.612) * (-505.789) (-497.595) [-498.904] (-498.843) -- 0:00:32
462500 -- (-499.897) [-499.206] (-499.871) (-501.007) * [-500.402] (-500.555) (-498.120) (-498.800) -- 0:00:32
463000 -- (-502.893) [-501.221] (-500.487) (-497.845) * (-500.076) (-498.866) [-498.240] (-498.558) -- 0:00:32
463500 -- (-497.668) (-499.581) [-499.177] (-498.562) * (-497.490) (-497.294) (-505.903) [-498.647] -- 0:00:32
464000 -- (-498.688) (-501.572) (-499.532) [-498.717] * (-498.123) [-498.068] (-502.687) (-498.331) -- 0:00:32
464500 -- (-499.750) [-503.395] (-497.175) (-503.797) * [-500.066] (-498.269) (-502.439) (-498.002) -- 0:00:32
465000 -- (-500.075) (-502.765) (-498.854) [-497.056] * (-503.851) (-504.597) (-497.313) [-500.352] -- 0:00:32
Average standard deviation of split frequencies: 0.009850
465500 -- (-497.400) (-502.366) (-499.377) [-497.260] * (-502.144) (-505.884) [-499.526] (-497.076) -- 0:00:32
466000 -- (-501.141) [-500.182] (-498.136) (-498.751) * [-499.726] (-499.921) (-498.990) (-497.500) -- 0:00:32
466500 -- (-505.195) [-497.396] (-499.776) (-500.017) * (-499.407) (-499.517) [-499.988] (-497.934) -- 0:00:32
467000 -- (-498.390) (-498.744) [-497.736] (-499.121) * (-497.611) (-498.293) [-497.907] (-501.452) -- 0:00:31
467500 -- (-498.301) (-499.203) (-502.330) [-497.508] * (-497.910) (-497.288) [-498.676] (-499.871) -- 0:00:31
468000 -- (-498.920) [-499.605] (-500.775) (-502.722) * [-497.998] (-498.117) (-499.719) (-500.531) -- 0:00:31
468500 -- (-498.332) [-498.539] (-502.779) (-500.008) * (-500.794) (-499.583) (-502.870) [-498.197] -- 0:00:31
469000 -- [-497.386] (-497.462) (-501.730) (-497.564) * (-497.910) (-501.549) [-498.184] (-498.503) -- 0:00:31
469500 -- (-497.999) (-497.458) [-497.625] (-502.317) * (-498.618) [-500.844] (-498.752) (-497.128) -- 0:00:31
470000 -- (-498.598) [-497.378] (-498.947) (-498.632) * (-501.495) (-499.728) (-499.479) [-497.544] -- 0:00:31
Average standard deviation of split frequencies: 0.009647
470500 -- (-496.953) (-498.673) (-497.484) [-499.729] * [-498.322] (-500.732) (-497.760) (-498.960) -- 0:00:31
471000 -- (-498.767) (-498.923) [-501.036] (-498.094) * [-498.002] (-499.911) (-498.343) (-497.297) -- 0:00:31
471500 -- (-499.032) (-498.783) (-498.674) [-498.996] * [-500.664] (-498.943) (-500.002) (-499.214) -- 0:00:31
472000 -- (-499.676) [-497.099] (-499.948) (-498.453) * (-500.465) [-497.825] (-501.557) (-502.348) -- 0:00:31
472500 -- (-497.537) (-497.227) [-496.994] (-499.171) * [-505.523] (-498.075) (-502.101) (-498.504) -- 0:00:31
473000 -- [-497.706] (-500.804) (-498.455) (-501.542) * (-505.411) [-498.340] (-497.616) (-500.442) -- 0:00:31
473500 -- (-498.504) (-499.823) [-496.950] (-501.599) * [-502.732] (-497.992) (-498.623) (-498.115) -- 0:00:31
474000 -- (-497.459) (-498.861) [-497.634] (-500.550) * (-497.914) [-500.084] (-500.364) (-497.865) -- 0:00:31
474500 -- (-500.365) [-497.492] (-498.649) (-500.358) * [-499.419] (-497.353) (-497.689) (-498.237) -- 0:00:32
475000 -- (-498.069) (-499.763) [-497.686] (-498.483) * (-498.094) (-501.336) (-498.354) [-497.409] -- 0:00:32
Average standard deviation of split frequencies: 0.009903
475500 -- (-497.100) [-503.133] (-498.325) (-498.918) * (-501.089) (-503.755) (-497.672) [-497.187] -- 0:00:31
476000 -- (-498.284) [-497.185] (-496.958) (-502.760) * [-499.316] (-498.845) (-502.132) (-497.833) -- 0:00:31
476500 -- (-497.722) (-498.226) [-498.868] (-504.031) * (-498.849) (-499.122) [-498.761] (-496.796) -- 0:00:31
477000 -- [-498.578] (-499.879) (-500.730) (-501.313) * (-499.842) [-498.633] (-497.519) (-498.227) -- 0:00:31
477500 -- [-499.508] (-499.292) (-499.255) (-500.791) * (-500.269) [-499.068] (-496.963) (-499.153) -- 0:00:31
478000 -- (-498.508) [-497.341] (-501.887) (-498.595) * (-497.252) [-498.011] (-497.350) (-499.790) -- 0:00:31
478500 -- (-501.266) (-499.089) (-499.396) [-498.679] * (-497.990) (-498.483) (-500.588) [-498.210] -- 0:00:31
479000 -- [-499.898] (-501.143) (-499.129) (-503.184) * (-502.153) [-497.938] (-502.760) (-497.323) -- 0:00:31
479500 -- (-500.337) (-498.985) (-497.852) [-499.037] * (-497.605) [-498.756] (-498.908) (-497.266) -- 0:00:31
480000 -- (-497.592) (-497.727) [-499.609] (-500.396) * [-502.375] (-501.280) (-499.050) (-497.962) -- 0:00:31
Average standard deviation of split frequencies: 0.010943
480500 -- (-501.541) (-497.927) (-497.571) [-501.423] * (-505.214) [-498.828] (-498.755) (-497.817) -- 0:00:31
481000 -- (-497.962) (-496.991) [-497.341] (-500.403) * (-500.438) (-497.400) (-500.316) [-497.665] -- 0:00:31
481500 -- (-498.177) (-498.104) (-500.395) [-500.035] * [-501.667] (-500.008) (-500.205) (-500.127) -- 0:00:31
482000 -- (-499.411) (-497.738) [-498.349] (-499.216) * (-497.979) (-498.093) [-500.384] (-498.788) -- 0:00:31
482500 -- (-500.384) (-498.836) [-502.646] (-503.752) * (-498.880) (-497.833) [-498.678] (-498.394) -- 0:00:31
483000 -- (-501.380) (-498.786) [-502.000] (-503.986) * (-498.810) [-498.491] (-496.864) (-498.503) -- 0:00:31
483500 -- (-500.364) (-497.030) (-499.844) [-500.331] * (-499.489) [-501.916] (-496.944) (-499.115) -- 0:00:30
484000 -- (-499.831) [-499.568] (-497.658) (-498.277) * (-500.696) (-499.012) (-499.453) [-497.710] -- 0:00:30
484500 -- (-499.316) (-503.247) (-498.698) [-498.920] * [-499.544] (-502.116) (-497.874) (-501.142) -- 0:00:30
485000 -- (-500.696) (-498.759) [-500.297] (-499.649) * (-500.082) (-497.391) [-497.988] (-500.681) -- 0:00:30
Average standard deviation of split frequencies: 0.011009
485500 -- (-503.452) (-499.362) [-498.386] (-498.266) * [-500.305] (-497.285) (-500.712) (-498.554) -- 0:00:30
486000 -- [-498.587] (-502.984) (-498.042) (-498.419) * [-497.369] (-498.555) (-500.082) (-498.084) -- 0:00:30
486500 -- [-499.368] (-497.509) (-499.530) (-499.373) * [-497.344] (-497.657) (-497.375) (-500.229) -- 0:00:30
487000 -- (-497.970) [-498.894] (-496.882) (-500.297) * (-498.505) [-497.669] (-498.729) (-499.517) -- 0:00:30
487500 -- [-497.088] (-499.991) (-499.277) (-500.331) * (-500.384) [-502.288] (-499.690) (-497.476) -- 0:00:30
488000 -- [-496.958] (-501.271) (-498.340) (-501.757) * [-496.841] (-500.401) (-500.279) (-498.452) -- 0:00:30
488500 -- (-497.466) [-498.560] (-500.395) (-498.146) * (-497.384) (-498.647) (-498.533) [-501.193] -- 0:00:30
489000 -- (-499.582) (-501.294) (-500.556) [-497.239] * (-497.984) [-498.015] (-503.974) (-499.965) -- 0:00:30
489500 -- [-499.294] (-498.638) (-504.238) (-497.526) * (-501.205) [-500.656] (-498.380) (-498.401) -- 0:00:30
490000 -- [-497.046] (-497.249) (-501.216) (-498.447) * (-497.867) [-498.721] (-501.945) (-499.637) -- 0:00:30
Average standard deviation of split frequencies: 0.010664
490500 -- (-498.865) [-499.512] (-503.873) (-499.562) * [-501.041] (-498.716) (-500.151) (-499.877) -- 0:00:30
491000 -- (-498.565) [-498.256] (-498.136) (-498.354) * (-497.399) (-497.360) (-505.469) [-497.983] -- 0:00:30
491500 -- (-497.862) [-497.341] (-502.207) (-501.853) * (-497.773) (-499.345) (-498.814) [-497.539] -- 0:00:31
492000 -- (-497.399) (-501.173) (-500.641) [-500.489] * (-499.491) (-499.502) (-503.937) [-499.784] -- 0:00:30
492500 -- (-499.867) [-498.109] (-504.360) (-498.338) * [-497.588] (-497.363) (-501.098) (-500.007) -- 0:00:30
493000 -- (-498.583) (-498.686) [-500.470] (-497.400) * (-498.808) [-497.898] (-497.922) (-499.918) -- 0:00:30
493500 -- [-499.819] (-497.683) (-497.736) (-501.174) * (-502.978) (-502.598) (-497.571) [-499.686] -- 0:00:30
494000 -- (-498.570) [-498.492] (-500.864) (-498.227) * (-499.404) (-499.248) [-498.324] (-502.020) -- 0:00:30
494500 -- [-501.030] (-499.373) (-501.004) (-497.627) * (-500.659) (-498.504) [-498.535] (-499.701) -- 0:00:30
495000 -- (-502.467) [-502.683] (-500.997) (-498.333) * (-500.352) [-498.744] (-498.809) (-500.825) -- 0:00:30
Average standard deviation of split frequencies: 0.010169
495500 -- (-501.445) [-501.733] (-501.588) (-498.880) * (-502.475) (-501.551) (-501.788) [-499.900] -- 0:00:30
496000 -- (-501.557) (-500.058) [-500.650] (-501.014) * (-497.221) [-498.784] (-501.472) (-502.184) -- 0:00:30
496500 -- (-503.630) (-498.173) (-497.674) [-500.313] * (-497.124) [-498.490] (-497.831) (-500.904) -- 0:00:30
497000 -- (-499.062) (-498.560) (-497.220) [-498.744] * (-499.440) [-497.509] (-498.281) (-498.781) -- 0:00:30
497500 -- (-498.012) (-504.690) (-497.594) [-497.272] * (-499.987) [-497.785] (-499.884) (-500.734) -- 0:00:30
498000 -- (-497.767) [-497.437] (-498.751) (-498.739) * (-499.395) (-498.230) [-499.989] (-502.420) -- 0:00:30
498500 -- (-497.640) (-500.182) (-503.216) [-497.509] * (-497.713) [-499.904] (-504.879) (-501.719) -- 0:00:30
499000 -- (-496.956) (-497.766) (-497.368) [-503.249] * (-499.142) (-497.281) (-499.785) [-499.640] -- 0:00:30
499500 -- [-497.774] (-499.569) (-499.665) (-499.725) * (-498.193) (-499.289) (-500.793) [-498.005] -- 0:00:30
500000 -- (-498.520) (-501.638) (-500.296) [-499.224] * [-501.114] (-500.134) (-500.936) (-497.739) -- 0:00:30
Average standard deviation of split frequencies: 0.009792
500500 -- [-498.161] (-500.179) (-499.169) (-499.723) * [-497.960] (-497.919) (-500.425) (-498.324) -- 0:00:29
501000 -- (-501.098) (-499.058) (-499.008) [-497.905] * (-499.747) (-500.059) (-501.573) [-499.618] -- 0:00:29
501500 -- (-501.771) (-499.006) [-498.350] (-500.982) * (-499.892) [-499.244] (-505.566) (-501.446) -- 0:00:29
502000 -- (-502.524) (-501.353) (-499.462) [-497.476] * [-498.980] (-498.511) (-501.443) (-498.478) -- 0:00:29
502500 -- (-499.075) (-500.089) (-499.540) [-498.475] * (-498.938) (-499.520) (-499.200) [-498.934] -- 0:00:29
503000 -- (-499.201) (-499.884) (-499.950) [-499.771] * (-499.796) (-500.629) (-502.801) [-497.716] -- 0:00:29
503500 -- (-499.886) [-500.613] (-501.464) (-496.839) * (-500.159) (-503.629) [-498.501] (-497.257) -- 0:00:29
504000 -- (-499.996) [-499.144] (-497.955) (-497.616) * (-498.128) (-498.882) [-499.114] (-498.036) -- 0:00:29
504500 -- (-501.963) (-498.164) (-499.627) [-500.897] * (-499.117) (-502.636) (-497.608) [-500.236] -- 0:00:29
505000 -- (-499.762) [-497.668] (-497.670) (-499.065) * (-499.773) (-504.523) (-500.637) [-498.433] -- 0:00:29
Average standard deviation of split frequencies: 0.009968
505500 -- [-497.943] (-499.008) (-502.480) (-498.507) * (-497.457) [-500.378] (-500.764) (-500.956) -- 0:00:29
506000 -- [-497.062] (-497.809) (-501.052) (-501.583) * (-499.171) (-502.275) (-498.772) [-497.867] -- 0:00:29
506500 -- (-501.133) (-498.596) (-502.160) [-497.516] * (-498.818) (-499.160) (-498.809) [-498.397] -- 0:00:29
507000 -- (-497.269) (-501.077) [-501.904] (-501.748) * [-498.739] (-497.959) (-501.940) (-498.277) -- 0:00:29
507500 -- (-499.735) (-499.217) [-497.356] (-499.125) * [-499.572] (-500.131) (-504.300) (-498.682) -- 0:00:29
508000 -- (-506.715) (-497.332) (-499.480) [-499.197] * (-498.931) (-498.604) (-499.924) [-498.153] -- 0:00:30
508500 -- [-497.190] (-499.145) (-497.306) (-500.804) * (-498.778) (-499.530) [-498.003] (-497.808) -- 0:00:29
509000 -- (-497.975) (-500.064) (-498.213) [-498.690] * [-498.459] (-499.360) (-497.668) (-496.749) -- 0:00:29
509500 -- (-500.784) (-498.499) [-499.789] (-497.269) * [-500.010] (-500.924) (-498.360) (-496.961) -- 0:00:29
510000 -- (-498.672) [-497.880] (-502.930) (-499.366) * (-498.616) [-497.296] (-498.472) (-497.498) -- 0:00:29
Average standard deviation of split frequencies: 0.009785
510500 -- (-503.935) [-497.908] (-497.149) (-499.380) * [-502.446] (-499.319) (-499.150) (-498.945) -- 0:00:29
511000 -- (-497.939) (-499.230) [-498.563] (-503.030) * [-503.448] (-499.375) (-499.715) (-498.271) -- 0:00:29
511500 -- [-497.146] (-498.344) (-498.355) (-501.796) * [-500.650] (-499.669) (-499.885) (-497.818) -- 0:00:29
512000 -- (-497.889) [-499.241] (-497.607) (-500.897) * (-499.245) [-498.686] (-499.382) (-497.524) -- 0:00:29
512500 -- [-498.007] (-500.773) (-497.071) (-498.636) * [-497.305] (-500.169) (-500.709) (-498.493) -- 0:00:29
513000 -- (-497.429) (-499.451) [-498.375] (-501.979) * (-501.745) [-497.684] (-498.123) (-499.322) -- 0:00:29
513500 -- [-496.878] (-499.196) (-497.751) (-501.678) * [-498.147] (-500.144) (-500.259) (-499.501) -- 0:00:29
514000 -- [-498.645] (-500.587) (-501.037) (-501.307) * (-500.150) (-501.546) [-499.552] (-498.973) -- 0:00:29
514500 -- (-498.060) [-499.387] (-499.571) (-498.671) * (-499.260) (-499.969) [-497.411] (-499.008) -- 0:00:29
515000 -- (-499.113) (-498.198) (-502.233) [-500.467] * (-499.499) (-498.557) (-497.373) [-503.617] -- 0:00:29
Average standard deviation of split frequencies: 0.010338
515500 -- [-497.637] (-497.771) (-501.758) (-500.741) * [-497.909] (-503.692) (-498.138) (-497.495) -- 0:00:29
516000 -- (-499.367) [-497.754] (-497.150) (-502.877) * (-497.705) (-503.089) (-498.880) [-500.239] -- 0:00:29
516500 -- (-497.794) [-501.141] (-500.320) (-501.367) * [-497.211] (-499.696) (-499.973) (-502.263) -- 0:00:29
517000 -- (-497.134) (-498.134) (-500.096) [-499.754] * (-500.410) (-501.942) [-497.256] (-501.489) -- 0:00:28
517500 -- (-498.716) [-497.133] (-500.072) (-497.652) * (-499.258) [-497.392] (-498.738) (-502.515) -- 0:00:28
518000 -- [-500.174] (-496.949) (-505.288) (-498.180) * (-502.277) [-498.274] (-498.129) (-503.623) -- 0:00:28
518500 -- [-497.666] (-500.015) (-500.796) (-498.512) * [-501.448] (-498.722) (-498.873) (-507.525) -- 0:00:28
519000 -- (-496.871) [-498.962] (-498.186) (-498.210) * (-501.035) (-497.595) [-502.120] (-499.533) -- 0:00:28
519500 -- [-497.659] (-498.221) (-498.095) (-498.921) * (-500.935) (-497.538) (-499.892) [-499.166] -- 0:00:28
520000 -- (-497.879) (-497.873) (-497.684) [-499.474] * (-498.694) [-498.222] (-502.289) (-500.475) -- 0:00:28
Average standard deviation of split frequencies: 0.010915
520500 -- (-501.251) [-498.106] (-496.832) (-497.660) * (-497.227) (-497.701) (-502.165) [-499.824] -- 0:00:28
521000 -- (-500.885) (-501.925) (-498.372) [-497.252] * [-496.884] (-499.000) (-499.796) (-498.508) -- 0:00:28
521500 -- (-498.510) (-504.180) (-502.319) [-501.640] * [-501.861] (-498.914) (-499.678) (-497.911) -- 0:00:28
522000 -- (-498.676) (-502.391) (-502.446) [-499.053] * (-501.004) (-499.003) [-501.398] (-498.363) -- 0:00:28
522500 -- [-499.280] (-499.241) (-502.991) (-500.663) * (-499.659) (-499.303) [-497.216] (-501.184) -- 0:00:28
523000 -- (-500.150) [-499.059] (-499.600) (-509.170) * (-499.338) [-497.740] (-501.375) (-498.211) -- 0:00:28
523500 -- [-500.872] (-498.751) (-498.883) (-500.238) * (-502.348) (-498.136) [-499.824] (-498.293) -- 0:00:28
524000 -- [-499.125] (-499.001) (-499.889) (-498.861) * [-498.191] (-497.838) (-498.267) (-498.132) -- 0:00:28
524500 -- (-497.967) (-497.407) (-497.537) [-498.506] * (-497.662) (-506.103) (-499.526) [-498.259] -- 0:00:28
525000 -- (-498.059) (-498.263) [-499.841] (-498.764) * (-498.630) (-503.961) [-498.265] (-498.337) -- 0:00:28
Average standard deviation of split frequencies: 0.010396
525500 -- (-499.824) (-498.421) (-500.074) [-498.918] * (-499.998) (-497.346) (-498.905) [-497.872] -- 0:00:28
526000 -- [-500.780] (-498.836) (-499.356) (-497.459) * (-497.703) (-503.296) (-497.030) [-497.507] -- 0:00:28
526500 -- (-498.358) [-502.259] (-501.738) (-497.368) * (-500.830) (-499.377) (-501.799) [-504.417] -- 0:00:28
527000 -- (-506.819) [-498.845] (-497.686) (-501.835) * (-498.880) (-498.883) (-503.692) [-498.103] -- 0:00:28
527500 -- (-499.979) (-502.435) (-498.279) [-497.603] * (-501.848) (-498.929) [-498.125] (-499.723) -- 0:00:28
528000 -- (-499.335) [-501.194] (-501.151) (-500.757) * (-506.908) (-497.601) (-499.129) [-501.442] -- 0:00:28
528500 -- (-497.773) (-502.165) (-498.005) [-498.641] * (-502.582) (-498.348) [-500.615] (-501.379) -- 0:00:28
529000 -- (-498.192) (-497.703) (-500.534) [-501.455] * (-507.124) (-499.175) (-499.247) [-499.211] -- 0:00:28
529500 -- [-500.169] (-499.910) (-499.268) (-500.880) * (-502.682) (-503.017) [-497.153] (-500.673) -- 0:00:28
530000 -- [-497.997] (-499.878) (-503.173) (-501.004) * (-503.212) (-499.753) (-499.659) [-498.364] -- 0:00:28
Average standard deviation of split frequencies: 0.009624
530500 -- [-502.786] (-499.873) (-497.057) (-503.558) * (-499.559) (-499.990) (-500.139) [-498.918] -- 0:00:28
531000 -- [-498.959] (-498.541) (-501.996) (-503.229) * [-500.439] (-502.414) (-500.590) (-497.767) -- 0:00:28
531500 -- (-498.478) (-498.777) [-498.577] (-499.154) * [-500.210] (-500.834) (-500.082) (-498.583) -- 0:00:28
532000 -- [-497.626] (-497.512) (-501.761) (-499.394) * (-500.447) (-499.792) [-499.531] (-497.669) -- 0:00:28
532500 -- (-499.341) (-498.914) [-498.425] (-497.897) * (-498.581) [-498.782] (-499.589) (-499.296) -- 0:00:28
533000 -- (-499.277) [-501.136] (-498.200) (-501.730) * (-502.795) (-497.945) [-497.017] (-501.001) -- 0:00:28
533500 -- (-499.029) (-498.693) [-501.923] (-500.175) * (-499.761) [-502.674] (-499.198) (-500.155) -- 0:00:27
534000 -- (-499.277) (-501.400) [-505.459] (-497.722) * (-501.105) (-504.038) (-501.533) [-497.212] -- 0:00:27
534500 -- (-499.246) (-498.834) (-497.651) [-500.066] * (-501.555) (-498.106) [-498.835] (-497.045) -- 0:00:27
535000 -- (-497.423) (-504.335) [-497.246] (-501.015) * (-499.986) (-499.172) [-499.001] (-498.381) -- 0:00:27
Average standard deviation of split frequencies: 0.009528
535500 -- (-499.535) (-504.151) [-498.664] (-499.367) * (-500.746) [-499.507] (-506.821) (-497.314) -- 0:00:27
536000 -- (-500.266) (-502.166) (-498.642) [-498.014] * [-497.764] (-497.988) (-500.794) (-497.331) -- 0:00:27
536500 -- (-498.400) (-498.098) [-499.141] (-500.184) * (-497.684) (-498.793) (-503.554) [-497.910] -- 0:00:27
537000 -- [-499.618] (-499.936) (-497.258) (-497.328) * (-502.230) [-499.970] (-499.376) (-497.762) -- 0:00:27
537500 -- (-500.664) (-497.360) (-497.257) [-498.739] * [-497.127] (-501.962) (-497.006) (-501.408) -- 0:00:27
538000 -- [-497.769] (-498.109) (-501.813) (-499.599) * (-499.012) [-496.898] (-499.311) (-498.941) -- 0:00:27
538500 -- (-499.684) (-497.525) [-497.868] (-497.029) * (-498.207) (-498.663) (-501.384) [-501.334] -- 0:00:27
539000 -- (-502.918) (-497.348) [-499.923] (-500.433) * [-498.776] (-498.782) (-499.573) (-500.185) -- 0:00:27
539500 -- (-504.445) (-499.343) (-498.154) [-498.036] * (-498.045) [-498.642] (-498.854) (-504.512) -- 0:00:27
540000 -- (-501.184) (-498.287) [-499.636] (-503.057) * (-503.996) (-500.928) (-498.440) [-499.047] -- 0:00:27
Average standard deviation of split frequencies: 0.009736
540500 -- (-500.612) (-498.328) [-503.212] (-499.917) * (-498.728) (-502.510) [-498.697] (-497.074) -- 0:00:27
541000 -- [-499.251] (-499.719) (-499.990) (-497.698) * (-497.909) (-504.266) [-500.097] (-498.434) -- 0:00:27
541500 -- [-497.408] (-498.607) (-500.950) (-499.758) * [-498.527] (-499.906) (-502.683) (-500.415) -- 0:00:27
542000 -- [-499.713] (-499.265) (-501.106) (-499.054) * (-501.623) (-499.215) [-504.175] (-499.046) -- 0:00:27
542500 -- [-498.160] (-500.465) (-500.966) (-500.671) * (-497.376) [-498.800] (-499.504) (-500.736) -- 0:00:27
543000 -- (-498.888) (-497.242) (-498.900) [-502.008] * [-502.270] (-499.238) (-496.919) (-498.551) -- 0:00:27
543500 -- (-503.197) (-499.671) (-498.851) [-498.647] * (-498.106) [-497.465] (-499.863) (-498.115) -- 0:00:27
544000 -- (-497.507) [-496.865] (-498.673) (-499.321) * (-499.073) (-500.094) (-498.800) [-499.585] -- 0:00:27
544500 -- [-498.748] (-497.847) (-499.945) (-498.699) * (-497.595) (-497.973) (-498.816) [-499.081] -- 0:00:27
545000 -- (-497.649) [-501.523] (-498.418) (-498.596) * (-501.497) (-499.296) (-499.420) [-499.452] -- 0:00:27
Average standard deviation of split frequencies: 0.010088
545500 -- (-500.207) (-500.779) (-499.068) [-499.560] * (-497.673) (-498.647) [-498.612] (-500.801) -- 0:00:27
546000 -- (-500.724) [-498.885] (-498.429) (-498.407) * (-502.300) (-499.450) [-499.907] (-499.140) -- 0:00:27
546500 -- (-499.006) [-498.592] (-498.841) (-498.085) * (-500.724) (-499.094) (-500.614) [-499.100] -- 0:00:27
547000 -- [-498.458] (-503.653) (-500.569) (-498.419) * [-499.100] (-498.152) (-497.585) (-499.184) -- 0:00:27
547500 -- (-498.674) (-497.511) [-505.387] (-502.232) * (-498.350) (-500.186) (-498.600) [-496.926] -- 0:00:27
548000 -- (-498.588) (-499.044) [-499.406] (-498.262) * (-498.781) [-498.880] (-504.240) (-497.958) -- 0:00:27
548500 -- (-502.239) (-497.526) [-499.811] (-496.901) * (-496.928) (-499.773) (-496.774) [-499.506] -- 0:00:27
549000 -- (-500.489) (-498.000) (-501.470) [-498.831] * (-498.455) (-500.371) [-500.692] (-499.544) -- 0:00:27
549500 -- (-498.275) (-502.126) [-501.616] (-498.103) * (-499.073) [-496.979] (-499.681) (-498.579) -- 0:00:27
550000 -- [-498.304] (-500.195) (-498.832) (-498.278) * (-500.321) (-497.574) [-496.681] (-500.638) -- 0:00:27
Average standard deviation of split frequencies: 0.010498
550500 -- [-501.719] (-501.125) (-497.628) (-497.723) * (-498.627) (-499.592) [-499.100] (-499.702) -- 0:00:26
551000 -- (-499.245) (-498.836) (-497.378) [-499.087] * (-499.969) (-499.300) (-497.209) [-497.923] -- 0:00:26
551500 -- [-498.913] (-498.783) (-497.564) (-501.127) * [-500.555] (-499.354) (-497.517) (-500.895) -- 0:00:26
552000 -- (-497.139) (-502.275) (-498.158) [-498.017] * (-501.115) (-499.619) [-497.454] (-499.158) -- 0:00:26
552500 -- [-498.194] (-497.552) (-497.843) (-499.018) * (-499.612) (-499.255) [-497.249] (-498.959) -- 0:00:26
553000 -- (-499.845) (-498.718) [-500.090] (-497.655) * (-497.821) (-497.211) (-497.999) [-499.043] -- 0:00:26
553500 -- (-502.960) (-498.718) [-498.735] (-498.248) * [-498.318] (-498.742) (-497.891) (-497.318) -- 0:00:26
554000 -- (-497.580) (-499.355) (-500.090) [-500.262] * (-501.033) (-499.073) [-498.080] (-499.010) -- 0:00:26
554500 -- [-497.615] (-499.735) (-497.225) (-500.966) * (-498.007) (-498.585) (-498.177) [-498.080] -- 0:00:26
555000 -- (-499.850) [-500.274] (-498.958) (-505.276) * (-499.564) [-504.243] (-498.680) (-497.977) -- 0:00:26
Average standard deviation of split frequencies: 0.010397
555500 -- (-498.694) (-497.655) [-498.005] (-499.467) * (-497.757) [-498.908] (-497.828) (-501.306) -- 0:00:26
556000 -- [-498.082] (-498.530) (-497.764) (-500.376) * (-504.406) (-498.736) (-500.846) [-498.343] -- 0:00:26
556500 -- (-498.522) (-498.103) (-499.354) [-497.234] * (-501.417) [-498.627] (-497.949) (-499.370) -- 0:00:26
557000 -- (-498.969) [-501.528] (-497.985) (-499.278) * (-498.792) (-498.260) [-497.664] (-500.486) -- 0:00:26
557500 -- (-501.526) (-501.289) (-500.463) [-501.079] * (-498.729) (-496.983) [-503.675] (-499.484) -- 0:00:26
558000 -- [-497.240] (-502.713) (-498.743) (-499.827) * (-498.028) (-497.315) [-497.472] (-497.926) -- 0:00:26
558500 -- (-502.949) (-498.466) (-498.391) [-501.042] * (-499.617) (-502.526) (-497.239) [-498.497] -- 0:00:26
559000 -- (-498.550) (-499.170) (-497.854) [-500.703] * (-502.012) (-502.376) (-497.946) [-498.719] -- 0:00:26
559500 -- [-499.747] (-497.335) (-497.736) (-500.499) * [-500.712] (-499.731) (-499.752) (-501.302) -- 0:00:26
560000 -- (-500.294) [-502.082] (-498.597) (-502.464) * (-499.983) [-499.103] (-501.680) (-500.498) -- 0:00:26
Average standard deviation of split frequencies: 0.010837
560500 -- (-501.567) [-502.051] (-499.906) (-499.004) * [-500.948] (-497.806) (-501.227) (-500.218) -- 0:00:26
561000 -- (-500.487) (-500.533) (-499.152) [-499.247] * (-498.740) (-497.383) [-501.083] (-499.698) -- 0:00:26
561500 -- (-504.554) (-497.846) [-499.521] (-500.612) * [-498.726] (-504.390) (-498.225) (-500.060) -- 0:00:26
562000 -- (-503.021) (-497.641) [-499.112] (-498.035) * (-502.586) (-500.092) (-499.223) [-499.474] -- 0:00:26
562500 -- [-498.477] (-499.438) (-498.633) (-497.717) * (-499.963) (-498.710) (-501.250) [-497.425] -- 0:00:26
563000 -- (-500.609) [-496.940] (-499.858) (-500.492) * (-497.610) (-500.927) (-500.116) [-496.809] -- 0:00:26
563500 -- (-497.691) (-497.817) (-497.987) [-499.260] * (-498.218) (-497.724) (-500.063) [-501.635] -- 0:00:26
564000 -- (-499.276) (-498.429) [-497.621] (-497.868) * (-497.428) (-498.740) [-499.457] (-498.489) -- 0:00:26
564500 -- (-502.851) [-501.820] (-497.594) (-496.904) * [-499.182] (-499.540) (-499.685) (-499.746) -- 0:00:26
565000 -- (-507.334) (-499.259) (-499.162) [-497.990] * [-497.505] (-500.850) (-500.922) (-496.650) -- 0:00:26
Average standard deviation of split frequencies: 0.009731
565500 -- (-500.804) (-500.735) (-497.976) [-498.326] * (-497.531) [-497.680] (-498.717) (-503.391) -- 0:00:26
566000 -- (-503.068) [-500.282] (-497.953) (-498.517) * [-501.833] (-500.252) (-499.578) (-499.332) -- 0:00:26
566500 -- (-503.076) [-498.656] (-500.839) (-499.745) * (-503.789) (-500.342) (-498.348) [-497.564] -- 0:00:26
567000 -- [-499.194] (-498.604) (-498.239) (-498.639) * [-498.276] (-498.156) (-498.821) (-501.729) -- 0:00:25
567500 -- (-500.018) (-503.434) [-497.544] (-499.831) * (-498.181) (-498.680) [-498.234] (-498.657) -- 0:00:25
568000 -- (-498.808) [-500.400] (-498.958) (-506.596) * (-499.214) (-502.515) (-498.525) [-498.604] -- 0:00:25
568500 -- (-499.124) (-499.418) (-498.666) [-500.599] * (-499.828) (-499.580) [-497.926] (-497.699) -- 0:00:25
569000 -- (-498.501) (-499.540) [-499.665] (-497.857) * (-501.827) [-498.638] (-498.829) (-498.747) -- 0:00:25
569500 -- (-499.044) (-498.626) (-500.226) [-498.526] * (-498.585) [-497.890] (-500.993) (-497.751) -- 0:00:25
570000 -- [-497.601] (-499.617) (-501.157) (-498.032) * (-497.055) (-497.911) [-498.900] (-500.418) -- 0:00:25
Average standard deviation of split frequencies: 0.010463
570500 -- (-499.199) [-498.337] (-499.595) (-498.804) * (-498.525) [-503.390] (-499.370) (-504.304) -- 0:00:25
571000 -- (-499.358) (-501.226) [-502.409] (-497.218) * (-497.835) (-497.384) [-499.219] (-501.361) -- 0:00:25
571500 -- [-499.686] (-500.475) (-501.921) (-497.181) * (-499.005) (-506.287) [-498.699] (-497.525) -- 0:00:25
572000 -- (-498.041) [-498.115] (-501.850) (-497.131) * (-498.626) (-498.201) (-501.530) [-501.976] -- 0:00:25
572500 -- (-500.165) (-504.458) (-498.559) [-497.418] * [-498.354] (-500.153) (-499.418) (-502.165) -- 0:00:25
573000 -- (-503.027) [-497.156] (-498.677) (-503.571) * (-498.627) (-497.449) [-499.271] (-499.020) -- 0:00:25
573500 -- (-496.780) (-500.591) [-498.340] (-500.687) * [-497.800] (-498.908) (-497.358) (-500.569) -- 0:00:25
574000 -- (-497.820) (-499.127) [-500.042] (-499.761) * [-498.249] (-497.617) (-502.527) (-498.374) -- 0:00:25
574500 -- (-497.851) (-499.276) (-500.428) [-499.823] * [-497.627] (-499.093) (-499.112) (-499.671) -- 0:00:25
575000 -- (-500.895) [-498.374] (-499.326) (-502.615) * [-499.181] (-499.995) (-500.479) (-499.344) -- 0:00:25
Average standard deviation of split frequencies: 0.010730
575500 -- (-499.280) (-498.188) (-498.345) [-499.782] * (-500.992) (-498.533) (-499.203) [-497.415] -- 0:00:25
576000 -- (-497.908) (-497.383) [-497.858] (-499.016) * (-504.253) (-499.448) (-499.155) [-498.890] -- 0:00:25
576500 -- (-504.976) [-497.628] (-502.056) (-498.798) * (-503.990) (-498.122) (-498.937) [-497.206] -- 0:00:25
577000 -- (-502.216) (-497.360) [-498.117] (-498.779) * (-503.412) [-497.733] (-501.863) (-497.866) -- 0:00:25
577500 -- (-499.822) (-500.431) [-499.944] (-497.587) * [-498.295] (-498.148) (-501.182) (-503.227) -- 0:00:25
578000 -- (-497.624) (-498.927) [-499.980] (-500.916) * (-501.203) (-499.915) [-496.829] (-503.029) -- 0:00:25
578500 -- (-503.426) [-497.588] (-501.878) (-497.142) * [-500.045] (-498.594) (-497.797) (-497.115) -- 0:00:25
579000 -- (-499.202) (-501.987) [-499.612] (-497.100) * [-501.081] (-497.851) (-498.325) (-497.495) -- 0:00:25
579500 -- (-499.658) (-498.057) [-498.417] (-498.862) * (-499.434) [-496.955] (-500.605) (-500.008) -- 0:00:25
580000 -- (-498.897) [-500.309] (-498.486) (-500.176) * [-499.692] (-500.359) (-506.338) (-501.923) -- 0:00:25
Average standard deviation of split frequencies: 0.010915
580500 -- [-497.938] (-500.985) (-498.469) (-498.186) * (-499.476) (-504.591) [-497.780] (-498.574) -- 0:00:25
581000 -- [-496.999] (-497.669) (-500.823) (-497.187) * (-499.067) (-502.322) (-501.040) [-498.620] -- 0:00:25
581500 -- [-497.605] (-498.982) (-501.232) (-497.179) * (-497.119) (-501.281) [-499.339] (-504.252) -- 0:00:25
582000 -- [-497.103] (-504.339) (-499.248) (-499.939) * (-498.029) [-498.757] (-499.101) (-502.211) -- 0:00:25
582500 -- (-497.480) [-503.186] (-499.253) (-499.117) * [-499.300] (-498.751) (-501.494) (-504.110) -- 0:00:25
583000 -- (-496.822) (-498.895) (-502.381) [-503.002] * [-497.513] (-497.642) (-501.223) (-499.820) -- 0:00:25
583500 -- (-496.793) [-498.953] (-502.279) (-500.124) * (-498.950) (-499.778) [-500.825] (-497.780) -- 0:00:24
584000 -- (-501.607) (-498.234) (-499.174) [-500.531] * (-498.130) (-498.455) [-498.189] (-498.006) -- 0:00:24
584500 -- (-502.392) [-498.055] (-497.918) (-500.068) * (-498.537) (-497.945) [-499.163] (-498.279) -- 0:00:24
585000 -- (-500.428) (-499.546) [-498.143] (-498.752) * (-497.340) (-500.345) [-497.648] (-497.503) -- 0:00:24
Average standard deviation of split frequencies: 0.010905
585500 -- (-500.160) (-498.696) [-501.099] (-498.897) * [-497.376] (-498.197) (-500.670) (-498.844) -- 0:00:24
586000 -- (-500.620) [-498.744] (-502.643) (-498.368) * (-497.632) (-500.831) [-498.943] (-501.285) -- 0:00:24
586500 -- (-505.969) (-499.193) (-498.271) [-501.091] * (-499.071) (-500.002) (-498.218) [-499.896] -- 0:00:24
587000 -- (-497.802) (-502.460) [-500.516] (-497.952) * (-500.569) (-499.610) [-497.268] (-496.858) -- 0:00:24
587500 -- (-498.179) (-499.905) [-500.597] (-500.782) * (-501.738) (-496.979) (-497.154) [-496.974] -- 0:00:24
588000 -- (-499.323) (-499.011) (-497.539) [-499.892] * [-500.730] (-497.074) (-497.506) (-498.397) -- 0:00:24
588500 -- (-497.592) (-498.525) [-496.897] (-498.415) * (-497.544) [-497.503] (-497.553) (-497.803) -- 0:00:24
589000 -- (-499.438) (-498.124) (-499.747) [-498.591] * (-498.535) (-500.764) (-500.139) [-497.367] -- 0:00:24
589500 -- (-500.111) (-500.271) (-500.077) [-498.107] * [-497.636] (-499.801) (-498.621) (-502.093) -- 0:00:24
590000 -- (-499.584) (-499.903) [-499.522] (-497.958) * (-499.561) (-500.011) [-497.932] (-499.490) -- 0:00:24
Average standard deviation of split frequencies: 0.010845
590500 -- (-499.751) (-497.980) [-500.207] (-499.469) * (-499.329) [-498.793] (-501.239) (-499.363) -- 0:00:24
591000 -- [-497.549] (-497.291) (-498.384) (-498.651) * (-500.980) (-501.666) (-500.756) [-497.434] -- 0:00:24
591500 -- [-497.840] (-500.483) (-498.626) (-499.776) * [-500.774] (-500.920) (-499.346) (-499.011) -- 0:00:24
592000 -- (-503.581) (-497.391) [-500.117] (-499.155) * [-497.478] (-500.087) (-500.198) (-501.592) -- 0:00:24
592500 -- (-499.242) (-501.914) [-501.420] (-500.067) * (-499.569) (-497.872) (-498.924) [-500.772] -- 0:00:24
593000 -- [-497.274] (-499.122) (-497.581) (-502.981) * (-497.368) [-497.461] (-500.089) (-499.778) -- 0:00:24
593500 -- (-497.545) (-498.452) (-499.333) [-498.444] * (-497.806) (-503.037) [-497.570] (-500.871) -- 0:00:24
594000 -- (-499.640) (-500.044) (-498.538) [-500.738] * [-501.782] (-500.963) (-499.577) (-498.341) -- 0:00:24
594500 -- (-497.837) (-501.884) (-499.105) [-499.013] * (-499.070) [-500.744] (-497.436) (-499.485) -- 0:00:24
595000 -- (-498.563) (-498.072) (-498.368) [-499.377] * [-499.882] (-496.879) (-498.786) (-498.922) -- 0:00:24
Average standard deviation of split frequencies: 0.010748
595500 -- [-498.400] (-497.072) (-501.897) (-506.718) * (-498.492) (-502.561) [-497.375] (-496.982) -- 0:00:24
596000 -- (-501.245) (-500.183) (-501.168) [-501.248] * [-501.694] (-497.079) (-498.661) (-501.787) -- 0:00:24
596500 -- (-502.005) (-501.047) [-498.706] (-500.513) * (-499.822) (-500.161) (-498.351) [-501.345] -- 0:00:24
597000 -- (-499.423) (-501.275) (-503.879) [-499.824] * (-500.154) (-498.335) [-498.907] (-499.596) -- 0:00:24
597500 -- (-498.913) (-498.764) [-497.801] (-505.128) * (-499.640) (-497.907) [-498.637] (-498.368) -- 0:00:24
598000 -- (-499.785) (-498.095) (-499.072) [-500.052] * (-500.597) [-497.984] (-497.518) (-498.276) -- 0:00:24
598500 -- (-498.935) (-499.719) (-497.874) [-496.956] * (-497.620) (-500.464) [-497.733] (-496.778) -- 0:00:24
599000 -- (-500.136) [-497.512] (-499.479) (-497.054) * (-501.054) [-502.367] (-498.717) (-497.715) -- 0:00:24
599500 -- (-500.411) [-502.018] (-498.807) (-499.074) * (-502.927) (-500.132) [-497.088] (-497.386) -- 0:00:24
600000 -- (-498.200) [-501.599] (-501.732) (-499.422) * (-497.562) (-500.208) (-500.108) [-497.917] -- 0:00:24
Average standard deviation of split frequencies: 0.010526
600500 -- (-499.170) (-497.936) (-498.300) [-499.797] * [-501.746] (-500.097) (-500.246) (-497.533) -- 0:00:23
601000 -- [-499.540] (-499.826) (-499.012) (-497.342) * (-498.851) [-499.809] (-502.033) (-497.724) -- 0:00:23
601500 -- [-499.983] (-498.429) (-500.107) (-496.989) * (-498.469) (-500.517) (-498.888) [-500.870] -- 0:00:23
602000 -- [-497.012] (-501.658) (-499.923) (-497.916) * [-500.626] (-501.203) (-500.377) (-501.157) -- 0:00:23
602500 -- [-499.235] (-498.333) (-502.110) (-498.606) * (-497.927) [-498.888] (-499.973) (-499.806) -- 0:00:23
603000 -- [-500.006] (-498.677) (-498.466) (-499.583) * [-497.560] (-497.536) (-500.206) (-498.197) -- 0:00:23
603500 -- (-496.902) (-501.665) [-500.288] (-501.771) * [-497.603] (-498.597) (-499.346) (-497.998) -- 0:00:23
604000 -- (-496.936) (-501.368) [-497.296] (-499.527) * (-498.503) (-499.453) (-497.709) [-498.887] -- 0:00:23
604500 -- (-496.914) [-500.854] (-500.153) (-501.828) * [-498.339] (-500.948) (-497.359) (-501.633) -- 0:00:23
605000 -- [-497.654] (-499.544) (-499.918) (-502.032) * (-504.397) (-499.580) [-500.185] (-498.024) -- 0:00:23
Average standard deviation of split frequencies: 0.010113
605500 -- (-498.138) (-497.535) (-499.405) [-497.404] * [-497.454] (-500.249) (-498.658) (-500.056) -- 0:00:23
606000 -- (-502.142) [-498.563] (-499.220) (-499.454) * (-500.417) [-498.699] (-502.442) (-498.520) -- 0:00:23
606500 -- (-498.484) (-498.459) [-498.704] (-497.995) * (-498.882) (-498.373) (-504.258) [-499.115] -- 0:00:23
607000 -- (-497.534) [-498.969] (-499.881) (-497.314) * [-498.229] (-500.230) (-501.124) (-498.627) -- 0:00:23
607500 -- (-499.405) [-497.752] (-499.529) (-497.291) * [-496.983] (-504.356) (-499.329) (-499.776) -- 0:00:23
608000 -- (-501.254) (-497.586) (-498.627) [-498.887] * [-500.642] (-505.471) (-502.303) (-497.744) -- 0:00:23
608500 -- [-498.342] (-498.691) (-501.181) (-501.641) * (-503.578) (-502.005) (-501.076) [-499.644] -- 0:00:23
609000 -- [-499.725] (-501.477) (-506.406) (-499.198) * (-496.832) [-498.264] (-502.242) (-499.769) -- 0:00:23
609500 -- (-499.542) (-504.127) [-497.214] (-498.913) * [-497.060] (-498.759) (-498.630) (-499.042) -- 0:00:23
610000 -- (-499.045) [-500.046] (-497.658) (-499.380) * (-497.871) (-501.765) [-498.324] (-499.162) -- 0:00:23
Average standard deviation of split frequencies: 0.010262
610500 -- [-498.534] (-497.759) (-499.519) (-499.779) * [-497.445] (-499.412) (-498.207) (-503.948) -- 0:00:23
611000 -- (-501.278) (-502.901) [-501.592] (-499.028) * (-497.415) [-499.284] (-504.257) (-499.643) -- 0:00:23
611500 -- (-501.066) [-498.370] (-498.477) (-500.466) * (-497.307) [-503.732] (-501.243) (-502.719) -- 0:00:23
612000 -- (-500.913) (-499.210) [-498.503] (-497.611) * [-498.143] (-499.643) (-498.706) (-500.548) -- 0:00:23
612500 -- (-497.433) (-498.445) [-499.049] (-497.726) * (-500.860) (-498.736) [-498.280] (-506.295) -- 0:00:23
613000 -- [-500.670] (-501.304) (-498.397) (-498.293) * (-497.329) [-497.044] (-499.873) (-499.406) -- 0:00:23
613500 -- (-498.445) [-500.120] (-503.160) (-499.692) * (-498.435) [-500.206] (-497.463) (-499.220) -- 0:00:23
614000 -- [-497.626] (-498.545) (-498.133) (-498.018) * (-499.367) [-501.660] (-497.219) (-501.408) -- 0:00:23
614500 -- (-498.381) [-498.361] (-499.766) (-499.098) * (-501.375) (-501.942) [-497.940] (-498.505) -- 0:00:23
615000 -- (-498.472) [-497.583] (-502.761) (-498.752) * (-502.429) [-500.084] (-499.009) (-497.478) -- 0:00:23
Average standard deviation of split frequencies: 0.010129
615500 -- (-499.734) [-497.766] (-501.246) (-503.102) * (-499.777) (-498.462) (-498.402) [-496.709] -- 0:00:23
616000 -- (-499.183) [-500.783] (-499.381) (-502.957) * (-498.754) [-500.512] (-498.716) (-497.291) -- 0:00:23
616500 -- (-505.173) [-499.330] (-499.219) (-498.308) * [-497.729] (-501.205) (-503.554) (-497.006) -- 0:00:23
617000 -- (-498.880) (-507.799) (-499.093) [-503.484] * (-497.892) (-498.179) (-497.671) [-496.878] -- 0:00:22
617500 -- (-499.418) [-504.416] (-498.286) (-500.626) * [-499.804] (-501.248) (-499.074) (-498.391) -- 0:00:22
618000 -- [-497.424] (-499.470) (-498.719) (-498.895) * (-501.686) (-499.107) (-499.947) [-501.758] -- 0:00:22
618500 -- (-500.801) (-499.551) (-499.783) [-497.420] * [-500.157] (-499.248) (-504.634) (-497.713) -- 0:00:22
619000 -- (-499.576) [-501.632] (-503.871) (-499.366) * [-498.332] (-500.060) (-505.415) (-500.379) -- 0:00:22
619500 -- (-498.554) [-501.979] (-501.946) (-500.709) * (-497.680) (-504.512) [-501.429] (-497.651) -- 0:00:22
620000 -- (-497.921) [-498.668] (-497.270) (-498.506) * (-497.406) (-499.165) [-504.852] (-501.900) -- 0:00:22
Average standard deviation of split frequencies: 0.010008
620500 -- (-498.512) (-498.580) (-497.665) [-496.936] * (-497.630) (-497.306) (-499.714) [-498.962] -- 0:00:22
621000 -- (-499.233) (-497.289) [-498.840] (-497.826) * (-498.050) (-497.306) [-503.844] (-498.604) -- 0:00:22
621500 -- (-500.760) (-497.822) (-498.994) [-499.078] * (-499.082) (-497.614) (-499.281) [-499.188] -- 0:00:22
622000 -- (-500.628) (-498.145) [-501.470] (-500.329) * (-497.398) [-498.224] (-498.041) (-498.113) -- 0:00:22
622500 -- (-499.578) [-499.837] (-498.090) (-498.049) * [-498.295] (-497.344) (-497.729) (-500.272) -- 0:00:22
623000 -- [-498.499] (-498.924) (-497.957) (-499.833) * [-498.799] (-498.847) (-498.622) (-499.162) -- 0:00:22
623500 -- (-506.965) [-497.489] (-498.322) (-498.906) * (-498.880) [-498.193] (-502.103) (-499.771) -- 0:00:22
624000 -- (-505.469) [-498.255] (-497.730) (-497.453) * (-497.741) (-499.946) [-498.092] (-498.051) -- 0:00:22
624500 -- (-501.002) [-500.312] (-497.225) (-501.471) * (-497.338) (-500.643) [-498.117] (-498.062) -- 0:00:22
625000 -- (-498.652) (-499.082) [-497.303] (-497.841) * (-497.526) (-499.915) [-497.916] (-499.794) -- 0:00:22
Average standard deviation of split frequencies: 0.010188
625500 -- (-501.502) (-499.115) [-499.203] (-498.995) * (-498.846) (-497.042) [-498.519] (-502.487) -- 0:00:22
626000 -- (-499.305) (-497.933) [-499.916] (-497.966) * (-498.782) (-498.176) [-498.637] (-499.112) -- 0:00:22
626500 -- (-499.333) (-501.035) [-498.954] (-499.359) * (-498.748) (-497.692) (-499.908) [-497.898] -- 0:00:22
627000 -- (-498.091) (-499.533) [-498.561] (-497.805) * (-496.837) (-500.463) (-499.447) [-497.119] -- 0:00:22
627500 -- (-500.206) (-497.800) (-498.598) [-498.520] * [-498.447] (-498.343) (-498.430) (-499.694) -- 0:00:22
628000 -- (-497.413) (-499.839) [-497.554] (-502.195) * (-505.369) [-499.513] (-498.248) (-500.795) -- 0:00:22
628500 -- (-496.732) (-497.288) [-500.525] (-498.910) * (-504.086) [-500.545] (-500.787) (-499.388) -- 0:00:22
629000 -- (-497.623) (-500.418) [-498.117] (-500.436) * (-502.904) (-501.369) (-499.925) [-497.592] -- 0:00:22
629500 -- [-499.428] (-499.483) (-500.578) (-500.782) * [-500.715] (-498.334) (-499.490) (-498.016) -- 0:00:22
630000 -- [-500.503] (-498.394) (-500.168) (-501.103) * (-500.201) (-499.194) [-500.144] (-498.506) -- 0:00:22
Average standard deviation of split frequencies: 0.010423
630500 -- (-499.871) (-500.706) [-498.287] (-499.350) * (-497.776) (-497.330) (-497.491) [-497.181] -- 0:00:22
631000 -- (-498.771) (-504.542) [-500.343] (-498.556) * (-499.000) (-498.773) [-498.181] (-498.131) -- 0:00:22
631500 -- (-497.702) [-497.316] (-499.933) (-497.127) * [-497.548] (-500.835) (-497.889) (-498.773) -- 0:00:22
632000 -- [-500.004] (-497.695) (-499.212) (-498.682) * [-501.211] (-500.782) (-500.301) (-499.489) -- 0:00:22
632500 -- (-498.087) (-500.151) [-498.294] (-497.661) * (-503.236) (-502.235) (-499.995) [-499.363] -- 0:00:22
633000 -- (-497.246) (-499.141) (-498.306) [-497.471] * (-499.520) [-498.376] (-499.701) (-499.430) -- 0:00:22
633500 -- [-497.420] (-497.725) (-496.949) (-503.057) * (-497.892) (-498.490) [-499.528] (-498.620) -- 0:00:21
634000 -- (-497.322) (-498.107) (-497.482) [-502.017] * (-500.351) (-498.545) (-501.743) [-500.713] -- 0:00:21
634500 -- (-499.720) (-498.142) [-497.410] (-497.164) * (-504.040) [-498.238] (-505.819) (-497.871) -- 0:00:21
635000 -- (-501.978) (-499.466) (-502.593) [-499.696] * [-498.764] (-500.283) (-505.143) (-499.427) -- 0:00:21
Average standard deviation of split frequencies: 0.009810
635500 -- [-499.868] (-499.603) (-504.489) (-499.196) * (-498.415) [-502.647] (-499.220) (-498.734) -- 0:00:21
636000 -- [-498.824] (-505.222) (-500.189) (-498.703) * [-498.265] (-497.883) (-497.337) (-498.420) -- 0:00:21
636500 -- (-498.298) (-502.101) (-499.249) [-497.682] * (-499.536) (-499.131) (-499.054) [-503.875] -- 0:00:21
637000 -- (-498.009) (-498.150) [-498.327] (-499.900) * (-498.630) (-498.844) (-498.322) [-499.732] -- 0:00:21
637500 -- (-501.197) (-499.564) [-500.079] (-497.266) * (-498.849) (-499.672) (-497.018) [-497.739] -- 0:00:21
638000 -- [-498.128] (-502.324) (-500.530) (-501.460) * (-497.547) [-497.684] (-502.759) (-500.221) -- 0:00:21
638500 -- (-499.607) (-498.800) (-502.091) [-499.935] * [-499.307] (-506.379) (-500.554) (-497.978) -- 0:00:21
639000 -- [-497.862] (-499.120) (-500.953) (-500.223) * (-497.135) [-497.313] (-500.849) (-500.567) -- 0:00:21
639500 -- (-498.385) [-498.462] (-499.603) (-498.843) * (-502.169) (-499.612) (-497.708) [-501.864] -- 0:00:21
640000 -- (-497.659) [-499.191] (-498.017) (-504.950) * (-503.833) (-503.511) [-498.493] (-497.085) -- 0:00:21
Average standard deviation of split frequencies: 0.009912
640500 -- [-498.145] (-502.346) (-496.946) (-500.697) * (-497.605) (-499.904) [-497.862] (-500.717) -- 0:00:21
641000 -- [-502.112] (-497.635) (-497.088) (-508.011) * (-498.040) [-501.444] (-501.120) (-501.835) -- 0:00:21
641500 -- (-499.847) (-499.125) [-499.155] (-500.500) * [-498.013] (-499.780) (-497.845) (-502.304) -- 0:00:21
642000 -- (-497.820) [-499.095] (-500.424) (-499.674) * (-499.154) (-500.295) (-497.549) [-499.618] -- 0:00:21
642500 -- (-500.290) (-499.913) (-497.247) [-499.584] * (-499.123) [-498.007] (-497.280) (-499.326) -- 0:00:21
643000 -- (-498.540) [-498.117] (-498.251) (-501.338) * [-497.102] (-497.364) (-498.076) (-499.727) -- 0:00:21
643500 -- (-498.835) [-499.331] (-498.023) (-497.658) * [-501.867] (-502.499) (-500.616) (-499.072) -- 0:00:21
644000 -- (-498.984) [-500.227] (-497.163) (-497.192) * (-499.980) (-501.604) (-499.545) [-502.336] -- 0:00:21
644500 -- (-498.361) (-500.998) [-498.493] (-499.321) * (-502.237) (-500.198) (-498.212) [-498.530] -- 0:00:21
645000 -- (-501.878) (-498.368) [-498.484] (-498.802) * (-504.336) (-498.645) [-498.943] (-497.022) -- 0:00:21
Average standard deviation of split frequencies: 0.011108
645500 -- (-500.535) (-500.509) [-498.472] (-498.192) * (-503.396) (-498.458) (-500.151) [-498.443] -- 0:00:21
646000 -- (-502.164) (-497.617) [-500.076] (-501.606) * (-501.168) (-498.288) [-498.465] (-501.595) -- 0:00:21
646500 -- [-498.917] (-498.965) (-503.250) (-498.375) * (-497.686) (-501.334) (-499.013) [-499.881] -- 0:00:21
647000 -- (-498.972) (-500.081) (-501.114) [-501.877] * (-498.673) [-496.821] (-499.372) (-498.075) -- 0:00:21
647500 -- [-498.041] (-501.955) (-504.258) (-499.197) * [-499.173] (-497.591) (-499.838) (-497.387) -- 0:00:21
648000 -- (-500.191) (-498.152) [-499.711] (-497.403) * [-500.127] (-499.585) (-498.743) (-500.631) -- 0:00:21
648500 -- [-498.486] (-497.342) (-497.568) (-497.526) * (-498.143) (-500.320) (-498.492) [-497.772] -- 0:00:21
649000 -- [-499.792] (-499.773) (-497.958) (-497.733) * (-497.634) (-498.879) [-500.505] (-499.941) -- 0:00:21
649500 -- (-504.876) [-497.723] (-499.804) (-497.352) * [-497.205] (-501.054) (-500.574) (-498.989) -- 0:00:21
650000 -- (-498.186) [-498.842] (-500.193) (-499.151) * (-496.908) (-500.352) [-497.061] (-500.071) -- 0:00:21
Average standard deviation of split frequencies: 0.010827
650500 -- (-498.668) (-501.119) (-499.822) [-498.649] * (-502.021) (-497.579) [-498.415] (-501.786) -- 0:00:20
651000 -- (-498.116) (-498.284) (-498.886) [-498.368] * [-500.455] (-498.970) (-498.735) (-501.898) -- 0:00:20
651500 -- (-497.401) [-498.726] (-499.447) (-499.548) * (-498.480) [-498.165] (-499.217) (-501.735) -- 0:00:20
652000 -- (-501.036) (-499.523) (-500.048) [-500.932] * (-497.980) (-499.097) [-498.011] (-499.241) -- 0:00:20
652500 -- (-498.042) [-499.023] (-500.667) (-497.687) * (-498.447) (-497.394) [-500.473] (-498.376) -- 0:00:20
653000 -- (-497.397) (-498.802) (-499.794) [-497.518] * (-498.285) [-498.118] (-497.743) (-499.329) -- 0:00:20
653500 -- (-498.614) [-498.263] (-498.373) (-500.269) * (-498.667) [-499.608] (-500.003) (-498.923) -- 0:00:20
654000 -- [-498.933] (-499.428) (-497.666) (-498.162) * (-498.235) (-501.171) [-498.617] (-498.549) -- 0:00:20
654500 -- (-502.252) (-499.261) [-498.313] (-499.468) * (-497.931) [-498.657] (-499.178) (-498.211) -- 0:00:20
655000 -- (-503.078) (-501.264) (-499.963) [-497.417] * (-499.191) (-500.114) (-498.587) [-497.651] -- 0:00:20
Average standard deviation of split frequencies: 0.011098
655500 -- [-498.651] (-501.710) (-499.966) (-498.666) * (-499.295) [-497.229] (-498.968) (-497.591) -- 0:00:20
656000 -- (-498.637) (-499.944) [-496.809] (-497.576) * (-498.576) (-500.177) (-499.344) [-502.991] -- 0:00:20
656500 -- (-501.153) [-498.599] (-499.850) (-500.016) * [-499.365] (-498.934) (-499.638) (-499.676) -- 0:00:20
657000 -- (-499.494) [-498.164] (-498.756) (-501.569) * (-498.465) [-497.552] (-497.819) (-504.742) -- 0:00:20
657500 -- (-499.411) (-498.705) (-500.392) [-500.551] * [-500.363] (-497.438) (-498.228) (-498.198) -- 0:00:20
658000 -- (-498.526) [-498.841] (-499.938) (-498.484) * (-499.208) (-497.307) [-497.731] (-498.924) -- 0:00:20
658500 -- (-499.644) (-497.493) (-499.941) [-497.650] * (-500.818) (-497.282) (-499.164) [-498.404] -- 0:00:20
659000 -- [-497.837] (-498.485) (-498.405) (-498.332) * (-498.510) [-497.983] (-499.671) (-503.858) -- 0:00:20
659500 -- (-498.631) (-497.861) (-501.170) [-497.246] * (-502.908) [-499.747] (-500.767) (-498.760) -- 0:00:20
660000 -- (-497.588) [-498.482] (-498.530) (-498.628) * (-497.783) [-500.181] (-503.401) (-497.791) -- 0:00:20
Average standard deviation of split frequencies: 0.010031
660500 -- (-498.131) (-498.332) (-496.990) [-498.837] * (-498.009) [-499.920] (-503.687) (-497.859) -- 0:00:20
661000 -- (-498.370) (-500.376) [-498.255] (-499.767) * (-498.169) [-499.166] (-500.056) (-497.592) -- 0:00:20
661500 -- (-500.042) (-503.788) (-502.681) [-499.727] * (-499.031) (-497.783) (-498.811) [-500.525] -- 0:00:20
662000 -- (-503.628) [-499.420] (-502.066) (-498.505) * (-497.430) [-497.995] (-499.174) (-501.371) -- 0:00:20
662500 -- [-498.516] (-509.500) (-500.175) (-498.207) * (-497.849) (-500.799) [-498.691] (-499.898) -- 0:00:20
663000 -- (-497.278) (-497.957) (-500.889) [-499.289] * (-498.738) (-498.775) [-499.570] (-502.327) -- 0:00:20
663500 -- (-497.885) (-503.268) [-497.245] (-498.733) * (-499.937) (-497.103) [-500.474] (-499.850) -- 0:00:20
664000 -- (-501.888) (-503.958) (-499.293) [-499.783] * (-502.169) [-501.511] (-497.660) (-501.332) -- 0:00:20
664500 -- [-496.971] (-506.978) (-501.525) (-498.104) * (-501.894) [-497.365] (-498.522) (-506.217) -- 0:00:20
665000 -- (-500.573) (-507.582) [-499.973] (-497.750) * (-503.961) [-502.238] (-498.251) (-501.236) -- 0:00:20
Average standard deviation of split frequencies: 0.010499
665500 -- (-499.893) (-499.100) (-497.404) [-497.247] * (-501.772) (-497.915) [-498.376] (-502.515) -- 0:00:20
666000 -- (-499.115) [-497.987] (-498.653) (-499.308) * (-497.324) (-497.887) [-500.409] (-502.047) -- 0:00:20
666500 -- (-498.042) (-498.734) (-498.631) [-499.986] * (-499.178) (-496.950) (-498.992) [-497.275] -- 0:00:20
667000 -- (-497.257) [-498.179] (-499.334) (-504.642) * (-496.990) (-497.778) [-498.224] (-500.909) -- 0:00:19
667500 -- (-496.986) (-499.817) [-499.663] (-499.481) * (-499.383) (-500.036) (-500.581) [-497.925] -- 0:00:19
668000 -- (-497.129) [-498.715] (-500.667) (-498.276) * [-497.405] (-498.170) (-498.548) (-499.578) -- 0:00:19
668500 -- [-498.083] (-498.402) (-498.031) (-500.009) * (-500.833) [-497.403] (-500.135) (-502.550) -- 0:00:19
669000 -- (-498.575) (-500.783) [-497.679] (-498.340) * (-503.984) (-500.439) [-498.467] (-500.667) -- 0:00:19
669500 -- (-500.260) (-500.666) (-498.047) [-498.367] * (-497.570) (-500.252) [-502.432] (-499.764) -- 0:00:19
670000 -- [-498.841] (-506.706) (-498.398) (-500.975) * (-500.939) (-499.997) (-498.633) [-498.783] -- 0:00:19
Average standard deviation of split frequencies: 0.010006
670500 -- [-497.030] (-500.179) (-499.398) (-498.076) * (-500.663) [-499.640] (-498.711) (-501.850) -- 0:00:19
671000 -- (-496.904) [-497.864] (-500.192) (-497.928) * (-500.625) [-499.437] (-498.858) (-505.908) -- 0:00:19
671500 -- [-498.521] (-501.777) (-499.126) (-501.290) * [-499.407] (-500.770) (-500.507) (-501.302) -- 0:00:19
672000 -- (-498.327) (-499.717) [-497.709] (-501.975) * (-498.745) (-499.999) [-500.541] (-501.881) -- 0:00:19
672500 -- (-500.898) (-501.218) (-501.014) [-499.103] * (-496.633) (-498.158) [-498.063] (-500.103) -- 0:00:19
673000 -- (-500.107) (-505.867) [-498.339] (-508.225) * [-497.287] (-502.175) (-503.442) (-498.126) -- 0:00:19
673500 -- (-499.482) (-497.932) (-498.702) [-503.042] * [-500.563] (-497.836) (-500.920) (-498.093) -- 0:00:19
674000 -- (-501.182) (-497.418) [-497.255] (-498.162) * (-500.751) (-496.982) (-500.904) [-498.352] -- 0:00:19
674500 -- [-500.660] (-497.923) (-501.274) (-498.521) * (-501.311) [-498.077] (-499.549) (-498.044) -- 0:00:19
675000 -- (-497.869) (-499.589) (-499.690) [-501.721] * (-497.306) [-498.804] (-501.941) (-500.144) -- 0:00:19
Average standard deviation of split frequencies: 0.009640
675500 -- (-499.818) (-497.381) (-499.203) [-500.006] * (-498.464) (-502.927) [-497.646] (-499.913) -- 0:00:19
676000 -- [-498.352] (-498.293) (-498.939) (-501.737) * (-500.855) (-497.640) (-501.095) [-498.282] -- 0:00:19
676500 -- [-498.964] (-499.444) (-499.379) (-498.753) * (-497.758) [-497.736] (-506.839) (-497.445) -- 0:00:19
677000 -- (-500.425) [-497.585] (-499.133) (-497.143) * (-500.311) (-502.014) (-498.225) [-497.256] -- 0:00:19
677500 -- (-501.653) (-501.865) (-500.185) [-499.302] * (-503.836) (-500.175) [-499.792] (-501.887) -- 0:00:19
678000 -- (-499.553) (-499.669) [-500.440] (-497.756) * [-499.075] (-503.166) (-502.654) (-498.675) -- 0:00:19
678500 -- (-497.227) (-500.696) (-499.262) [-500.585] * (-500.719) (-497.309) (-500.760) [-498.193] -- 0:00:19
679000 -- [-497.132] (-501.459) (-497.680) (-497.884) * [-499.777] (-499.511) (-501.750) (-498.299) -- 0:00:19
679500 -- (-500.266) (-499.877) (-498.574) [-498.416] * [-499.329] (-499.901) (-503.753) (-502.059) -- 0:00:19
680000 -- (-504.671) (-502.175) [-501.268] (-498.112) * (-498.199) (-498.683) [-497.200] (-498.973) -- 0:00:19
Average standard deviation of split frequencies: 0.009777
680500 -- [-497.300] (-497.737) (-502.093) (-499.520) * (-498.615) (-497.506) (-500.057) [-498.559] -- 0:00:19
681000 -- (-498.353) (-497.106) [-501.118] (-499.757) * (-500.440) (-499.338) [-499.949] (-497.725) -- 0:00:19
681500 -- (-497.853) (-497.467) [-501.421] (-499.743) * (-497.361) [-499.685] (-498.162) (-497.310) -- 0:00:19
682000 -- (-497.684) (-499.004) (-502.385) [-498.598] * (-498.096) (-501.364) [-497.156] (-496.997) -- 0:00:19
682500 -- [-499.724] (-499.546) (-503.024) (-497.768) * [-499.813] (-500.108) (-499.462) (-497.731) -- 0:00:19
683000 -- [-496.747] (-501.032) (-505.579) (-498.674) * (-499.856) [-498.198] (-502.506) (-497.997) -- 0:00:19
683500 -- (-496.870) (-504.059) [-500.686] (-499.751) * (-497.442) (-499.481) (-499.075) [-498.720] -- 0:00:18
684000 -- [-496.965] (-499.153) (-504.295) (-499.898) * (-498.983) (-498.232) (-497.202) [-499.018] -- 0:00:18
684500 -- (-499.271) [-499.320] (-501.585) (-499.547) * [-498.432] (-498.052) (-500.318) (-498.991) -- 0:00:18
685000 -- (-501.747) [-499.372] (-499.261) (-498.191) * [-498.632] (-499.772) (-499.489) (-497.291) -- 0:00:18
Average standard deviation of split frequencies: 0.010025
685500 -- (-502.966) [-499.061] (-504.753) (-500.541) * [-496.752] (-498.342) (-498.703) (-499.764) -- 0:00:18
686000 -- [-500.112] (-496.966) (-499.639) (-500.885) * [-497.158] (-501.931) (-496.905) (-499.557) -- 0:00:18
686500 -- (-498.300) [-498.160] (-496.952) (-498.062) * [-497.695] (-500.114) (-499.994) (-497.535) -- 0:00:18
687000 -- (-498.020) (-497.995) [-497.668] (-499.440) * (-499.055) (-508.710) (-504.260) [-498.124] -- 0:00:18
687500 -- (-497.033) (-499.083) (-497.908) [-498.122] * (-504.354) [-500.008] (-501.394) (-501.607) -- 0:00:18
688000 -- (-499.534) (-499.605) [-497.863] (-497.878) * (-499.162) (-498.798) [-500.773] (-499.614) -- 0:00:18
688500 -- (-497.913) (-501.072) (-499.365) [-498.962] * (-498.218) (-499.680) [-500.981] (-500.494) -- 0:00:18
689000 -- [-497.118] (-499.500) (-499.960) (-498.306) * (-496.640) [-500.461] (-504.878) (-498.027) -- 0:00:18
689500 -- (-498.430) (-500.344) [-500.743] (-497.650) * (-497.438) [-500.518] (-501.589) (-497.468) -- 0:00:18
690000 -- (-501.306) [-499.332] (-501.321) (-498.041) * (-498.563) (-499.144) (-502.357) [-497.109] -- 0:00:18
Average standard deviation of split frequencies: 0.010633
690500 -- (-499.267) (-500.880) (-499.217) [-499.419] * (-497.479) (-498.750) [-497.506] (-499.294) -- 0:00:18
691000 -- [-499.752] (-499.773) (-500.500) (-499.054) * (-499.311) (-498.665) (-498.635) [-499.718] -- 0:00:18
691500 -- [-498.534] (-499.609) (-503.225) (-497.452) * (-499.716) [-499.369] (-499.578) (-498.056) -- 0:00:18
692000 -- (-497.197) (-498.057) (-497.612) [-498.677] * [-497.994] (-498.725) (-499.827) (-497.353) -- 0:00:18
692500 -- (-501.971) (-499.490) (-497.418) [-501.828] * (-501.955) (-501.113) [-501.858] (-500.681) -- 0:00:18
693000 -- (-499.931) (-499.579) [-497.503] (-499.182) * (-499.597) (-497.838) (-498.956) [-502.582] -- 0:00:18
693500 -- (-500.517) (-498.377) (-497.713) [-498.332] * (-499.061) (-498.589) (-497.682) [-497.392] -- 0:00:18
694000 -- [-499.396] (-498.171) (-500.210) (-498.371) * [-498.446] (-499.313) (-499.111) (-503.006) -- 0:00:18
694500 -- (-498.104) [-499.168] (-500.144) (-499.283) * [-500.562] (-508.894) (-500.219) (-500.926) -- 0:00:18
695000 -- (-497.857) (-500.996) [-497.909] (-499.925) * (-504.265) (-500.194) (-502.264) [-496.862] -- 0:00:18
Average standard deviation of split frequencies: 0.010409
695500 -- [-498.011] (-502.440) (-499.430) (-498.430) * (-500.013) [-499.185] (-498.021) (-497.907) -- 0:00:18
696000 -- (-498.424) (-499.193) [-499.168] (-499.600) * [-498.211] (-498.123) (-500.496) (-501.075) -- 0:00:18
696500 -- (-498.178) (-499.285) [-500.320] (-497.581) * [-502.201] (-500.615) (-498.970) (-499.561) -- 0:00:18
697000 -- (-497.563) [-500.316] (-501.305) (-497.047) * (-498.273) (-503.791) (-500.968) [-500.684] -- 0:00:18
697500 -- (-502.064) (-499.601) (-497.676) [-497.261] * (-498.632) (-503.240) [-500.626] (-500.220) -- 0:00:18
698000 -- (-500.508) (-498.660) [-499.097] (-502.171) * [-497.375] (-501.240) (-498.422) (-497.236) -- 0:00:18
698500 -- [-498.430] (-498.623) (-505.109) (-500.675) * (-499.080) [-497.512] (-498.451) (-501.601) -- 0:00:18
699000 -- (-498.357) [-499.112] (-501.852) (-500.531) * (-499.117) (-497.857) (-498.698) [-499.719] -- 0:00:18
699500 -- (-496.737) [-501.073] (-500.395) (-498.947) * (-497.582) [-497.448] (-496.831) (-497.427) -- 0:00:18
700000 -- [-498.935] (-497.346) (-498.796) (-502.879) * (-497.358) (-497.452) [-499.377] (-498.346) -- 0:00:18
Average standard deviation of split frequencies: 0.010340
700500 -- (-500.149) [-498.014] (-498.447) (-500.484) * (-497.746) (-498.244) (-502.132) [-496.995] -- 0:00:17
701000 -- (-499.354) (-497.167) (-498.200) [-498.781] * (-499.640) (-499.150) (-500.800) [-499.532] -- 0:00:17
701500 -- (-499.575) (-497.640) [-498.001] (-498.277) * (-497.456) (-501.641) (-503.231) [-500.996] -- 0:00:17
702000 -- (-500.696) [-498.551] (-502.207) (-499.264) * (-499.839) [-497.980] (-500.007) (-498.806) -- 0:00:17
702500 -- [-499.055] (-499.141) (-499.085) (-498.648) * [-497.210] (-498.629) (-500.179) (-497.517) -- 0:00:17
703000 -- (-502.180) (-502.718) (-505.626) [-498.344] * [-497.591] (-498.298) (-497.997) (-497.767) -- 0:00:17
703500 -- (-499.946) (-498.768) [-498.686] (-498.040) * (-500.338) (-497.407) [-500.026] (-502.006) -- 0:00:17
704000 -- (-498.805) [-497.213] (-497.192) (-502.523) * (-501.680) (-499.491) (-498.398) [-501.950] -- 0:00:17
704500 -- [-501.092] (-499.971) (-500.010) (-503.128) * (-499.836) (-498.641) (-499.538) [-499.549] -- 0:00:17
705000 -- (-500.895) (-499.892) [-499.855] (-502.672) * [-497.518] (-497.685) (-497.855) (-500.119) -- 0:00:17
Average standard deviation of split frequencies: 0.009875
705500 -- [-501.061] (-499.558) (-499.735) (-498.813) * [-498.164] (-498.837) (-497.782) (-499.265) -- 0:00:17
706000 -- (-498.964) (-502.439) (-497.902) [-500.395] * [-499.692] (-499.266) (-500.156) (-499.610) -- 0:00:17
706500 -- (-498.530) (-498.226) (-498.841) [-498.767] * (-498.304) [-503.941] (-500.859) (-502.684) -- 0:00:17
707000 -- (-499.682) (-498.110) (-497.481) [-498.539] * [-498.290] (-499.622) (-498.758) (-498.969) -- 0:00:17
707500 -- (-500.553) [-498.761] (-498.277) (-498.154) * (-498.980) (-497.278) [-500.863] (-497.430) -- 0:00:17
708000 -- (-499.157) (-498.770) (-497.608) [-498.312] * (-502.667) (-497.971) (-500.140) [-498.795] -- 0:00:17
708500 -- (-499.052) (-498.571) (-499.629) [-497.630] * (-501.164) (-500.744) (-498.849) [-498.312] -- 0:00:17
709000 -- [-498.332] (-498.433) (-499.562) (-497.333) * (-500.386) (-502.298) [-499.739] (-500.652) -- 0:00:17
709500 -- [-499.224] (-497.686) (-502.516) (-499.860) * (-501.420) (-499.692) [-497.988] (-503.758) -- 0:00:17
710000 -- [-497.781] (-500.970) (-500.386) (-500.981) * (-499.535) [-498.038] (-498.316) (-499.340) -- 0:00:17
Average standard deviation of split frequencies: 0.009740
710500 -- (-498.468) (-498.924) [-498.185] (-500.106) * (-500.342) (-497.713) [-505.446] (-497.295) -- 0:00:17
711000 -- (-497.496) (-501.124) (-498.558) [-499.873] * [-500.128] (-499.971) (-498.834) (-497.428) -- 0:00:17
711500 -- (-497.218) (-498.814) [-498.780] (-499.278) * [-500.485] (-501.526) (-498.068) (-505.125) -- 0:00:17
712000 -- (-504.310) (-502.970) (-500.884) [-497.040] * [-499.773] (-498.550) (-498.271) (-501.274) -- 0:00:17
712500 -- (-500.019) [-499.180] (-502.843) (-501.190) * (-501.242) (-500.424) [-500.068] (-500.325) -- 0:00:17
713000 -- [-499.470] (-501.639) (-498.636) (-502.645) * (-499.217) (-500.879) [-498.588] (-497.376) -- 0:00:17
713500 -- (-497.966) (-498.562) (-501.147) [-502.081] * (-497.425) (-498.862) [-499.762] (-496.806) -- 0:00:17
714000 -- (-497.678) [-498.732] (-498.126) (-497.750) * (-498.132) (-500.292) [-501.259] (-496.776) -- 0:00:17
714500 -- [-497.752] (-498.908) (-500.804) (-506.471) * (-501.143) [-498.894] (-501.002) (-498.271) -- 0:00:17
715000 -- (-497.878) (-499.163) (-502.114) [-504.398] * (-500.437) [-498.880] (-503.097) (-497.930) -- 0:00:17
Average standard deviation of split frequencies: 0.009391
715500 -- (-497.327) (-501.033) (-505.622) [-497.648] * (-499.553) [-497.995] (-498.832) (-500.287) -- 0:00:17
716000 -- [-497.834] (-501.509) (-500.962) (-498.515) * (-500.172) (-497.571) (-501.565) [-499.080] -- 0:00:17
716500 -- (-497.769) (-499.667) (-502.322) [-501.951] * (-500.244) (-498.358) (-506.384) [-499.500] -- 0:00:17
717000 -- [-497.178] (-503.342) (-499.503) (-501.466) * [-497.913] (-498.607) (-501.625) (-498.619) -- 0:00:16
717500 -- [-501.206] (-504.222) (-498.456) (-500.685) * (-498.731) (-501.285) (-502.154) [-500.156] -- 0:00:16
718000 -- (-501.413) (-500.866) [-500.700] (-498.855) * (-500.755) (-497.266) [-498.275] (-505.283) -- 0:00:16
718500 -- (-498.288) [-498.111] (-499.620) (-500.457) * (-499.268) [-498.342] (-497.851) (-503.129) -- 0:00:16
719000 -- (-499.044) (-498.001) (-501.478) [-503.229] * (-499.501) [-497.015] (-499.137) (-500.233) -- 0:00:16
719500 -- (-500.867) [-500.132] (-498.560) (-499.562) * (-504.249) (-497.108) [-497.722] (-501.831) -- 0:00:16
720000 -- (-499.163) [-500.138] (-501.394) (-500.643) * (-503.858) [-497.108] (-497.835) (-498.104) -- 0:00:16
Average standard deviation of split frequencies: 0.009605
720500 -- (-497.936) (-499.328) (-499.843) [-499.577] * [-500.071] (-499.922) (-499.151) (-504.814) -- 0:00:16
721000 -- (-498.985) [-499.903] (-500.778) (-499.280) * [-502.547] (-499.416) (-497.716) (-498.144) -- 0:00:16
721500 -- (-499.223) (-499.942) [-498.161] (-499.964) * (-501.043) (-498.233) [-498.124] (-499.251) -- 0:00:16
722000 -- (-498.287) (-497.676) (-498.759) [-498.552] * (-499.088) (-498.627) [-499.194] (-497.716) -- 0:00:16
722500 -- (-498.942) [-499.357] (-499.576) (-501.694) * [-499.341] (-502.568) (-504.654) (-498.968) -- 0:00:16
723000 -- (-501.193) (-498.697) [-498.270] (-501.014) * (-501.751) [-500.605] (-503.055) (-497.414) -- 0:00:16
723500 -- (-497.671) (-498.184) (-499.179) [-499.002] * (-497.941) (-501.364) [-504.408] (-498.185) -- 0:00:16
724000 -- (-500.804) (-496.737) (-498.876) [-503.211] * (-496.833) [-502.516] (-503.943) (-499.419) -- 0:00:16
724500 -- (-502.156) [-497.264] (-498.471) (-506.843) * [-500.298] (-500.693) (-500.722) (-500.601) -- 0:00:16
725000 -- (-498.383) (-503.352) (-498.353) [-497.403] * (-500.073) [-500.576] (-498.033) (-499.798) -- 0:00:16
Average standard deviation of split frequencies: 0.009808
725500 -- [-497.432] (-501.087) (-501.983) (-498.375) * (-500.462) (-501.281) (-501.115) [-498.614] -- 0:00:16
726000 -- (-499.389) (-506.683) (-505.120) [-497.109] * (-500.081) [-497.857] (-502.293) (-499.698) -- 0:00:16
726500 -- [-497.995] (-500.436) (-501.973) (-499.621) * (-498.060) (-498.578) (-498.022) [-501.544] -- 0:00:16
727000 -- [-500.251] (-501.014) (-498.176) (-501.502) * [-499.367] (-500.965) (-497.947) (-499.017) -- 0:00:16
727500 -- (-500.706) [-503.918] (-498.169) (-501.847) * (-499.535) (-499.653) (-497.692) [-499.785] -- 0:00:16
728000 -- (-499.035) (-499.830) (-497.066) [-499.190] * [-498.662] (-498.074) (-502.324) (-499.499) -- 0:00:16
728500 -- (-499.253) (-499.128) [-499.159] (-498.898) * (-499.573) (-499.045) (-500.809) [-498.100] -- 0:00:16
729000 -- [-497.660] (-497.383) (-500.764) (-502.242) * (-502.982) [-498.106] (-501.390) (-499.057) -- 0:00:16
729500 -- (-500.643) [-497.361] (-498.920) (-501.563) * (-499.694) [-496.874] (-499.088) (-500.182) -- 0:00:16
730000 -- (-503.501) (-499.228) [-499.122] (-499.134) * (-500.081) [-501.881] (-499.803) (-498.879) -- 0:00:16
Average standard deviation of split frequencies: 0.008638
730500 -- (-499.113) [-498.964] (-500.385) (-501.107) * (-499.769) (-500.387) (-496.915) [-499.167] -- 0:00:16
731000 -- (-500.452) [-496.862] (-502.468) (-502.709) * (-498.494) [-498.494] (-496.944) (-499.635) -- 0:00:16
731500 -- (-500.664) [-498.839] (-505.936) (-497.918) * (-497.231) (-508.082) [-500.858] (-497.902) -- 0:00:16
732000 -- (-501.045) [-497.653] (-501.052) (-498.590) * [-497.412] (-501.275) (-500.143) (-498.980) -- 0:00:16
732500 -- [-500.294] (-500.454) (-497.936) (-504.320) * (-498.703) (-498.176) [-498.152] (-500.071) -- 0:00:16
733000 -- (-498.487) (-498.694) [-497.803] (-504.394) * (-499.258) (-500.282) [-498.686] (-499.135) -- 0:00:16
733500 -- [-499.412] (-498.772) (-499.078) (-501.329) * (-497.146) (-498.022) [-497.255] (-498.013) -- 0:00:15
734000 -- (-498.119) (-504.147) [-497.216] (-499.246) * (-498.824) [-499.382] (-500.835) (-497.914) -- 0:00:15
734500 -- (-500.059) (-499.235) [-499.868] (-502.110) * [-501.736] (-497.662) (-499.263) (-498.947) -- 0:00:15
735000 -- (-497.690) (-499.130) [-501.319] (-499.103) * (-501.878) (-497.903) [-497.336] (-499.521) -- 0:00:15
Average standard deviation of split frequencies: 0.009038
735500 -- (-498.575) [-498.286] (-500.812) (-500.571) * (-497.569) (-500.523) (-497.780) [-497.398] -- 0:00:15
736000 -- [-499.719] (-502.758) (-499.402) (-497.878) * (-498.074) (-498.989) (-497.082) [-497.480] -- 0:00:15
736500 -- (-499.512) (-502.254) [-503.682] (-498.097) * (-500.179) [-499.429] (-498.385) (-499.690) -- 0:00:15
737000 -- (-498.327) (-499.280) [-499.247] (-501.343) * (-500.392) (-501.733) [-499.969] (-499.256) -- 0:00:15
737500 -- (-500.996) [-499.051] (-499.223) (-500.476) * [-498.674] (-500.587) (-498.370) (-501.186) -- 0:00:15
738000 -- (-500.420) (-498.951) (-498.606) [-498.947] * (-499.530) [-500.007] (-499.683) (-499.260) -- 0:00:15
738500 -- (-498.681) (-498.014) [-496.773] (-502.067) * (-499.818) (-499.526) (-499.515) [-499.692] -- 0:00:15
739000 -- [-498.128] (-498.209) (-500.244) (-501.195) * (-500.076) [-501.229] (-498.539) (-499.222) -- 0:00:15
739500 -- (-497.890) [-498.157] (-498.187) (-499.849) * (-497.364) [-497.979] (-497.867) (-496.979) -- 0:00:15
740000 -- (-500.139) (-500.226) [-501.624] (-500.693) * [-498.614] (-498.845) (-500.704) (-499.815) -- 0:00:15
Average standard deviation of split frequencies: 0.009441
740500 -- (-501.128) (-500.619) (-498.072) [-498.181] * (-499.678) (-499.039) [-501.890] (-500.958) -- 0:00:15
741000 -- (-499.692) (-503.016) (-498.341) [-498.273] * (-501.261) (-498.894) [-499.733] (-500.340) -- 0:00:15
741500 -- (-498.606) (-498.700) [-498.392] (-497.491) * (-502.759) [-497.787] (-499.997) (-498.937) -- 0:00:15
742000 -- (-498.057) (-500.590) [-498.522] (-500.065) * [-498.573] (-497.978) (-501.151) (-499.377) -- 0:00:15
742500 -- (-498.030) (-498.181) [-496.883] (-499.255) * (-498.289) [-499.563] (-500.193) (-498.010) -- 0:00:15
743000 -- (-497.228) [-497.710] (-500.732) (-499.678) * (-501.323) [-499.078] (-499.915) (-499.954) -- 0:00:15
743500 -- [-497.855] (-499.057) (-501.847) (-499.260) * [-498.043] (-497.377) (-498.131) (-499.427) -- 0:00:15
744000 -- [-500.434] (-500.089) (-497.803) (-497.291) * [-499.158] (-501.320) (-500.445) (-503.260) -- 0:00:15
744500 -- (-514.295) (-497.830) (-497.286) [-499.359] * (-502.628) (-499.789) (-500.316) [-497.978] -- 0:00:15
745000 -- [-496.922] (-500.204) (-500.091) (-499.675) * (-501.435) (-501.412) [-499.697] (-499.557) -- 0:00:15
Average standard deviation of split frequencies: 0.009689
745500 -- [-500.431] (-504.316) (-500.194) (-497.437) * (-501.149) (-499.109) [-497.294] (-497.366) -- 0:00:15
746000 -- [-499.657] (-502.265) (-502.286) (-497.816) * [-497.853] (-505.228) (-500.169) (-498.105) -- 0:00:15
746500 -- (-497.626) (-500.170) (-497.368) [-497.679] * (-499.587) [-502.015] (-499.529) (-498.865) -- 0:00:15
747000 -- (-498.941) [-498.877] (-497.440) (-497.235) * [-501.562] (-501.181) (-498.258) (-505.799) -- 0:00:15
747500 -- (-497.975) [-499.069] (-502.195) (-498.056) * (-497.578) (-498.877) (-500.283) [-501.442] -- 0:00:15
748000 -- (-498.175) [-499.096] (-497.263) (-499.215) * (-499.293) (-500.294) (-499.959) [-498.841] -- 0:00:15
748500 -- (-497.678) [-497.571] (-500.066) (-497.689) * (-502.737) (-499.665) (-498.629) [-499.626] -- 0:00:15
749000 -- (-500.380) [-499.155] (-502.325) (-497.930) * (-499.852) (-499.646) (-498.043) [-507.802] -- 0:00:15
749500 -- (-500.383) [-499.974] (-498.701) (-500.811) * (-498.047) (-498.180) (-500.719) [-498.192] -- 0:00:15
750000 -- (-499.581) (-499.687) [-497.629] (-501.683) * (-498.901) [-500.337] (-497.042) (-499.258) -- 0:00:15
Average standard deviation of split frequencies: 0.009943
750500 -- [-497.397] (-500.288) (-498.461) (-500.466) * (-501.236) [-497.547] (-501.887) (-499.236) -- 0:00:14
751000 -- [-502.619] (-498.659) (-499.859) (-498.254) * (-498.887) [-499.209] (-498.319) (-498.016) -- 0:00:14
751500 -- [-504.201] (-501.220) (-501.438) (-498.054) * (-498.734) (-497.662) (-499.000) [-497.871] -- 0:00:14
752000 -- [-497.226] (-499.146) (-498.319) (-499.989) * (-498.208) (-499.686) [-497.323] (-499.809) -- 0:00:14
752500 -- (-501.791) (-501.369) (-498.537) [-500.020] * (-497.898) (-504.381) (-497.204) [-504.266] -- 0:00:14
753000 -- (-498.762) (-503.405) (-502.284) [-500.033] * (-499.534) (-498.434) [-498.843] (-499.267) -- 0:00:14
753500 -- (-498.240) (-504.157) (-501.000) [-498.883] * (-499.939) [-500.838] (-496.680) (-501.412) -- 0:00:14
754000 -- [-500.814] (-505.971) (-503.019) (-498.196) * (-501.344) (-499.340) [-502.826] (-499.079) -- 0:00:14
754500 -- (-498.966) [-498.119] (-500.032) (-497.578) * [-498.100] (-501.224) (-499.467) (-499.460) -- 0:00:14
755000 -- (-498.576) (-497.592) (-498.296) [-498.576] * [-498.437] (-498.477) (-499.170) (-500.188) -- 0:00:14
Average standard deviation of split frequencies: 0.009908
755500 -- (-498.392) (-499.671) [-497.959] (-498.650) * (-497.837) (-498.396) (-498.937) [-499.968] -- 0:00:14
756000 -- (-498.415) [-497.376] (-497.510) (-499.030) * (-500.209) (-499.654) [-497.909] (-501.098) -- 0:00:14
756500 -- (-498.602) [-499.418] (-503.518) (-500.721) * (-499.274) [-500.382] (-499.833) (-498.977) -- 0:00:14
757000 -- [-498.450] (-498.960) (-501.960) (-499.520) * (-503.284) (-498.400) [-503.437] (-501.722) -- 0:00:14
757500 -- (-498.106) [-498.684] (-498.817) (-501.721) * (-499.549) (-497.761) (-499.951) [-497.472] -- 0:00:14
758000 -- (-499.837) (-498.784) [-498.304] (-500.953) * [-497.432] (-499.300) (-497.909) (-501.528) -- 0:00:14
758500 -- (-497.963) (-497.795) [-496.968] (-499.856) * (-499.983) (-499.015) [-498.650] (-497.687) -- 0:00:14
759000 -- [-497.982] (-500.565) (-497.709) (-498.595) * (-499.489) [-500.379] (-498.593) (-498.011) -- 0:00:14
759500 -- (-499.521) (-499.322) (-497.591) [-500.888] * (-501.255) (-497.630) [-500.357] (-498.762) -- 0:00:14
760000 -- (-496.675) (-501.979) [-499.427] (-498.151) * [-499.435] (-498.840) (-500.797) (-501.044) -- 0:00:14
Average standard deviation of split frequencies: 0.009778
760500 -- [-498.238] (-498.879) (-498.233) (-499.139) * (-497.328) (-501.128) (-499.456) [-500.475] -- 0:00:14
761000 -- (-499.481) (-502.471) (-497.081) [-500.998] * (-501.481) (-499.064) (-497.479) [-496.908] -- 0:00:14
761500 -- [-497.731] (-498.009) (-497.943) (-497.347) * (-501.594) [-498.100] (-497.453) (-496.927) -- 0:00:14
762000 -- (-498.604) [-499.104] (-503.677) (-499.833) * [-504.945] (-497.920) (-500.189) (-500.870) -- 0:00:14
762500 -- [-498.943] (-501.387) (-499.340) (-506.220) * (-502.912) (-497.881) (-503.329) [-497.075] -- 0:00:14
763000 -- (-499.778) (-504.460) (-498.242) [-499.216] * (-502.758) (-498.781) (-499.447) [-497.223] -- 0:00:14
763500 -- (-498.422) (-503.479) [-498.857] (-498.845) * [-498.448] (-499.533) (-500.129) (-499.333) -- 0:00:14
764000 -- (-497.906) (-502.309) (-500.956) [-500.832] * (-498.020) (-500.654) [-497.353] (-499.488) -- 0:00:14
764500 -- (-498.307) (-498.614) [-497.598] (-499.348) * (-498.315) (-501.778) (-498.122) [-498.271] -- 0:00:14
765000 -- (-506.778) [-500.887] (-497.630) (-500.344) * (-497.493) (-500.077) (-498.822) [-497.457] -- 0:00:14
Average standard deviation of split frequencies: 0.009744
765500 -- [-503.265] (-497.891) (-496.891) (-499.494) * (-500.423) (-498.944) (-499.172) [-497.209] -- 0:00:14
766000 -- [-499.633] (-498.155) (-499.829) (-498.134) * (-498.963) (-497.597) (-501.225) [-497.969] -- 0:00:14
766500 -- (-497.694) (-500.265) [-500.171] (-497.732) * (-497.409) [-498.871] (-502.929) (-497.665) -- 0:00:14
767000 -- (-500.995) (-501.475) (-500.870) [-497.738] * (-499.529) [-498.029] (-501.567) (-497.775) -- 0:00:13
767500 -- (-503.707) (-504.840) (-505.576) [-496.729] * (-502.228) (-499.518) (-503.797) [-498.225] -- 0:00:13
768000 -- (-497.519) (-502.355) (-499.959) [-498.710] * (-506.723) (-498.150) (-499.542) [-500.968] -- 0:00:13
768500 -- (-501.726) (-503.464) [-497.565] (-497.006) * (-499.978) [-499.647] (-501.205) (-497.940) -- 0:00:13
769000 -- [-498.704] (-499.570) (-501.599) (-498.198) * [-500.209] (-497.918) (-500.162) (-497.653) -- 0:00:13
769500 -- (-498.649) (-500.889) [-499.151] (-500.283) * (-499.358) (-506.138) [-497.358] (-498.133) -- 0:00:13
770000 -- (-499.923) (-500.784) [-501.301] (-497.813) * (-500.031) (-499.325) (-500.639) [-502.163] -- 0:00:13
Average standard deviation of split frequencies: 0.009753
770500 -- (-497.460) (-502.226) (-499.550) [-496.776] * (-497.493) (-497.110) (-498.591) [-501.104] -- 0:00:13
771000 -- (-499.343) (-500.169) (-497.503) [-498.013] * (-500.348) [-497.941] (-500.899) (-498.664) -- 0:00:13
771500 -- [-499.192] (-499.394) (-498.535) (-499.584) * [-499.789] (-497.803) (-498.715) (-497.043) -- 0:00:13
772000 -- (-501.130) [-498.001] (-497.822) (-498.541) * (-498.203) (-498.153) [-498.938] (-499.451) -- 0:00:13
772500 -- (-501.037) [-497.534] (-502.503) (-498.086) * (-500.452) (-498.626) (-497.992) [-501.139] -- 0:00:13
773000 -- (-498.081) (-497.629) (-498.021) [-498.786] * (-497.326) [-499.450] (-498.583) (-497.960) -- 0:00:13
773500 -- [-497.613] (-497.095) (-500.669) (-498.556) * (-497.813) (-498.001) [-499.776] (-500.031) -- 0:00:13
774000 -- (-498.756) (-498.790) [-501.565] (-498.432) * (-498.943) (-498.663) [-497.834] (-499.305) -- 0:00:13
774500 -- [-501.266] (-497.787) (-498.853) (-498.879) * (-503.157) [-499.689] (-497.015) (-501.873) -- 0:00:13
775000 -- [-503.536] (-505.663) (-497.747) (-500.970) * (-497.362) (-500.209) (-498.255) [-500.754] -- 0:00:13
Average standard deviation of split frequencies: 0.009753
775500 -- (-498.724) (-499.857) [-498.112] (-497.894) * (-504.086) [-502.452] (-501.152) (-498.858) -- 0:00:13
776000 -- (-497.335) (-497.810) [-498.080] (-500.324) * (-499.779) (-501.579) [-499.905] (-500.421) -- 0:00:13
776500 -- (-500.196) [-498.662] (-498.345) (-500.513) * (-503.926) (-502.021) (-500.685) [-499.027] -- 0:00:13
777000 -- (-500.324) [-500.353] (-500.332) (-505.220) * (-503.085) [-499.687] (-500.695) (-501.831) -- 0:00:13
777500 -- (-499.803) [-496.982] (-500.025) (-499.533) * [-498.839] (-498.622) (-499.004) (-498.682) -- 0:00:13
778000 -- [-502.728] (-498.434) (-497.307) (-497.397) * (-503.034) [-497.032] (-498.112) (-499.481) -- 0:00:13
778500 -- [-497.799] (-498.503) (-497.373) (-503.146) * (-499.325) [-499.968] (-500.289) (-497.479) -- 0:00:13
779000 -- (-498.362) [-497.304] (-497.030) (-500.131) * (-502.893) (-500.192) [-499.891] (-501.599) -- 0:00:13
779500 -- [-498.791] (-498.701) (-498.788) (-504.084) * [-502.386] (-497.540) (-498.613) (-497.388) -- 0:00:13
780000 -- (-502.745) [-499.085] (-500.112) (-505.604) * [-499.493] (-498.114) (-507.424) (-497.281) -- 0:00:13
Average standard deviation of split frequencies: 0.009413
780500 -- (-500.546) (-499.313) [-497.226] (-498.239) * (-499.803) (-497.557) [-498.486] (-499.583) -- 0:00:13
781000 -- (-504.290) [-498.512] (-498.540) (-497.318) * (-498.569) [-498.880] (-498.367) (-497.252) -- 0:00:13
781500 -- [-504.049] (-503.490) (-497.919) (-498.052) * (-496.819) [-500.777] (-500.205) (-498.192) -- 0:00:13
782000 -- (-499.892) [-498.293] (-498.719) (-498.614) * (-497.258) (-499.888) (-498.371) [-498.472] -- 0:00:13
782500 -- (-499.206) [-497.675] (-497.889) (-499.824) * (-498.507) (-497.939) [-497.234] (-498.356) -- 0:00:13
783000 -- [-498.800] (-497.892) (-500.376) (-499.379) * (-498.372) (-500.111) (-501.894) [-499.969] -- 0:00:13
783500 -- (-500.077) [-497.849] (-500.004) (-498.802) * [-498.102] (-498.140) (-498.348) (-500.985) -- 0:00:12
784000 -- (-496.832) (-499.864) (-499.897) [-500.323] * (-496.977) (-498.882) (-500.063) [-500.595] -- 0:00:12
784500 -- [-497.508] (-499.397) (-499.977) (-500.916) * (-503.942) [-497.312] (-498.397) (-499.241) -- 0:00:12
785000 -- [-499.744] (-499.528) (-502.011) (-497.666) * (-499.835) (-502.259) [-499.314] (-499.064) -- 0:00:12
Average standard deviation of split frequencies: 0.009912
785500 -- (-500.637) [-502.883] (-498.705) (-500.069) * (-498.128) (-499.096) (-504.313) [-498.585] -- 0:00:12
786000 -- (-500.922) (-499.083) (-500.588) [-497.592] * (-498.533) [-498.011] (-501.313) (-498.363) -- 0:00:12
786500 -- (-500.929) [-499.099] (-506.811) (-498.217) * (-502.593) [-499.236] (-504.151) (-500.088) -- 0:00:12
787000 -- [-499.253] (-501.671) (-506.478) (-497.341) * (-500.131) [-497.651] (-498.888) (-501.021) -- 0:00:12
787500 -- (-498.750) (-497.194) [-502.502] (-497.504) * (-499.223) (-499.076) (-498.888) [-498.052] -- 0:00:12
788000 -- [-498.799] (-499.674) (-497.750) (-497.388) * (-498.315) (-499.339) (-499.199) [-497.383] -- 0:00:12
788500 -- (-498.601) [-498.340] (-501.685) (-498.408) * [-497.511] (-502.784) (-504.224) (-501.932) -- 0:00:12
789000 -- (-498.227) (-497.417) (-500.496) [-499.492] * (-497.128) (-500.972) [-497.108] (-500.649) -- 0:00:12
789500 -- [-498.313] (-497.728) (-499.130) (-500.226) * (-497.615) (-503.947) [-497.401] (-501.371) -- 0:00:12
790000 -- (-498.400) (-503.004) [-500.270] (-497.586) * (-496.902) [-500.122] (-497.511) (-499.255) -- 0:00:12
Average standard deviation of split frequencies: 0.009639
790500 -- [-499.796] (-500.933) (-499.192) (-497.838) * (-498.043) [-499.006] (-499.299) (-498.587) -- 0:00:12
791000 -- (-499.951) (-502.204) [-499.824] (-497.158) * (-498.414) (-498.443) [-498.728] (-497.435) -- 0:00:12
791500 -- (-498.539) (-498.622) [-499.719] (-499.145) * (-502.480) (-498.417) [-498.784] (-497.454) -- 0:00:12
792000 -- (-497.299) [-498.288] (-499.938) (-504.782) * [-501.578] (-499.791) (-498.293) (-502.271) -- 0:00:12
792500 -- [-499.110] (-499.842) (-500.273) (-500.309) * (-498.067) (-498.290) [-500.062] (-500.437) -- 0:00:12
793000 -- [-499.162] (-498.192) (-503.138) (-498.675) * (-499.208) (-498.621) [-501.365] (-499.892) -- 0:00:12
793500 -- (-500.511) [-498.780] (-503.492) (-498.534) * (-498.917) (-499.651) (-500.796) [-500.369] -- 0:00:12
794000 -- (-500.891) [-501.379] (-499.025) (-500.134) * [-499.682] (-500.158) (-500.602) (-501.382) -- 0:00:12
794500 -- (-498.575) (-497.366) [-498.734] (-498.023) * [-499.215] (-500.827) (-502.212) (-497.707) -- 0:00:12
795000 -- (-500.456) (-496.903) (-501.073) [-501.652] * (-498.960) [-498.780] (-503.142) (-499.746) -- 0:00:12
Average standard deviation of split frequencies: 0.008988
795500 -- (-500.752) (-501.659) (-500.161) [-497.165] * (-499.954) (-502.228) [-500.645] (-499.912) -- 0:00:12
796000 -- (-500.113) [-498.672] (-497.956) (-499.395) * (-500.875) (-500.682) (-504.099) [-498.748] -- 0:00:12
796500 -- [-498.488] (-499.092) (-497.367) (-499.028) * (-500.045) [-497.605] (-500.194) (-497.373) -- 0:00:12
797000 -- (-499.062) (-499.181) [-499.965] (-498.842) * (-497.891) (-503.388) (-500.944) [-497.243] -- 0:00:12
797500 -- (-499.431) [-499.297] (-502.991) (-499.148) * [-498.075] (-498.536) (-500.742) (-497.874) -- 0:00:12
798000 -- (-497.334) (-500.581) [-497.698] (-499.966) * [-500.589] (-499.662) (-500.311) (-497.000) -- 0:00:12
798500 -- (-498.560) [-500.701] (-498.401) (-501.593) * (-498.948) (-499.412) (-498.192) [-497.780] -- 0:00:12
799000 -- (-498.239) (-500.583) [-497.880] (-503.613) * (-502.741) (-499.491) [-498.700] (-499.132) -- 0:00:12
799500 -- [-498.013] (-506.774) (-497.945) (-497.342) * (-499.265) (-498.480) (-498.437) [-498.273] -- 0:00:12
800000 -- [-499.260] (-501.150) (-497.088) (-498.110) * (-498.838) (-498.199) [-497.972] (-498.321) -- 0:00:12
Average standard deviation of split frequencies: 0.007929
800500 -- [-498.232] (-504.926) (-502.106) (-498.621) * [-498.974] (-498.812) (-501.362) (-498.618) -- 0:00:11
801000 -- [-497.276] (-501.198) (-499.799) (-497.767) * [-498.567] (-499.483) (-502.010) (-500.814) -- 0:00:11
801500 -- [-497.535] (-500.104) (-497.758) (-501.919) * [-496.869] (-498.437) (-497.385) (-499.958) -- 0:00:11
802000 -- (-498.237) (-499.351) [-498.007] (-498.520) * (-497.646) [-498.047] (-504.781) (-498.042) -- 0:00:11
802500 -- (-500.357) (-498.877) (-499.131) [-498.700] * (-499.485) (-497.619) (-499.381) [-498.388] -- 0:00:11
803000 -- (-499.552) (-500.999) [-497.151] (-497.973) * (-498.459) (-498.641) (-498.926) [-499.447] -- 0:00:11
803500 -- [-497.494] (-502.277) (-497.833) (-499.130) * (-499.476) [-497.865] (-498.225) (-501.599) -- 0:00:11
804000 -- [-497.324] (-500.402) (-500.945) (-497.745) * (-504.552) [-498.971] (-498.793) (-500.325) -- 0:00:11
804500 -- (-497.690) [-500.018] (-500.985) (-499.876) * [-500.464] (-498.492) (-501.695) (-500.561) -- 0:00:11
805000 -- (-498.620) [-498.292] (-497.881) (-498.569) * [-499.439] (-498.383) (-501.289) (-502.257) -- 0:00:11
Average standard deviation of split frequencies: 0.008773
805500 -- [-499.215] (-500.145) (-499.540) (-497.831) * (-499.079) (-498.570) (-500.256) [-498.001] -- 0:00:11
806000 -- (-504.230) (-500.754) [-502.614] (-499.039) * (-498.577) (-498.906) [-499.955] (-498.217) -- 0:00:11
806500 -- (-500.270) (-499.160) [-497.737] (-501.298) * (-499.198) [-497.216] (-498.656) (-499.204) -- 0:00:11
807000 -- (-501.291) [-503.379] (-498.890) (-499.004) * (-497.248) (-497.174) [-498.147] (-499.180) -- 0:00:11
807500 -- (-499.086) (-503.844) [-500.559] (-498.082) * [-497.529] (-497.482) (-497.971) (-498.407) -- 0:00:11
808000 -- [-501.795] (-505.627) (-500.505) (-498.406) * (-497.276) (-501.751) [-499.322] (-498.058) -- 0:00:11
808500 -- (-501.644) (-501.416) [-498.086] (-497.411) * (-501.097) (-497.821) (-501.517) [-496.908] -- 0:00:11
809000 -- (-498.056) (-500.476) [-499.308] (-498.192) * [-498.609] (-498.826) (-499.268) (-500.984) -- 0:00:11
809500 -- (-503.865) [-499.781] (-502.037) (-500.893) * (-497.427) [-499.383] (-500.412) (-499.698) -- 0:00:11
810000 -- (-501.817) [-499.151] (-500.703) (-504.351) * (-500.292) (-500.534) [-502.412] (-500.481) -- 0:00:11
Average standard deviation of split frequencies: 0.008541
810500 -- [-500.388] (-503.008) (-502.943) (-499.300) * [-501.314] (-496.721) (-499.659) (-498.211) -- 0:00:11
811000 -- (-497.968) [-500.944] (-501.383) (-500.437) * (-497.302) (-501.465) (-501.577) [-500.132] -- 0:00:11
811500 -- (-497.616) (-499.854) [-499.769] (-497.610) * (-498.150) (-500.124) (-500.363) [-498.514] -- 0:00:11
812000 -- (-500.956) [-498.473] (-499.725) (-501.574) * [-498.909] (-497.681) (-499.005) (-500.168) -- 0:00:11
812500 -- [-499.583] (-500.245) (-500.118) (-500.557) * (-501.789) [-498.792] (-496.791) (-498.773) -- 0:00:11
813000 -- (-500.119) (-498.736) [-500.132] (-498.757) * (-501.508) (-497.593) (-497.570) [-501.891] -- 0:00:11
813500 -- (-497.121) (-497.674) (-503.752) [-498.838] * (-498.678) [-497.391] (-497.509) (-500.155) -- 0:00:11
814000 -- [-498.376] (-499.103) (-499.464) (-502.540) * (-498.212) (-497.867) (-499.957) [-498.179] -- 0:00:11
814500 -- [-498.124] (-497.485) (-498.221) (-497.130) * (-497.815) (-497.745) (-499.530) [-497.844] -- 0:00:11
815000 -- (-497.941) (-497.709) (-502.860) [-499.356] * (-501.614) (-498.116) [-500.008] (-499.352) -- 0:00:11
Average standard deviation of split frequencies: 0.008268
815500 -- (-497.918) [-497.396] (-503.510) (-498.789) * (-500.106) (-501.003) [-501.383] (-499.488) -- 0:00:11
816000 -- (-501.143) [-498.150] (-501.102) (-499.642) * [-499.138] (-497.910) (-499.137) (-501.100) -- 0:00:11
816500 -- (-498.793) [-498.130] (-498.785) (-497.795) * (-501.689) [-500.695] (-499.222) (-504.113) -- 0:00:11
817000 -- [-499.489] (-500.007) (-497.013) (-497.999) * (-498.915) [-499.151] (-501.172) (-500.785) -- 0:00:10
817500 -- [-499.112] (-497.377) (-501.733) (-498.864) * [-497.297] (-497.166) (-499.438) (-503.526) -- 0:00:10
818000 -- [-500.122] (-497.938) (-502.296) (-497.892) * [-498.324] (-502.253) (-503.132) (-500.620) -- 0:00:10
818500 -- (-499.779) [-498.603] (-504.055) (-499.989) * (-502.538) [-499.804] (-499.800) (-499.967) -- 0:00:10
819000 -- [-498.982] (-502.141) (-500.893) (-498.710) * (-499.925) (-499.072) (-497.509) [-498.402] -- 0:00:10
819500 -- (-500.203) [-498.181] (-501.282) (-497.734) * (-498.787) (-502.478) [-497.350] (-499.156) -- 0:00:10
820000 -- [-497.983] (-498.701) (-497.551) (-499.180) * (-502.074) [-501.860] (-497.379) (-499.223) -- 0:00:10
Average standard deviation of split frequencies: 0.008185
820500 -- [-500.887] (-498.482) (-497.558) (-499.379) * (-498.571) [-498.252] (-502.585) (-502.037) -- 0:00:10
821000 -- [-499.313] (-499.157) (-503.315) (-500.891) * (-499.738) [-497.547] (-501.381) (-499.981) -- 0:00:10
821500 -- [-499.806] (-497.716) (-498.781) (-497.930) * (-497.400) [-497.533] (-499.016) (-501.421) -- 0:00:10
822000 -- [-499.093] (-500.129) (-499.287) (-499.701) * (-498.524) (-498.545) (-500.953) [-498.934] -- 0:00:10
822500 -- (-500.043) (-498.159) [-499.464] (-499.633) * (-499.357) (-504.477) [-498.341] (-499.174) -- 0:00:10
823000 -- [-499.586] (-497.378) (-502.175) (-503.496) * (-501.899) (-502.260) (-499.978) [-499.518] -- 0:00:10
823500 -- (-497.813) (-500.045) [-499.506] (-497.630) * (-502.585) (-499.757) [-498.461] (-500.936) -- 0:00:10
824000 -- (-498.382) (-499.181) [-504.088] (-501.137) * (-500.992) (-500.861) (-498.470) [-498.997] -- 0:00:10
824500 -- (-500.686) (-497.468) [-497.335] (-498.843) * (-497.536) (-501.386) [-498.032] (-498.454) -- 0:00:10
825000 -- [-498.511] (-497.970) (-503.610) (-499.029) * (-497.458) (-498.467) [-497.201] (-498.456) -- 0:00:10
Average standard deviation of split frequencies: 0.008527
825500 -- (-498.960) (-502.520) [-497.916] (-499.744) * (-499.530) (-498.582) (-497.689) [-499.494] -- 0:00:10
826000 -- (-499.096) (-498.616) (-497.890) [-499.378] * (-499.892) [-498.960] (-496.970) (-501.259) -- 0:00:10
826500 -- (-502.394) [-502.940] (-501.276) (-498.622) * (-501.648) (-499.584) [-502.043] (-501.331) -- 0:00:10
827000 -- (-499.727) (-500.524) [-499.974] (-501.508) * (-497.070) (-497.280) (-498.430) [-499.458] -- 0:00:10
827500 -- (-498.627) (-502.028) [-503.566] (-499.846) * (-497.450) (-500.074) [-498.416] (-502.072) -- 0:00:10
828000 -- (-498.234) (-499.221) (-500.267) [-497.970] * (-499.658) (-496.799) (-499.819) [-499.586] -- 0:00:10
828500 -- [-498.957] (-498.060) (-500.776) (-499.106) * (-498.023) (-500.767) [-499.398] (-497.654) -- 0:00:10
829000 -- (-498.837) (-498.121) (-497.324) [-498.219] * (-499.268) (-504.838) (-497.333) [-498.636] -- 0:00:10
829500 -- (-498.388) (-500.368) (-499.032) [-497.680] * [-497.108] (-500.149) (-499.186) (-498.413) -- 0:00:10
830000 -- (-499.059) (-499.382) [-497.990] (-498.839) * [-497.426] (-498.333) (-497.002) (-498.717) -- 0:00:10
Average standard deviation of split frequencies: 0.007264
830500 -- (-501.096) (-499.880) [-499.612] (-497.500) * (-498.819) (-500.090) (-498.255) [-497.294] -- 0:00:10
831000 -- (-501.265) (-502.743) [-497.952] (-498.426) * [-498.763] (-500.401) (-497.383) (-499.553) -- 0:00:10
831500 -- [-498.603] (-500.174) (-506.935) (-500.824) * (-498.763) [-498.489] (-500.217) (-499.105) -- 0:00:10
832000 -- (-501.537) [-497.549] (-501.219) (-500.746) * (-502.812) (-498.782) [-500.336] (-505.926) -- 0:00:10
832500 -- (-499.306) (-498.146) (-500.179) [-498.457] * (-502.559) [-497.857] (-499.307) (-500.021) -- 0:00:10
833000 -- (-498.697) (-500.084) [-497.819] (-499.787) * (-498.180) (-502.761) [-499.844] (-502.710) -- 0:00:10
833500 -- [-500.848] (-499.975) (-499.422) (-501.256) * (-499.060) (-500.454) (-498.266) [-497.451] -- 0:00:09
834000 -- (-497.852) (-499.215) [-497.402] (-498.163) * [-499.269] (-498.714) (-497.900) (-498.675) -- 0:00:09
834500 -- (-500.510) (-499.358) [-497.449] (-498.688) * (-498.722) (-497.480) (-500.364) [-502.703] -- 0:00:09
835000 -- (-499.772) [-499.293] (-498.378) (-500.562) * [-500.360] (-502.819) (-498.458) (-504.909) -- 0:00:09
Average standard deviation of split frequencies: 0.007556
835500 -- (-498.818) [-498.019] (-497.863) (-499.324) * [-499.962] (-498.939) (-499.496) (-500.906) -- 0:00:09
836000 -- (-498.295) [-498.022] (-498.657) (-499.854) * (-498.687) (-497.238) (-498.162) [-499.633] -- 0:00:09
836500 -- (-501.654) [-499.191] (-497.920) (-498.597) * (-496.972) (-499.070) (-501.716) [-497.312] -- 0:00:09
837000 -- [-500.322] (-499.024) (-498.584) (-499.525) * [-498.581] (-502.355) (-497.717) (-497.066) -- 0:00:09
837500 -- (-500.948) (-502.058) (-504.996) [-498.943] * [-502.128] (-497.835) (-498.534) (-498.237) -- 0:00:09
838000 -- (-499.590) (-501.687) [-503.695] (-501.678) * (-501.827) [-497.668] (-497.662) (-496.793) -- 0:00:09
838500 -- (-497.672) [-499.653] (-499.286) (-502.329) * (-497.246) [-498.247] (-497.435) (-497.812) -- 0:00:09
839000 -- (-503.460) (-500.057) [-501.762] (-500.350) * (-500.775) (-504.583) [-500.076] (-501.180) -- 0:00:09
839500 -- [-497.886] (-498.570) (-499.201) (-499.823) * (-501.425) (-501.581) [-497.132] (-499.667) -- 0:00:09
840000 -- (-498.530) [-499.129] (-502.589) (-504.501) * (-500.749) (-499.036) (-499.394) [-498.883] -- 0:00:09
Average standard deviation of split frequencies: 0.007589
840500 -- (-497.824) (-501.179) [-497.155] (-497.546) * [-500.867] (-500.601) (-497.342) (-498.217) -- 0:00:09
841000 -- (-500.334) (-497.321) (-498.770) [-497.949] * (-498.663) [-499.759] (-501.845) (-498.014) -- 0:00:09
841500 -- (-502.938) [-500.114] (-496.936) (-500.635) * (-500.101) (-499.298) (-500.533) [-500.457] -- 0:00:09
842000 -- (-499.981) (-499.652) (-498.763) [-499.123] * [-497.960] (-498.121) (-498.962) (-498.922) -- 0:00:09
842500 -- [-499.623] (-499.012) (-498.621) (-496.995) * [-498.955] (-498.675) (-499.449) (-499.180) -- 0:00:09
843000 -- (-497.660) (-498.107) (-499.740) [-498.475] * [-497.585] (-499.429) (-498.719) (-499.136) -- 0:00:09
843500 -- [-499.154] (-500.667) (-501.751) (-499.430) * [-497.437] (-499.379) (-498.203) (-500.480) -- 0:00:09
844000 -- (-498.069) [-497.885] (-500.030) (-500.213) * [-497.840] (-498.729) (-498.086) (-497.760) -- 0:00:09
844500 -- (-498.971) (-500.560) (-500.941) [-504.142] * (-499.830) (-499.925) (-497.426) [-497.252] -- 0:00:09
845000 -- [-499.162] (-498.486) (-502.095) (-500.297) * (-498.244) [-500.023] (-499.116) (-498.862) -- 0:00:09
Average standard deviation of split frequencies: 0.007764
845500 -- (-499.964) (-496.857) (-499.633) [-497.911] * [-500.564] (-503.938) (-501.483) (-497.806) -- 0:00:09
846000 -- (-498.976) [-497.748] (-500.710) (-499.379) * (-499.223) (-502.860) (-498.192) [-500.427] -- 0:00:09
846500 -- (-499.129) [-500.629] (-504.548) (-499.082) * (-497.862) (-497.356) (-506.554) [-498.545] -- 0:00:09
847000 -- (-497.866) (-497.344) (-499.936) [-498.187] * (-498.529) [-499.242] (-500.358) (-497.790) -- 0:00:09
847500 -- (-498.766) (-498.204) (-497.544) [-497.983] * (-499.392) (-498.905) (-501.297) [-499.076] -- 0:00:09
848000 -- [-497.169] (-499.300) (-497.616) (-501.462) * [-500.875] (-497.546) (-498.509) (-500.224) -- 0:00:09
848500 -- (-497.403) [-498.812] (-498.467) (-499.174) * (-500.019) (-496.754) (-499.917) [-498.219] -- 0:00:09
849000 -- (-498.631) (-498.128) [-496.977] (-497.329) * [-498.320] (-499.494) (-500.973) (-499.196) -- 0:00:09
849500 -- (-501.105) [-498.808] (-501.136) (-499.808) * (-499.315) [-497.707] (-501.561) (-500.146) -- 0:00:09
850000 -- [-508.612] (-499.203) (-498.668) (-498.153) * (-499.204) [-498.087] (-498.391) (-501.105) -- 0:00:09
Average standard deviation of split frequencies: 0.007721
850500 -- (-500.547) [-498.623] (-498.823) (-503.587) * [-497.333] (-498.261) (-498.339) (-501.396) -- 0:00:08
851000 -- (-503.888) [-497.181] (-499.131) (-503.207) * (-497.850) (-501.501) [-497.547] (-499.510) -- 0:00:08
851500 -- (-504.370) (-497.803) [-498.763] (-500.891) * (-499.837) (-501.948) (-497.309) [-497.905] -- 0:00:08
852000 -- (-501.792) (-497.550) (-499.310) [-498.523] * (-500.396) [-499.357] (-497.166) (-501.701) -- 0:00:08
852500 -- (-498.717) [-497.565] (-500.011) (-497.517) * (-500.455) (-497.414) [-499.769] (-500.753) -- 0:00:08
853000 -- [-497.002] (-500.154) (-499.965) (-497.192) * (-497.055) [-499.215] (-499.723) (-499.836) -- 0:00:08
853500 -- (-497.594) (-503.376) [-499.352] (-498.083) * [-497.691] (-504.183) (-499.376) (-499.026) -- 0:00:08
854000 -- (-500.229) (-507.636) (-500.240) [-504.607] * (-497.074) (-501.667) [-497.127] (-502.471) -- 0:00:08
854500 -- (-503.495) (-498.023) [-501.637] (-498.812) * (-500.073) (-499.373) (-497.473) [-498.116] -- 0:00:08
855000 -- [-498.885] (-502.826) (-501.684) (-497.641) * (-499.754) (-500.423) [-497.251] (-498.749) -- 0:00:08
Average standard deviation of split frequencies: 0.008004
855500 -- [-498.062] (-498.405) (-497.520) (-498.274) * (-499.215) (-498.370) [-499.239] (-500.799) -- 0:00:08
856000 -- [-498.689] (-501.993) (-496.685) (-501.556) * (-499.154) [-500.657] (-499.725) (-497.909) -- 0:00:08
856500 -- (-498.919) (-498.268) [-498.548] (-499.403) * [-498.441] (-504.066) (-501.259) (-497.128) -- 0:00:08
857000 -- (-500.184) [-499.344] (-498.118) (-503.472) * [-499.182] (-500.129) (-498.037) (-499.394) -- 0:00:08
857500 -- (-499.480) (-498.459) [-497.832] (-497.192) * [-499.016] (-498.603) (-498.511) (-497.957) -- 0:00:08
858000 -- (-498.120) [-498.985] (-500.358) (-498.399) * (-502.650) [-501.336] (-497.801) (-498.682) -- 0:00:08
858500 -- (-497.991) (-497.451) [-497.645] (-502.542) * [-499.227] (-499.539) (-498.261) (-499.245) -- 0:00:08
859000 -- (-502.939) (-498.600) (-498.746) [-501.081] * (-497.643) [-500.947] (-497.879) (-500.461) -- 0:00:08
859500 -- [-499.435] (-498.782) (-499.289) (-504.564) * (-498.199) (-503.918) [-498.158] (-500.688) -- 0:00:08
860000 -- (-499.384) (-508.259) [-498.899] (-499.373) * (-499.330) [-499.387] (-497.721) (-500.343) -- 0:00:08
Average standard deviation of split frequencies: 0.007705
860500 -- (-498.893) [-497.781] (-501.435) (-497.686) * [-498.612] (-501.414) (-500.886) (-499.061) -- 0:00:08
861000 -- (-497.613) (-497.105) [-500.667] (-498.039) * [-501.157] (-504.136) (-498.463) (-498.895) -- 0:00:08
861500 -- [-498.033] (-499.863) (-500.898) (-500.041) * (-497.001) [-499.188] (-497.413) (-497.591) -- 0:00:08
862000 -- (-497.195) (-499.178) (-500.328) [-499.428] * (-496.895) [-499.208] (-497.223) (-498.443) -- 0:00:08
862500 -- (-499.344) (-497.561) (-499.823) [-500.099] * (-497.701) (-497.775) (-497.181) [-498.612] -- 0:00:08
863000 -- (-500.399) (-496.809) (-498.323) [-500.340] * (-498.691) (-498.218) (-499.330) [-497.160] -- 0:00:08
863500 -- (-497.338) (-497.671) [-499.564] (-498.128) * [-497.607] (-499.163) (-499.300) (-496.884) -- 0:00:08
864000 -- (-497.096) (-497.358) [-497.651] (-499.324) * (-501.037) (-501.528) [-501.084] (-497.644) -- 0:00:08
864500 -- [-499.227] (-498.618) (-505.033) (-498.831) * (-504.152) (-500.370) (-498.445) [-500.491] -- 0:00:08
865000 -- [-501.216] (-499.241) (-500.099) (-500.467) * (-497.809) (-498.968) [-498.291] (-504.288) -- 0:00:08
Average standard deviation of split frequencies: 0.008613
865500 -- (-498.041) (-501.456) (-498.098) [-501.939] * [-497.818] (-500.583) (-498.752) (-498.182) -- 0:00:08
866000 -- (-497.465) (-498.329) [-497.672] (-500.166) * (-497.929) (-499.302) (-500.601) [-501.166] -- 0:00:08
866500 -- (-499.615) [-501.080] (-499.922) (-501.932) * (-497.852) [-502.087] (-499.314) (-498.284) -- 0:00:08
867000 -- (-500.744) (-500.568) (-498.459) [-500.703] * (-504.227) (-497.438) [-498.911] (-502.680) -- 0:00:07
867500 -- [-497.159] (-498.393) (-498.910) (-497.937) * (-498.979) [-498.964] (-501.775) (-500.434) -- 0:00:07
868000 -- (-503.059) (-498.392) [-499.343] (-500.366) * (-500.496) (-498.438) (-499.099) [-498.618] -- 0:00:07
868500 -- (-498.983) (-498.146) [-497.247] (-500.016) * (-500.030) (-498.541) [-499.183] (-498.903) -- 0:00:07
869000 -- (-498.627) (-497.971) [-501.334] (-500.006) * [-499.101] (-499.507) (-500.189) (-499.943) -- 0:00:07
869500 -- (-499.737) (-497.948) [-501.046] (-499.277) * (-496.677) [-498.282] (-498.430) (-501.006) -- 0:00:07
870000 -- [-500.179] (-502.706) (-498.279) (-500.580) * (-499.668) (-498.225) [-497.266] (-497.211) -- 0:00:07
Average standard deviation of split frequencies: 0.008460
870500 -- [-497.545] (-497.951) (-499.080) (-497.736) * (-498.481) (-498.097) (-499.584) [-499.478] -- 0:00:07
871000 -- (-501.956) (-500.167) (-497.213) [-497.741] * (-505.527) (-505.241) (-497.869) [-497.369] -- 0:00:07
871500 -- (-504.087) (-498.848) [-498.701] (-498.639) * (-503.917) (-503.995) [-499.079] (-499.111) -- 0:00:07
872000 -- [-502.605] (-500.575) (-497.362) (-497.497) * (-500.831) (-500.002) (-500.208) [-499.954] -- 0:00:07
872500 -- (-499.466) [-498.673] (-498.435) (-501.164) * (-498.904) (-497.188) (-497.735) [-498.378] -- 0:00:07
873000 -- (-497.880) (-499.061) [-497.696] (-500.286) * [-497.173] (-496.911) (-496.792) (-498.062) -- 0:00:07
873500 -- (-498.573) [-497.784] (-499.187) (-497.006) * (-499.093) (-499.210) [-498.273] (-498.593) -- 0:00:07
874000 -- [-498.714] (-498.912) (-498.933) (-498.736) * [-498.940] (-497.684) (-499.374) (-500.389) -- 0:00:07
874500 -- (-497.291) [-497.590] (-498.662) (-496.982) * (-497.558) (-499.256) (-497.363) [-497.976] -- 0:00:07
875000 -- (-497.389) [-497.744] (-497.718) (-497.275) * [-498.530] (-498.356) (-506.652) (-502.230) -- 0:00:07
Average standard deviation of split frequencies: 0.008610
875500 -- [-497.148] (-498.684) (-498.499) (-497.410) * [-497.676] (-498.416) (-499.381) (-500.621) -- 0:00:07
876000 -- (-497.146) (-499.607) (-498.806) [-497.333] * (-500.233) [-502.703] (-498.854) (-502.974) -- 0:00:07
876500 -- (-497.307) (-503.176) (-500.374) [-498.060] * (-499.358) [-497.863] (-498.221) (-499.741) -- 0:00:07
877000 -- (-498.225) (-498.396) (-502.482) [-498.020] * (-498.879) (-499.850) (-497.233) [-500.110] -- 0:00:07
877500 -- (-502.305) [-498.848] (-497.573) (-497.845) * (-497.643) [-499.594] (-497.751) (-497.743) -- 0:00:07
878000 -- (-507.111) (-500.184) [-497.602] (-497.896) * (-498.334) (-498.874) [-500.764] (-496.956) -- 0:00:07
878500 -- (-505.830) [-497.146] (-499.207) (-498.421) * (-499.808) (-497.531) [-497.634] (-498.859) -- 0:00:07
879000 -- [-501.304] (-497.997) (-498.423) (-497.719) * (-504.652) [-497.716] (-499.139) (-498.536) -- 0:00:07
879500 -- (-499.977) [-500.627] (-500.233) (-500.575) * (-500.361) [-499.642] (-499.755) (-501.325) -- 0:00:07
880000 -- (-498.753) [-500.158] (-501.957) (-497.812) * (-498.947) [-500.262] (-497.618) (-497.994) -- 0:00:07
Average standard deviation of split frequencies: 0.008464
880500 -- (-498.511) [-497.232] (-499.358) (-498.859) * (-498.097) (-498.792) (-498.456) [-498.683] -- 0:00:07
881000 -- (-498.762) [-498.873] (-497.868) (-497.991) * (-499.189) (-502.046) (-501.798) [-499.235] -- 0:00:07
881500 -- [-498.006] (-499.456) (-500.519) (-499.792) * (-499.657) (-498.064) (-497.968) [-497.304] -- 0:00:07
882000 -- [-498.145] (-499.610) (-500.523) (-513.346) * (-498.998) (-498.743) [-499.373] (-497.247) -- 0:00:07
882500 -- [-499.559] (-501.911) (-498.687) (-505.727) * (-501.583) [-498.811] (-498.515) (-498.561) -- 0:00:07
883000 -- (-502.467) (-501.056) (-499.436) [-504.846] * (-497.763) (-499.029) [-500.009] (-500.131) -- 0:00:07
883500 -- (-501.992) [-505.553] (-498.159) (-500.730) * (-499.335) [-499.083] (-499.750) (-502.966) -- 0:00:06
884000 -- (-504.851) [-499.043] (-498.124) (-498.659) * (-498.357) (-498.713) [-500.299] (-505.806) -- 0:00:06
884500 -- (-503.016) (-498.467) (-500.088) [-497.934] * (-497.117) (-498.558) [-498.559] (-504.942) -- 0:00:06
885000 -- (-504.551) (-498.485) [-498.303] (-500.981) * (-499.346) [-500.564] (-501.344) (-499.763) -- 0:00:06
Average standard deviation of split frequencies: 0.008513
885500 -- (-499.151) (-498.430) [-498.128] (-503.745) * (-499.056) [-499.632] (-500.155) (-498.461) -- 0:00:06
886000 -- (-498.836) (-498.276) [-500.503] (-497.755) * [-498.756] (-500.829) (-501.624) (-497.900) -- 0:00:06
886500 -- [-498.695] (-498.612) (-498.420) (-499.984) * (-497.715) [-497.176] (-501.136) (-498.612) -- 0:00:06
887000 -- (-498.921) (-498.547) [-498.448] (-500.198) * [-498.881] (-501.808) (-499.338) (-501.370) -- 0:00:06
887500 -- [-498.010] (-501.718) (-500.325) (-497.715) * (-498.253) (-497.184) [-498.226] (-500.502) -- 0:00:06
888000 -- [-500.749] (-503.268) (-501.446) (-500.987) * (-502.248) [-499.684] (-500.421) (-498.885) -- 0:00:06
888500 -- (-499.758) (-499.005) [-499.694] (-500.631) * (-498.158) (-502.481) (-502.577) [-500.300] -- 0:00:06
889000 -- (-499.227) (-499.611) [-499.923] (-502.364) * (-497.791) [-498.923] (-497.759) (-498.813) -- 0:00:06
889500 -- (-499.138) [-497.542] (-501.069) (-497.333) * (-498.489) (-500.398) (-498.486) [-500.068] -- 0:00:06
890000 -- [-499.807] (-497.645) (-501.635) (-496.913) * (-499.711) [-500.959] (-499.096) (-502.323) -- 0:00:06
Average standard deviation of split frequencies: 0.008237
890500 -- (-499.549) [-498.653] (-497.237) (-498.653) * [-499.592] (-501.595) (-498.223) (-501.008) -- 0:00:06
891000 -- [-498.091] (-497.642) (-499.859) (-497.633) * (-499.106) (-498.506) [-497.647] (-498.707) -- 0:00:06
891500 -- (-499.083) (-498.295) (-499.851) [-498.269] * (-501.807) (-498.771) (-502.326) [-498.397] -- 0:00:06
892000 -- (-498.674) (-499.634) (-497.949) [-500.883] * [-498.961] (-503.451) (-497.983) (-499.412) -- 0:00:06
892500 -- (-499.485) [-497.914] (-498.476) (-502.096) * (-500.984) (-500.956) [-500.832] (-500.632) -- 0:00:06
893000 -- [-498.567] (-498.397) (-498.474) (-497.599) * [-498.090] (-500.385) (-498.050) (-499.875) -- 0:00:06
893500 -- (-497.786) (-498.031) (-498.980) [-497.700] * [-497.389] (-500.546) (-497.742) (-500.821) -- 0:00:06
894000 -- (-497.766) (-498.574) [-499.214] (-499.687) * (-497.000) (-500.823) (-497.393) [-498.650] -- 0:00:06
894500 -- [-498.350] (-511.584) (-500.552) (-498.524) * (-499.196) (-499.731) (-497.102) [-498.218] -- 0:00:06
895000 -- (-499.439) (-502.281) [-497.498] (-498.241) * (-497.762) (-498.175) (-497.344) [-498.653] -- 0:00:06
Average standard deviation of split frequencies: 0.008056
895500 -- (-499.376) (-501.060) [-497.634] (-497.528) * [-498.471] (-499.252) (-502.124) (-500.961) -- 0:00:06
896000 -- (-498.719) (-500.111) (-500.558) [-498.251] * (-500.213) (-498.150) (-503.258) [-496.944] -- 0:00:06
896500 -- (-498.214) (-498.653) [-502.773] (-499.854) * [-501.433] (-502.203) (-498.978) (-497.494) -- 0:00:06
897000 -- (-500.860) (-498.041) (-497.555) [-503.789] * [-501.381] (-501.219) (-500.865) (-497.435) -- 0:00:06
897500 -- (-500.000) [-499.523] (-497.884) (-504.655) * (-499.719) (-497.547) (-499.564) [-499.651] -- 0:00:06
898000 -- (-500.022) (-505.081) (-500.302) [-501.138] * [-498.612] (-500.143) (-500.392) (-499.010) -- 0:00:06
898500 -- (-497.902) (-505.775) [-500.618] (-498.485) * (-500.488) (-498.899) [-501.061] (-498.686) -- 0:00:06
899000 -- (-498.607) (-499.768) [-500.186] (-497.090) * (-500.706) (-498.352) [-497.407] (-497.308) -- 0:00:06
899500 -- (-498.154) (-499.356) [-500.020] (-497.387) * (-498.364) (-498.913) [-496.932] (-499.680) -- 0:00:06
900000 -- (-499.607) (-498.411) (-501.330) [-499.816] * (-498.216) [-499.310] (-497.817) (-500.608) -- 0:00:06
Average standard deviation of split frequencies: 0.007884
900500 -- (-501.124) [-497.302] (-503.607) (-498.723) * [-499.810] (-498.231) (-503.541) (-500.915) -- 0:00:05
901000 -- (-498.353) (-497.908) (-497.280) [-499.462] * (-500.271) (-499.184) (-505.277) [-498.759] -- 0:00:05
901500 -- [-497.463] (-497.216) (-498.447) (-501.666) * (-500.426) (-501.642) (-497.459) [-502.952] -- 0:00:05
902000 -- [-497.199] (-498.106) (-497.685) (-499.165) * (-500.211) (-498.006) [-499.159] (-498.920) -- 0:00:05
902500 -- (-498.524) (-499.408) (-499.622) [-499.159] * (-497.630) (-500.178) (-499.190) [-499.694] -- 0:00:05
903000 -- (-501.130) [-497.239] (-499.149) (-498.554) * (-499.427) (-499.260) [-496.851] (-497.459) -- 0:00:05
903500 -- (-499.955) (-498.315) (-502.999) [-498.988] * (-497.978) [-498.610] (-505.282) (-502.173) -- 0:00:05
904000 -- (-499.436) (-497.793) [-497.599] (-498.941) * (-502.712) (-499.117) [-497.915] (-498.713) -- 0:00:05
904500 -- (-499.288) (-499.233) (-496.876) [-498.845] * (-499.422) (-499.252) [-497.986] (-500.054) -- 0:00:05
905000 -- (-498.680) (-499.661) (-498.204) [-498.460] * (-499.108) (-499.317) [-499.364] (-500.791) -- 0:00:05
Average standard deviation of split frequencies: 0.008417
905500 -- (-498.221) [-498.047] (-496.970) (-500.676) * (-497.300) [-498.953] (-500.547) (-498.763) -- 0:00:05
906000 -- (-498.334) (-497.565) (-497.597) [-498.940] * (-499.096) (-499.738) (-501.979) [-498.479] -- 0:00:05
906500 -- (-500.508) (-498.510) (-500.349) [-497.912] * [-500.346] (-498.292) (-502.550) (-498.519) -- 0:00:05
907000 -- (-501.361) (-498.125) [-498.495] (-498.176) * (-499.028) (-499.200) [-499.205] (-500.550) -- 0:00:05
907500 -- (-500.163) (-498.405) [-497.440] (-500.187) * (-497.089) (-501.748) [-498.186] (-498.535) -- 0:00:05
908000 -- [-499.117] (-497.765) (-499.156) (-500.069) * [-498.063] (-501.409) (-499.178) (-499.005) -- 0:00:05
908500 -- (-497.539) (-502.006) (-500.051) [-499.059] * (-497.500) (-499.894) (-502.324) [-499.794] -- 0:00:05
909000 -- (-501.682) (-497.651) [-500.381] (-499.551) * (-499.788) (-500.029) (-502.997) [-498.542] -- 0:00:05
909500 -- (-500.182) (-500.416) (-498.677) [-497.530] * (-499.238) [-499.619] (-500.385) (-498.534) -- 0:00:05
910000 -- (-496.833) (-499.965) [-500.440] (-498.136) * (-503.221) (-499.549) [-497.772] (-502.318) -- 0:00:05
Average standard deviation of split frequencies: 0.007765
910500 -- (-501.526) (-500.889) (-503.482) [-498.434] * (-501.156) [-498.174] (-501.602) (-497.267) -- 0:00:05
911000 -- (-499.616) [-498.232] (-499.712) (-499.405) * (-500.274) [-499.670] (-499.720) (-500.197) -- 0:00:05
911500 -- [-498.752] (-500.330) (-497.193) (-499.164) * (-500.129) [-503.211] (-501.715) (-504.138) -- 0:00:05
912000 -- (-498.514) (-498.151) [-498.394] (-497.737) * (-498.193) (-499.555) (-499.779) [-499.183] -- 0:00:05
912500 -- (-497.341) (-498.026) (-499.970) [-497.778] * (-497.323) [-499.774] (-502.878) (-500.157) -- 0:00:05
913000 -- (-499.505) (-501.513) (-499.475) [-497.995] * (-502.105) [-498.693] (-503.226) (-497.930) -- 0:00:05
913500 -- (-499.290) (-502.370) (-501.963) [-497.028] * [-499.781] (-501.809) (-498.254) (-498.370) -- 0:00:05
914000 -- [-500.985] (-499.260) (-498.556) (-501.087) * [-500.079] (-497.625) (-499.511) (-499.181) -- 0:00:05
914500 -- (-498.293) (-497.770) (-500.771) [-498.624] * (-498.891) [-500.797] (-499.910) (-497.367) -- 0:00:05
915000 -- [-497.009] (-499.365) (-503.230) (-499.443) * (-500.446) (-498.437) (-502.393) [-498.925] -- 0:00:05
Average standard deviation of split frequencies: 0.008174
915500 -- (-498.489) [-498.840] (-497.628) (-502.476) * (-499.245) (-498.106) (-500.842) [-499.794] -- 0:00:05
916000 -- [-498.903] (-502.965) (-502.139) (-498.113) * (-500.375) (-498.925) (-497.727) [-498.796] -- 0:00:05
916500 -- (-497.508) [-498.012] (-499.999) (-502.393) * [-498.047] (-499.443) (-499.442) (-501.397) -- 0:00:05
917000 -- (-497.704) (-499.682) [-499.491] (-499.033) * (-498.665) (-498.163) (-499.200) [-500.061] -- 0:00:04
917500 -- (-498.652) (-499.834) (-498.736) [-497.819] * (-497.157) (-498.175) [-497.509] (-497.399) -- 0:00:04
918000 -- [-500.495] (-500.431) (-498.129) (-501.738) * (-499.912) [-498.573] (-498.909) (-499.369) -- 0:00:04
918500 -- (-497.989) [-498.248] (-498.077) (-506.870) * (-500.015) (-501.330) (-497.221) [-498.036] -- 0:00:04
919000 -- [-502.602] (-498.680) (-497.430) (-503.791) * [-499.772] (-499.333) (-499.304) (-498.619) -- 0:00:04
919500 -- (-497.964) (-499.848) [-502.484] (-499.319) * (-497.189) [-497.466] (-498.285) (-500.328) -- 0:00:04
920000 -- [-498.643] (-497.252) (-498.203) (-498.706) * (-498.478) (-500.923) [-498.525] (-500.388) -- 0:00:04
Average standard deviation of split frequencies: 0.007648
920500 -- [-499.410] (-498.161) (-498.113) (-499.304) * (-499.139) (-501.904) (-499.195) [-496.727] -- 0:00:04
921000 -- (-498.372) (-498.163) [-498.576] (-502.136) * (-497.883) (-498.371) (-500.152) [-499.357] -- 0:00:04
921500 -- (-498.195) (-497.167) [-497.532] (-502.882) * (-498.602) (-499.850) (-499.129) [-500.568] -- 0:00:04
922000 -- (-499.187) (-497.109) (-498.230) [-500.785] * (-499.996) (-505.557) (-498.396) [-501.885] -- 0:00:04
922500 -- (-498.307) [-497.038] (-500.910) (-498.897) * (-501.227) (-499.434) [-497.157] (-497.222) -- 0:00:04
923000 -- (-499.203) (-500.866) (-499.896) [-500.071] * (-501.557) [-499.539] (-497.072) (-499.159) -- 0:00:04
923500 -- (-502.128) (-498.779) [-499.007] (-497.210) * (-498.634) (-499.303) (-500.954) [-498.764] -- 0:00:04
924000 -- [-500.461] (-499.685) (-498.264) (-497.977) * [-505.353] (-498.304) (-504.226) (-498.787) -- 0:00:04
924500 -- (-500.280) (-501.239) (-498.598) [-500.869] * [-499.827] (-498.137) (-502.178) (-502.264) -- 0:00:04
925000 -- (-499.035) (-503.297) (-499.179) [-498.319] * (-499.613) (-498.643) [-499.174] (-509.684) -- 0:00:04
Average standard deviation of split frequencies: 0.008683
925500 -- (-501.603) (-498.288) [-497.276] (-499.014) * [-502.287] (-497.637) (-501.274) (-502.991) -- 0:00:04
926000 -- [-498.080] (-498.528) (-501.451) (-497.463) * (-500.407) (-498.556) (-498.175) [-501.583] -- 0:00:04
926500 -- (-502.686) (-500.197) (-498.753) [-500.382] * (-498.552) (-497.860) [-497.814] (-501.052) -- 0:00:04
927000 -- (-501.682) [-498.336] (-498.752) (-497.070) * (-500.074) (-498.617) (-498.236) [-499.850] -- 0:00:04
927500 -- (-498.368) (-498.261) (-497.025) [-499.287] * (-497.821) (-500.976) [-499.607] (-500.589) -- 0:00:04
928000 -- (-500.001) (-498.502) [-497.056] (-499.127) * (-499.995) (-497.663) [-499.654] (-502.524) -- 0:00:04
928500 -- (-500.504) (-499.394) (-497.422) [-499.917] * [-497.948] (-498.331) (-499.372) (-502.236) -- 0:00:04
929000 -- (-500.524) (-499.140) [-504.124] (-499.549) * (-497.955) (-501.146) (-502.116) [-501.427] -- 0:00:04
929500 -- (-503.272) [-498.223] (-505.164) (-499.130) * [-497.716] (-502.379) (-500.332) (-501.657) -- 0:00:04
930000 -- (-506.300) (-498.052) [-497.592] (-501.654) * (-497.108) (-498.276) [-498.225] (-498.132) -- 0:00:04
Average standard deviation of split frequencies: 0.008075
930500 -- [-502.580] (-498.685) (-499.794) (-497.607) * (-498.235) (-497.723) (-500.490) [-498.169] -- 0:00:04
931000 -- (-497.953) (-500.674) [-497.801] (-497.327) * (-500.282) [-500.605] (-502.196) (-499.690) -- 0:00:04
931500 -- (-498.461) [-499.004] (-498.253) (-500.052) * (-497.330) (-500.850) [-500.687] (-498.815) -- 0:00:04
932000 -- [-497.358] (-497.251) (-498.417) (-498.960) * (-500.191) [-497.817] (-506.847) (-500.972) -- 0:00:04
932500 -- (-499.622) [-500.578] (-500.287) (-501.214) * (-497.082) (-498.253) [-500.212] (-499.648) -- 0:00:04
933000 -- [-498.042] (-499.650) (-498.906) (-499.599) * (-497.606) (-498.353) [-501.856] (-498.462) -- 0:00:04
933500 -- (-497.836) (-499.065) [-498.711] (-498.681) * (-498.027) (-498.436) (-499.455) [-497.534] -- 0:00:03
934000 -- [-497.354] (-499.284) (-500.012) (-500.023) * (-500.270) (-499.998) [-498.040] (-500.359) -- 0:00:03
934500 -- (-502.071) (-504.072) (-500.472) [-498.785] * (-501.940) (-497.322) (-498.855) [-504.122] -- 0:00:03
935000 -- (-501.817) [-502.024] (-498.262) (-499.316) * [-499.299] (-499.249) (-500.962) (-499.164) -- 0:00:03
Average standard deviation of split frequencies: 0.008310
935500 -- (-501.037) [-499.117] (-498.963) (-502.053) * (-496.943) (-501.831) [-497.900] (-498.490) -- 0:00:03
936000 -- (-498.671) [-499.915] (-500.912) (-504.069) * [-497.978] (-498.436) (-503.598) (-500.759) -- 0:00:03
936500 -- [-504.175] (-502.539) (-500.848) (-501.719) * (-497.690) (-500.166) [-498.514] (-498.060) -- 0:00:03
937000 -- (-497.710) (-498.810) (-500.022) [-497.593] * (-498.898) (-499.613) [-499.937] (-500.691) -- 0:00:03
937500 -- (-500.985) (-500.308) [-498.076] (-498.252) * (-497.923) (-499.873) (-500.781) [-501.367] -- 0:00:03
938000 -- (-497.723) [-499.444] (-498.433) (-500.647) * [-498.720] (-500.438) (-497.309) (-499.496) -- 0:00:03
938500 -- [-497.278] (-499.097) (-502.160) (-500.671) * (-499.985) [-498.583] (-499.077) (-505.762) -- 0:00:03
939000 -- (-498.814) (-498.145) [-500.502] (-501.970) * (-497.844) (-499.782) (-500.026) [-498.739] -- 0:00:03
939500 -- [-498.624] (-500.814) (-500.693) (-497.543) * (-497.797) [-498.493] (-501.254) (-500.052) -- 0:00:03
940000 -- (-500.910) (-498.764) [-497.823] (-496.889) * (-498.138) (-504.298) [-497.941] (-505.078) -- 0:00:03
Average standard deviation of split frequencies: 0.007454
940500 -- (-497.378) [-499.135] (-498.329) (-499.166) * (-501.005) (-502.499) [-497.082] (-500.697) -- 0:00:03
941000 -- (-497.945) (-496.842) [-499.743] (-499.712) * (-499.363) (-497.055) (-497.071) [-500.037] -- 0:00:03
941500 -- [-497.556] (-501.087) (-498.496) (-498.615) * [-498.787] (-498.325) (-499.658) (-497.206) -- 0:00:03
942000 -- [-501.219] (-500.974) (-499.425) (-496.797) * [-499.429] (-499.722) (-499.356) (-497.739) -- 0:00:03
942500 -- [-498.057] (-498.572) (-497.184) (-497.467) * (-498.313) (-497.203) [-500.473] (-501.060) -- 0:00:03
943000 -- (-498.250) (-498.887) (-497.244) [-498.548] * [-499.612] (-498.338) (-502.292) (-498.853) -- 0:00:03
943500 -- [-497.301] (-498.651) (-499.586) (-498.184) * (-501.761) (-497.926) (-499.961) [-500.580] -- 0:00:03
944000 -- (-497.913) [-498.264] (-496.773) (-498.106) * (-500.376) (-497.202) [-498.436] (-499.520) -- 0:00:03
944500 -- (-500.014) (-501.169) [-497.992] (-501.068) * [-498.161] (-499.950) (-498.821) (-499.105) -- 0:00:03
945000 -- (-499.755) (-498.785) [-498.836] (-499.605) * (-498.517) (-501.058) [-498.645] (-498.389) -- 0:00:03
Average standard deviation of split frequencies: 0.008610
945500 -- [-499.409] (-504.603) (-502.065) (-500.345) * (-501.428) (-501.310) (-498.035) [-502.570] -- 0:00:03
946000 -- (-499.899) (-498.386) [-501.854] (-501.111) * (-499.002) [-499.895] (-498.582) (-498.439) -- 0:00:03
946500 -- (-498.342) (-501.345) (-500.382) [-497.295] * (-499.334) (-499.530) (-498.917) [-500.064] -- 0:00:03
947000 -- (-498.299) (-497.548) [-501.788] (-497.630) * (-498.416) [-499.309] (-498.614) (-497.506) -- 0:00:03
947500 -- (-499.972) (-498.347) (-500.527) [-497.942] * (-499.314) [-500.211] (-500.918) (-498.474) -- 0:00:03
948000 -- (-498.365) [-498.375] (-498.260) (-497.676) * [-498.066] (-500.886) (-500.357) (-499.079) -- 0:00:03
948500 -- [-502.270] (-497.701) (-503.452) (-502.037) * (-501.892) [-498.345] (-501.108) (-499.140) -- 0:00:03
949000 -- [-499.053] (-500.582) (-498.525) (-502.368) * (-499.065) [-498.497] (-499.839) (-498.137) -- 0:00:03
949500 -- (-497.722) (-499.913) [-499.855] (-501.190) * (-497.992) [-498.435] (-499.484) (-497.022) -- 0:00:03
950000 -- (-498.969) (-501.196) (-499.714) [-498.928] * (-503.041) [-501.058] (-499.433) (-497.663) -- 0:00:03
Average standard deviation of split frequencies: 0.007905
950500 -- (-498.481) [-499.411] (-500.462) (-500.263) * (-502.095) [-499.770] (-499.966) (-498.675) -- 0:00:02
951000 -- [-497.581] (-501.308) (-498.983) (-502.395) * (-500.423) [-498.174] (-501.024) (-498.186) -- 0:00:02
951500 -- (-500.794) [-499.558] (-499.077) (-498.212) * (-499.365) (-498.250) (-498.675) [-502.938] -- 0:00:02
952000 -- (-497.053) [-497.023] (-498.819) (-498.115) * [-502.760] (-500.050) (-498.784) (-499.274) -- 0:00:02
952500 -- (-496.869) [-498.564] (-503.323) (-498.090) * (-499.862) (-501.356) [-500.260] (-501.554) -- 0:00:02
953000 -- (-497.272) [-501.411] (-499.724) (-501.832) * (-500.728) (-501.965) (-498.058) [-499.543] -- 0:00:02
953500 -- (-499.489) [-498.846] (-498.233) (-499.667) * (-497.618) (-498.848) (-498.089) [-497.384] -- 0:00:02
954000 -- (-501.518) [-499.914] (-497.514) (-498.375) * [-497.029] (-501.551) (-500.408) (-499.499) -- 0:00:02
954500 -- [-500.778] (-502.052) (-499.479) (-499.025) * (-497.631) [-499.812] (-499.927) (-497.240) -- 0:00:02
955000 -- (-499.742) (-500.085) [-499.682] (-501.022) * (-500.633) [-498.767] (-501.700) (-499.654) -- 0:00:02
Average standard deviation of split frequencies: 0.008093
955500 -- (-502.792) [-500.501] (-498.325) (-501.156) * (-501.515) (-499.073) [-497.254] (-499.154) -- 0:00:02
956000 -- (-499.894) [-500.504] (-498.664) (-498.247) * (-498.350) (-500.372) (-498.408) [-497.163] -- 0:00:02
956500 -- (-499.238) (-500.843) (-497.663) [-499.086] * (-504.314) (-500.328) (-500.828) [-497.075] -- 0:00:02
957000 -- (-499.696) (-498.798) [-497.648] (-503.570) * (-499.173) (-503.143) (-498.238) [-497.919] -- 0:00:02
957500 -- (-497.603) [-499.097] (-498.578) (-498.227) * (-499.188) (-498.105) (-498.636) [-499.489] -- 0:00:02
958000 -- (-499.657) [-502.542] (-498.530) (-497.976) * (-501.490) [-499.590] (-498.023) (-500.225) -- 0:00:02
958500 -- (-499.256) [-497.271] (-503.887) (-498.393) * (-499.652) (-499.421) (-500.146) [-499.197] -- 0:00:02
959000 -- (-498.257) (-497.686) [-504.947] (-502.523) * (-498.981) [-500.484] (-501.363) (-498.569) -- 0:00:02
959500 -- (-497.767) (-498.478) [-497.956] (-497.037) * (-498.881) [-501.552] (-501.129) (-499.152) -- 0:00:02
960000 -- (-500.581) (-499.001) [-497.662] (-497.558) * (-499.200) [-498.364] (-503.037) (-497.052) -- 0:00:02
Average standard deviation of split frequencies: 0.007909
960500 -- [-499.992] (-501.989) (-497.388) (-500.015) * [-498.744] (-499.988) (-499.411) (-500.036) -- 0:00:02
961000 -- (-499.236) (-501.287) [-500.376] (-500.736) * (-498.621) (-500.112) (-501.302) [-500.155] -- 0:00:02
961500 -- (-497.617) (-499.412) (-499.767) [-497.909] * (-498.793) (-499.302) [-499.381] (-501.843) -- 0:00:02
962000 -- (-499.175) [-500.046] (-500.862) (-501.957) * (-499.869) (-502.374) [-499.341] (-500.651) -- 0:00:02
962500 -- (-497.307) (-499.069) (-497.300) [-498.158] * (-499.149) (-501.338) [-498.482] (-497.653) -- 0:00:02
963000 -- (-497.683) (-500.253) [-497.818] (-497.813) * [-499.234] (-498.481) (-499.135) (-497.469) -- 0:00:02
963500 -- (-501.450) [-499.478] (-498.075) (-496.955) * [-497.407] (-500.947) (-498.978) (-496.881) -- 0:00:02
964000 -- (-500.114) [-497.831] (-497.230) (-496.963) * (-501.130) [-498.397] (-498.504) (-497.524) -- 0:00:02
964500 -- (-497.052) [-496.952] (-496.762) (-497.126) * (-498.136) (-497.886) [-497.427] (-498.480) -- 0:00:02
965000 -- (-501.477) [-499.515] (-497.901) (-500.082) * (-499.941) [-497.656] (-496.981) (-499.396) -- 0:00:02
Average standard deviation of split frequencies: 0.007198
965500 -- [-498.349] (-502.202) (-497.695) (-498.959) * (-498.445) (-499.811) [-502.424] (-497.401) -- 0:00:02
966000 -- [-497.932] (-499.475) (-499.515) (-498.582) * (-499.661) (-497.525) [-497.281] (-498.908) -- 0:00:02
966500 -- (-499.143) [-497.662] (-499.291) (-500.151) * (-497.640) (-497.751) [-500.229] (-498.734) -- 0:00:02
967000 -- (-499.698) (-497.042) (-499.122) [-497.848] * (-503.082) [-498.648] (-499.768) (-501.165) -- 0:00:01
967500 -- (-499.687) (-498.691) [-497.169] (-500.354) * (-502.963) [-497.369] (-498.960) (-500.239) -- 0:00:01
968000 -- (-499.405) (-502.630) (-501.913) [-498.138] * [-504.714] (-498.667) (-497.418) (-497.461) -- 0:00:01
968500 -- (-499.298) (-498.020) (-497.239) [-497.582] * (-503.185) (-501.751) [-497.878] (-497.423) -- 0:00:01
969000 -- [-501.197] (-498.658) (-499.938) (-497.919) * (-505.387) [-499.930] (-500.258) (-500.334) -- 0:00:01
969500 -- (-499.378) (-499.110) (-499.660) [-499.337] * (-500.085) (-501.203) (-497.981) [-497.775] -- 0:00:01
970000 -- (-499.357) (-497.490) [-500.610] (-499.367) * (-499.365) [-498.272] (-498.613) (-498.086) -- 0:00:01
Average standard deviation of split frequencies: 0.007254
970500 -- (-499.342) [-497.982] (-498.754) (-498.705) * (-499.274) (-500.944) [-497.120] (-499.805) -- 0:00:01
971000 -- (-497.261) [-498.420] (-501.594) (-498.674) * (-499.209) (-503.177) (-500.410) [-498.612] -- 0:00:01
971500 -- (-499.383) (-499.025) (-497.488) [-497.873] * (-496.892) [-499.695] (-501.042) (-498.911) -- 0:00:01
972000 -- (-501.837) [-499.574] (-497.891) (-498.546) * (-497.251) [-498.107] (-502.821) (-501.563) -- 0:00:01
972500 -- (-500.738) (-499.432) [-498.694] (-504.755) * (-498.854) (-499.507) [-499.870] (-497.691) -- 0:00:01
973000 -- [-502.406] (-501.168) (-497.167) (-501.243) * [-497.523] (-498.998) (-499.562) (-502.213) -- 0:00:01
973500 -- (-501.500) [-498.175] (-500.973) (-499.565) * (-499.207) (-497.955) [-498.937] (-498.979) -- 0:00:01
974000 -- (-498.368) [-497.979] (-497.764) (-501.368) * (-497.563) (-500.069) (-497.831) [-497.755] -- 0:00:01
974500 -- (-502.294) (-499.033) [-500.837] (-499.537) * [-499.612] (-500.103) (-500.436) (-501.932) -- 0:00:01
975000 -- [-497.522] (-501.088) (-499.532) (-501.829) * (-499.500) (-504.363) [-499.492] (-503.284) -- 0:00:01
Average standard deviation of split frequencies: 0.007003
975500 -- (-497.743) (-497.849) [-501.062] (-499.308) * (-499.690) (-500.410) [-497.709] (-499.717) -- 0:00:01
976000 -- [-498.110] (-499.008) (-499.110) (-497.951) * (-497.423) [-501.394] (-498.851) (-500.251) -- 0:00:01
976500 -- (-497.674) [-500.531] (-499.890) (-497.716) * (-500.533) (-497.759) (-498.936) [-497.694] -- 0:00:01
977000 -- [-499.010] (-501.383) (-500.745) (-497.546) * (-499.295) [-500.694] (-501.367) (-500.642) -- 0:00:01
977500 -- (-499.087) [-500.893] (-502.267) (-500.334) * (-500.975) (-499.890) [-500.605] (-499.502) -- 0:00:01
978000 -- (-499.698) (-498.464) [-497.332] (-502.434) * (-503.097) (-501.318) [-503.293] (-498.077) -- 0:00:01
978500 -- [-496.916] (-497.670) (-498.062) (-500.103) * (-500.115) [-497.211] (-501.669) (-500.656) -- 0:00:01
979000 -- (-497.461) [-500.021] (-497.385) (-498.429) * (-504.336) (-497.558) (-499.263) [-499.640] -- 0:00:01
979500 -- (-498.172) (-499.669) [-497.994] (-499.353) * (-497.176) (-497.221) [-501.543] (-501.036) -- 0:00:01
980000 -- [-497.956] (-505.087) (-499.055) (-501.669) * (-498.649) (-499.648) [-498.751] (-502.923) -- 0:00:01
Average standard deviation of split frequencies: 0.007030
980500 -- (-499.624) (-501.459) [-500.017] (-498.063) * (-498.561) [-500.315] (-500.901) (-499.207) -- 0:00:01
981000 -- (-497.817) [-500.490] (-499.259) (-499.592) * (-497.678) (-498.746) (-499.925) [-500.341] -- 0:00:01
981500 -- (-497.824) [-499.847] (-499.240) (-497.691) * (-497.743) [-497.827] (-497.598) (-502.767) -- 0:00:01
982000 -- (-497.992) (-505.521) [-500.400] (-497.448) * [-497.601] (-501.567) (-497.474) (-500.177) -- 0:00:01
982500 -- (-497.902) (-499.519) (-499.063) [-497.657] * (-497.042) [-498.926] (-497.512) (-497.190) -- 0:00:01
983000 -- (-499.425) (-501.190) (-504.316) [-502.319] * [-499.320] (-503.802) (-497.875) (-502.745) -- 0:00:01
983500 -- (-500.410) [-498.914] (-501.409) (-497.874) * (-498.802) (-498.318) (-501.464) [-499.072] -- 0:00:00
984000 -- [-501.370] (-498.766) (-499.713) (-497.570) * (-497.998) (-497.534) (-501.575) [-497.629] -- 0:00:00
984500 -- (-497.962) [-497.269] (-500.424) (-499.502) * (-498.591) (-500.438) (-498.346) [-502.996] -- 0:00:00
985000 -- (-501.047) (-500.292) (-502.180) [-499.824] * (-499.401) (-499.522) [-497.153] (-504.102) -- 0:00:00
Average standard deviation of split frequencies: 0.006903
985500 -- [-501.906] (-501.762) (-499.928) (-500.791) * (-500.374) (-498.939) [-497.249] (-503.038) -- 0:00:00
986000 -- [-498.693] (-499.388) (-505.717) (-500.673) * [-502.799] (-498.278) (-497.796) (-497.539) -- 0:00:00
986500 -- (-498.060) [-499.358] (-500.510) (-498.265) * (-497.544) [-500.053] (-498.575) (-499.189) -- 0:00:00
987000 -- (-497.634) (-500.398) [-498.753] (-498.331) * (-497.795) (-498.359) (-503.078) [-499.138] -- 0:00:00
987500 -- (-497.129) (-502.421) (-498.601) [-499.386] * (-500.325) (-500.418) (-498.959) [-497.659] -- 0:00:00
988000 -- (-497.589) (-497.842) (-500.923) [-497.968] * (-501.852) [-497.941] (-497.743) (-498.979) -- 0:00:00
988500 -- [-498.264] (-501.373) (-498.988) (-499.637) * (-501.790) (-498.558) [-498.020] (-497.115) -- 0:00:00
989000 -- (-499.917) [-499.475] (-500.544) (-500.982) * (-498.885) (-502.499) (-497.285) [-498.752] -- 0:00:00
989500 -- (-505.298) (-498.960) [-499.603] (-500.333) * (-499.710) (-498.759) (-498.248) [-498.482] -- 0:00:00
990000 -- (-499.351) [-498.866] (-498.056) (-497.476) * (-497.282) [-497.498] (-500.957) (-497.847) -- 0:00:00
Average standard deviation of split frequencies: 0.006692
990500 -- (-499.673) [-502.173] (-498.059) (-499.361) * (-501.894) [-497.614] (-500.295) (-500.392) -- 0:00:00
991000 -- (-498.906) (-499.733) (-498.827) [-498.858] * [-497.889] (-497.914) (-499.334) (-498.177) -- 0:00:00
991500 -- (-499.916) [-501.172] (-498.266) (-498.857) * (-500.255) (-499.627) (-497.546) [-501.165] -- 0:00:00
992000 -- (-499.045) [-500.098] (-498.435) (-499.316) * [-498.400] (-499.916) (-500.865) (-500.623) -- 0:00:00
992500 -- (-497.807) [-500.231] (-498.473) (-501.257) * [-497.604] (-497.241) (-497.833) (-505.385) -- 0:00:00
993000 -- [-498.349] (-498.550) (-497.616) (-498.962) * [-498.325] (-497.843) (-499.276) (-501.439) -- 0:00:00
993500 -- (-497.700) (-497.082) (-498.191) [-497.707] * (-497.448) (-500.024) (-498.173) [-499.674] -- 0:00:00
994000 -- (-500.216) (-497.808) (-497.759) [-503.253] * [-498.245] (-499.613) (-497.021) (-499.032) -- 0:00:00
994500 -- (-498.192) (-497.874) [-500.003] (-501.892) * (-501.064) [-497.745] (-497.698) (-498.583) -- 0:00:00
995000 -- (-499.985) (-497.811) [-498.916] (-497.375) * (-497.700) [-501.368] (-500.240) (-500.665) -- 0:00:00
Average standard deviation of split frequencies: 0.006184
995500 -- (-503.686) [-500.335] (-500.765) (-498.110) * (-499.988) (-500.158) (-497.679) [-498.781] -- 0:00:00
996000 -- [-502.481] (-498.970) (-500.936) (-498.321) * (-498.719) [-497.872] (-497.532) (-498.516) -- 0:00:00
996500 -- (-497.510) [-500.508] (-498.431) (-498.901) * (-498.584) (-502.189) (-499.900) [-501.517] -- 0:00:00
997000 -- (-501.835) (-498.421) [-498.079] (-498.154) * [-499.804] (-501.489) (-499.968) (-498.111) -- 0:00:00
997500 -- (-500.545) (-499.405) [-498.294] (-499.729) * [-497.966] (-497.980) (-500.849) (-497.761) -- 0:00:00
998000 -- [-498.070] (-497.476) (-498.991) (-498.535) * (-502.160) [-499.854] (-500.938) (-497.840) -- 0:00:00
998500 -- (-504.123) (-500.785) [-498.346] (-497.061) * [-499.137] (-501.902) (-504.029) (-498.470) -- 0:00:00
999000 -- (-500.612) [-498.895] (-497.106) (-503.228) * [-499.727] (-499.200) (-500.386) (-498.053) -- 0:00:00
999500 -- (-499.102) (-499.193) (-497.198) [-499.108] * [-498.252] (-503.463) (-500.736) (-499.546) -- 0:00:00
1000000 -- (-498.637) (-500.898) (-498.728) [-497.458] * (-498.894) (-498.508) (-498.118) [-500.888] -- 0:00:00
Average standard deviation of split frequencies: 0.006375
Analysis completed in 60 seconds
Analysis used 58.68 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -496.61
Likelihood of best state for "cold" chain of run 2 was -496.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 62 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.5 % ( 27 %) Dirichlet(Pi{all})
35.6 % ( 28 %) Slider(Pi{all})
77.9 % ( 56 %) Multiplier(Alpha{1,2})
77.0 % ( 52 %) Multiplier(Alpha{3})
26.1 % ( 38 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 80 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.2 % ( 31 %) Dirichlet(Pi{all})
36.1 % ( 25 %) Slider(Pi{all})
78.9 % ( 51 %) Multiplier(Alpha{1,2})
77.6 % ( 46 %) Multiplier(Alpha{3})
25.6 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166377 0.82 0.67
3 | 167290 166767 0.84
4 | 166627 166560 166379
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166739 0.82 0.67
3 | 166557 166522 0.84
4 | 166730 166978 166474
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -498.43
| 2 1 2 1 |
| 2 1 2 1 |
| 1 1 1 1 |
| * 2 1 |
| 2 1 1 2 2 1 2 1 2 2 2 2 2|
| 2 1 1 2 2 1 2 22 2 2 21 2 |
| 1 22 * 1 * 1 1 1 22 2 1 |
| 2 2 1 1 2 1 1 * 1 |
| 2 1 2 1 2 1 1 11 2 12 |
|1 21 2 221 2 21 1 2 2 1 |
| 1 *121 2 2 1 1 1|
| 11 1 22 2 1 2 |
|2 |
| 1 1 22 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -499.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.34 -503.24
2 -498.32 -501.93
--------------------------------------
TOTAL -498.33 -502.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888159 0.091511 0.360387 1.507989 0.846695 1250.57 1375.78 1.000
r(A<->C){all} 0.158117 0.019518 0.000036 0.430564 0.119452 159.46 181.65 1.000
r(A<->G){all} 0.160248 0.018713 0.000084 0.434343 0.124168 178.59 289.32 1.001
r(A<->T){all} 0.167585 0.019467 0.000106 0.438838 0.131672 207.47 226.47 1.001
r(C<->G){all} 0.171949 0.020159 0.000015 0.469343 0.133989 353.35 354.18 1.000
r(C<->T){all} 0.178545 0.021979 0.000511 0.474935 0.138798 135.05 138.28 1.008
r(G<->T){all} 0.163556 0.019291 0.000054 0.443488 0.125110 188.51 212.18 1.009
pi(A){all} 0.174719 0.000373 0.137815 0.214599 0.174025 1282.00 1290.20 1.001
pi(C){all} 0.297434 0.000557 0.251474 0.345225 0.298029 1255.92 1316.84 1.000
pi(G){all} 0.268970 0.000540 0.224531 0.315153 0.268440 1303.54 1380.83 1.000
pi(T){all} 0.258877 0.000527 0.216353 0.306348 0.258117 1325.35 1340.74 1.000
alpha{1,2} 0.400447 0.225700 0.000204 1.349713 0.230246 1292.43 1381.88 1.001
alpha{3} 0.455155 0.232612 0.000259 1.418819 0.299917 1129.68 1156.68 1.000
pinvar{all} 0.995459 0.000032 0.985288 0.999992 0.997331 1250.63 1265.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- ....**
9 -- ...*.*
10 -- .*..*.
11 -- .**.**
12 -- .*.*..
13 -- ...**.
14 -- ..****
15 -- .**...
16 -- ..*..*
17 -- .***.*
18 -- .****.
19 -- .*...*
20 -- ..**..
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.008480 0.145903 0.157895 2
8 448 0.149234 0.004711 0.145903 0.152565 2
9 445 0.148235 0.014604 0.137908 0.158561 2
10 445 0.148235 0.003298 0.145903 0.150566 2
11 443 0.147568 0.008951 0.141239 0.153897 2
12 441 0.146902 0.003298 0.144570 0.149234 2
13 436 0.145237 0.011306 0.137242 0.153231 2
14 431 0.143571 0.000471 0.143238 0.143904 2
15 427 0.142239 0.000471 0.141905 0.142572 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 419 0.139574 0.012719 0.130580 0.148568 2
18 417 0.138907 0.004240 0.135909 0.141905 2
19 416 0.138574 0.002827 0.136576 0.140573 2
20 407 0.135576 0.009893 0.128581 0.142572 2
21 403 0.134244 0.008951 0.127915 0.140573 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102167 0.010263 0.000018 0.294280 0.072346 1.000 2
length{all}[2] 0.098388 0.008803 0.000006 0.292760 0.069954 1.001 2
length{all}[3] 0.095701 0.008943 0.000032 0.281641 0.064988 1.000 2
length{all}[4] 0.097938 0.009449 0.000184 0.290599 0.067862 1.002 2
length{all}[5] 0.099051 0.009358 0.000000 0.297852 0.069525 1.000 2
length{all}[6] 0.100284 0.010433 0.000009 0.306236 0.068263 1.000 2
length{all}[7] 0.102230 0.011509 0.000468 0.316108 0.068499 1.011 2
length{all}[8] 0.095010 0.011232 0.000318 0.289820 0.061864 0.998 2
length{all}[9] 0.101479 0.011496 0.000636 0.349473 0.062968 0.998 2
length{all}[10] 0.103920 0.011846 0.000225 0.316838 0.069778 0.998 2
length{all}[11] 0.100292 0.009688 0.000058 0.268960 0.074382 0.999 2
length{all}[12] 0.103676 0.011421 0.000151 0.313882 0.067018 1.003 2
length{all}[13] 0.094670 0.009792 0.000372 0.280644 0.066588 1.000 2
length{all}[14] 0.101355 0.011690 0.000746 0.324486 0.067657 1.004 2
length{all}[15] 0.097884 0.012551 0.000137 0.282331 0.064883 1.005 2
length{all}[16] 0.092956 0.007969 0.000214 0.267816 0.066983 0.999 2
length{all}[17] 0.086626 0.007125 0.000297 0.235592 0.059661 0.999 2
length{all}[18] 0.094287 0.009861 0.000377 0.286416 0.062719 0.999 2
length{all}[19] 0.096409 0.008943 0.000042 0.289904 0.072022 1.000 2
length{all}[20] 0.101592 0.011810 0.000061 0.322167 0.069091 1.003 2
length{all}[21] 0.101874 0.012620 0.000694 0.333662 0.063284 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006375
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 363
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 121 / 121 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 121 / 121 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069157 0.049059 0.084679 0.022829 0.014625 0.039437 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -515.834202
Iterating by ming2
Initial: fx= 515.834202
x= 0.06916 0.04906 0.08468 0.02283 0.01462 0.03944 0.30000 1.30000
1 h-m-p 0.0000 0.0001 289.5902 ++ 505.507727 m 0.0001 13 | 1/8
2 h-m-p 0.0013 0.0172 24.2613 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 264.7362 ++ 500.660767 m 0.0001 44 | 2/8
4 h-m-p 0.0008 0.0233 19.5143 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 236.8123 ++ 492.781310 m 0.0001 75 | 3/8
6 h-m-p 0.0019 0.0331 15.2807 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 205.4276 ++ 489.342362 m 0.0001 107 | 4/8
8 h-m-p 0.0012 0.0537 11.2317 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 167.7395 +++ 484.531601 m 0.0002 139 | 5/8
10 h-m-p 0.0027 0.1006 7.3955 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 118.8663 ++ 482.661465 m 0.0001 171 | 6/8
12 h-m-p 0.3323 8.0000 0.0000 +++ 482.661465 m 8.0000 183 | 6/8
13 h-m-p 0.1336 8.0000 0.0001 +++ 482.661465 m 8.0000 197 | 6/8
14 h-m-p 0.0160 8.0000 1.7412 ++Y 482.661465 0 0.5805 212 | 6/8
15 h-m-p 1.6000 8.0000 0.0136 ++ 482.661465 m 8.0000 223 | 6/8
16 h-m-p 0.4510 8.0000 0.2408 --------Y 482.661465 0 0.0000 244 | 6/8
17 h-m-p 0.0583 8.0000 0.0000 ---N 482.661465 0 0.0002 260 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 ----------C 482.661465 0 0.0000 283
Out..
lnL = -482.661465
284 lfun, 284 eigenQcodon, 1704 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105780 0.036096 0.109713 0.089654 0.063843 0.018156 1.128923 0.557283 0.207119
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.544114
np = 9
lnL0 = -530.656849
Iterating by ming2
Initial: fx= 530.656849
x= 0.10578 0.03610 0.10971 0.08965 0.06384 0.01816 1.12892 0.55728 0.20712
1 h-m-p 0.0000 0.0002 264.6069 +++ 518.855324 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0004 183.1727 ++ 508.617107 m 0.0004 27 | 2/9
3 h-m-p 0.0001 0.0003 252.0040 ++ 496.940742 m 0.0003 39 | 3/9
4 h-m-p 0.0002 0.0008 130.8790 ++ 489.095301 m 0.0008 51 | 4/9
5 h-m-p 0.0021 0.0106 14.0819 ------------.. | 4/9
6 h-m-p 0.0000 0.0000 200.5794 ++ 487.468098 m 0.0000 85 | 5/9
7 h-m-p 0.0009 0.0529 6.9941 -----------.. | 5/9
8 h-m-p 0.0000 0.0002 164.8386 ++ 483.192126 m 0.0002 118 | 6/9
9 h-m-p 0.0067 0.1417 2.7050 ------------.. | 6/9
10 h-m-p 0.0000 0.0000 119.2153 ++ 482.661476 m 0.0000 152 | 7/9
11 h-m-p 0.0686 8.0000 0.0000 ++++ 482.661476 m 8.0000 166 | 6/9
12 h-m-p 0.0636 8.0000 0.0002 --------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 482.661476 m 8.0000 210 | 6/9
14 h-m-p 0.0068 3.3918 0.2237 +++++ 482.661468 m 3.3918 228 | 7/9
15 h-m-p 1.6000 8.0000 0.0030 ++ 482.661468 m 8.0000 243 | 7/9
16 h-m-p 0.0190 0.4867 1.2652 +++ 482.661467 m 0.4867 258 | 8/9
17 h-m-p 0.5666 4.0556 0.3646 ---------Y 482.661467 0 0.0000 279 | 8/9
18 h-m-p 1.6000 8.0000 0.0000 ---------------N 482.661467 0 0.0000 307
Out..
lnL = -482.661467
308 lfun, 924 eigenQcodon, 3696 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036446 0.014709 0.088812 0.096501 0.025763 0.052294 1.478735 1.779030 0.420735 0.383993 1.907512
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.781960
np = 11
lnL0 = -518.557997
Iterating by ming2
Initial: fx= 518.557997
x= 0.03645 0.01471 0.08881 0.09650 0.02576 0.05229 1.47873 1.77903 0.42074 0.38399 1.90751
1 h-m-p 0.0000 0.0001 269.0693 ++ 508.831445 m 0.0001 16 | 1/11
2 h-m-p 0.0002 0.0008 102.2434 ++ 502.190643 m 0.0008 30 | 2/11
3 h-m-p 0.0000 0.0001 296.0590 ++ 497.705886 m 0.0001 44 | 3/11
4 h-m-p 0.0001 0.0003 289.6064 ++ 492.423013 m 0.0003 58 | 4/11
5 h-m-p 0.0000 0.0001 1841.0605 ++ 483.706457 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0001 595.2074 ++ 483.010275 m 0.0001 86 | 6/11
7 h-m-p 0.0070 0.8164 1.6453 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 119.0944 ++ 482.661473 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 482.661473 m 8.0000 142 | 6/11
10 h-m-p -0.0000 -0.0000 0.0009
h-m-p: -9.68691737e-14 -4.84345869e-13 9.01358667e-04 482.661473
.. | 6/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 482.661473 m 8.0000 179 | 6/11
12 h-m-p 0.0085 4.2300 0.2722 +++++ 482.661467 m 4.2300 201 | 7/11
13 h-m-p 1.6000 8.0000 0.0269 ++ 482.661467 m 8.0000 220 | 7/11
14 h-m-p 0.1899 8.0000 1.1333 +Y 482.661466 0 0.7597 239 | 7/11
15 h-m-p 0.0670 8.0000 12.8521 C 482.661466 0 0.0214 253 | 7/11
16 h-m-p 1.6000 8.0000 0.0926 Y 482.661466 0 0.2060 267 | 7/11
17 h-m-p 1.6000 8.0000 0.0003 N 482.661466 0 0.4000 285 | 7/11
18 h-m-p 0.3759 8.0000 0.0004 +++ 482.661466 m 8.0000 304 | 7/11
19 h-m-p 1.0028 8.0000 0.0029 +Y 482.661466 0 4.8874 323 | 7/11
20 h-m-p 1.6000 8.0000 0.0058 -------C 482.661466 0 0.0000 348 | 7/11
21 h-m-p 0.0631 8.0000 0.0000 --------------.. | 7/11
22 h-m-p 0.0160 8.0000 0.0000 ------------Y 482.661466 0 0.0000 408 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 ------------Y 482.661466 0 0.0000 438
Out..
lnL = -482.661466
439 lfun, 1756 eigenQcodon, 7902 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -482.663428 S = -482.659353 -0.001557
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:03
did 20 / 51 patterns 0:03
did 30 / 51 patterns 0:03
did 40 / 51 patterns 0:03
did 50 / 51 patterns 0:03
did 51 / 51 patterns 0:03
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058432 0.040374 0.010170 0.033805 0.100707 0.044898 2.512479 1.084396 1.328497
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.582114
np = 9
lnL0 = -516.296044
Iterating by ming2
Initial: fx= 516.296044
x= 0.05843 0.04037 0.01017 0.03381 0.10071 0.04490 2.51248 1.08440 1.32850
1 h-m-p 0.0000 0.0001 280.1316 ++ 509.349470 m 0.0001 14 | 1/9
2 h-m-p 0.0013 0.0608 17.8692 -----------.. | 1/9
3 h-m-p 0.0000 0.0002 257.5870 +++ 495.646687 m 0.0002 48 | 2/9
4 h-m-p 0.0041 0.0951 11.5831 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 234.3952 ++ 492.551294 m 0.0001 82 | 3/9
6 h-m-p 0.0017 0.1752 6.6645 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 203.5687 ++ 490.947788 m 0.0000 116 | 4/9
8 h-m-p 0.0012 0.2362 5.2254 -----------.. | 4/9
9 h-m-p 0.0000 0.0001 166.1908 ++ 487.739995 m 0.0001 149 | 5/9
10 h-m-p 0.0036 0.3593 3.7683 ------------.. | 5/9
11 h-m-p 0.0000 0.0004 117.6556 +++ 482.661470 m 0.0004 184 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 482.661470 m 8.0000 196 | 6/9
13 h-m-p 0.0338 8.0000 0.0007 ++++ 482.661470 m 8.0000 213 | 6/9
14 h-m-p 0.0070 3.4979 0.9466 ++++
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
+ 482.661467 m 3.4979 231
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38888, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38862, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
15 h-m-p -0.0000 -0.0000 0.0631
h-m-p: -8.47086848e-16 -4.23543424e-15 6.31277160e-02 482.661467
..
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38888, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38862, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
N 482.661467 0 0.0160 258
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38888, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38862, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 0.0001 0.0004 0.0000
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
Y 482.661467 0 0.0000 278
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -482.661467
279 lfun, 3069 eigenQcodon, 16740 P(t)
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38875, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108115 0.016751 0.025172 0.049614 0.094678 0.024479 5.260011 0.900000 0.569129 1.339108 1.658828
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.086459
np = 11
lnL0 = -518.350755
Iterating by ming2
Initial: fx= 518.350755
x= 0.10812 0.01675 0.02517 0.04961 0.09468 0.02448 5.26001 0.90000 0.56913 1.33911 1.65883
1 h-m-p 0.0000 0.0002 260.8157 ++ 507.619688 m 0.0002 16 | 1/11
2 h-m-p 0.0001 0.0005 109.0369 ++ 503.098603 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 145.0991 ++ 502.774867 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0031 65.4189 ++++ 493.755125 m 0.0031 60 | 4/11
5 h-m-p 0.0000 0.0001 3493.2126 ++ 483.994333 m 0.0001 74 | 5/11
6 h-m-p 0.0011 0.0057 71.7486 ++ 482.860881 m 0.0057 88 | 6/11
7 h-m-p 0.0058 0.0292 29.2024 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 119.1007 ++ 482.661467 m 0.0000 126 | 7/11
9 h-m-p 0.0393 8.0000 0.0000 +Y 482.661467 0 0.1573 141 | 7/11
10 h-m-p 0.2824 8.0000 0.0000 --C 482.661467 0 0.0049 161
Out..
lnL = -482.661467
162 lfun, 1944 eigenQcodon, 10692 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -482.665000 S = -482.659458 -0.002428
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:11
did 20 / 51 patterns 0:11
did 30 / 51 patterns 0:11
did 40 / 51 patterns 0:12
did 50 / 51 patterns 0:12
did 51 / 51 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=121
NC_011896_1_WP_010908424_1_1696_MLBR_RS08030 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
NC_002677_1_NP_302103_1_975_ML1601 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN
**************************************************
NC_011896_1_WP_010908424_1_1696_MLBR_RS08030 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
NC_002677_1_NP_302103_1_975_ML1601 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995 PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG
**************************************************
NC_011896_1_WP_010908424_1_1696_MLBR_RS08030 RDDDLVTSVPPCGRASVVHRS
NC_002677_1_NP_302103_1_975_ML1601 RDDDLVTSVPPCGRASVVHRS
NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755 RDDDLVTSVPPCGRASVVHRS
NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350 RDDDLVTSVPPCGRASVVHRS
NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785 RDDDLVTSVPPCGRASVVHRS
NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995 RDDDLVTSVPPCGRASVVHRS
*********************
>NC_011896_1_WP_010908424_1_1696_MLBR_RS08030 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC >NC_002677_1_NP_302103_1_975_ML1601 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC >NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC >NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC >NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC >NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995 GTGGCACACCACAATGCGCATGCTGCTCCGGCGTTCCTTTGGTCCGGATT GGTCTCGGCAGCAGTCCTTATCGCTGACGGGCGTGGTGAGGATACATACT TACCGATCATATCGATCTACCTGGCTCGCGGAAACGAACTTAAGCCCAAT CCGCTCCTATCTGTTATCTATGTAGAACACTTGCTCGTCTTGTTCTACCA GTCGGTCGGCGATCATTGCGGATTCGGGCGTTACGACTTCGGCAAGACCA TGGTATTGGCCTGCTATGGATGCGTGGGCACCCGTTCGCTCTTATCAGGC CGCGACGACGATCTCGTCACTTCCGTACCACCGTGTGGCCGTGCCAGTGT GGTCCACCGGTCC
>NC_011896_1_WP_010908424_1_1696_MLBR_RS08030 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS >NC_002677_1_NP_302103_1_975_ML1601 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS >NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS >NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS >NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS >NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995 VAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPN PLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLACYGCVGTRSLLSG RDDDLVTSVPPCGRASVVHRS
#NEXUS
[ID: 5166904393]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908424_1_1696_MLBR_RS08030
NC_002677_1_NP_302103_1_975_ML1601
NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755
NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350
NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785
NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908424_1_1696_MLBR_RS08030,
2 NC_002677_1_NP_302103_1_975_ML1601,
3 NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755,
4 NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350,
5 NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785,
6 NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07234625,2:0.06995357,3:0.06498782,4:0.06786198,5:0.06952527,6:0.06826298);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07234625,2:0.06995357,3:0.06498782,4:0.06786198,5:0.06952527,6:0.06826298);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -498.34 -503.24
2 -498.32 -501.93
--------------------------------------
TOTAL -498.33 -502.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1601/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888159 0.091511 0.360387 1.507989 0.846695 1250.57 1375.78 1.000
r(A<->C){all} 0.158117 0.019518 0.000036 0.430564 0.119452 159.46 181.65 1.000
r(A<->G){all} 0.160248 0.018713 0.000084 0.434343 0.124168 178.59 289.32 1.001
r(A<->T){all} 0.167585 0.019467 0.000106 0.438838 0.131672 207.47 226.47 1.001
r(C<->G){all} 0.171949 0.020159 0.000015 0.469343 0.133989 353.35 354.18 1.000
r(C<->T){all} 0.178545 0.021979 0.000511 0.474935 0.138798 135.05 138.28 1.008
r(G<->T){all} 0.163556 0.019291 0.000054 0.443488 0.125110 188.51 212.18 1.009
pi(A){all} 0.174719 0.000373 0.137815 0.214599 0.174025 1282.00 1290.20 1.001
pi(C){all} 0.297434 0.000557 0.251474 0.345225 0.298029 1255.92 1316.84 1.000
pi(G){all} 0.268970 0.000540 0.224531 0.315153 0.268440 1303.54 1380.83 1.000
pi(T){all} 0.258877 0.000527 0.216353 0.306348 0.258117 1325.35 1340.74 1.000
alpha{1,2} 0.400447 0.225700 0.000204 1.349713 0.230246 1292.43 1381.88 1.001
alpha{3} 0.455155 0.232612 0.000259 1.418819 0.299917 1129.68 1156.68 1.000
pinvar{all} 0.995459 0.000032 0.985288 0.999992 0.997331 1250.63 1265.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1601/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 121
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 4 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 6 6 6 6 6 6 | GCC 2 2 2 2 2 2 | GAC 4 4 4 4 4 4 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 4 4 4 4 4 4
GTG 3 3 3 3 3 3 | GCG 2 2 2 2 2 2 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908424_1_1696_MLBR_RS08030
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
#2: NC_002677_1_NP_302103_1_975_ML1601
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
#3: NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
#4: NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
#5: NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
#6: NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 24 | TCC 18 | TAC 24 | TGC 18
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 24
CTC 24 | CCC 6 | CAC 24 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 6 | CCG 24 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 24 | ACC 12 | AAC 6 | AGC 0
ATA 6 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 18 | Gly G GGT 6
GTC 36 | GCC 12 | GAC 24 | GGC 30
GTA 18 | GCA 18 | Glu E GAA 12 | GGA 24
GTG 18 | GCG 12 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.24793 C:0.23967 A:0.13223 G:0.38017
position 2: T:0.31405 C:0.24793 A:0.23140 G:0.20661
position 3: T:0.21488 C:0.40496 A:0.15702 G:0.22314
Average T:0.25895 C:0.29752 A:0.17355 G:0.26997
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -482.661465 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.128923 1.658828
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908424_1_1696_MLBR_RS08030: 0.000004, NC_002677_1_NP_302103_1_975_ML1601: 0.000004, NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755: 0.000004, NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350: 0.000004, NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785: 0.000004, NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.12892
omega (dN/dS) = 1.65883
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
7..2 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
7..3 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
7..4 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
7..5 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
7..6 0.000 269.2 93.8 1.6588 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -482.661467 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.478735 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908424_1_1696_MLBR_RS08030: 0.000004, NC_002677_1_NP_302103_1_975_ML1601: 0.000004, NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755: 0.000004, NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350: 0.000004, NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785: 0.000004, NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.47873
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 266.1 96.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -482.661466 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 2.512479 0.301553 0.494035 1.000000 2.563434
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908424_1_1696_MLBR_RS08030: 0.000004, NC_002677_1_NP_302103_1_975_ML1601: 0.000004, NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755: 0.000004, NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350: 0.000004, NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785: 0.000004, NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.51248
MLEs of dN/dS (w) for site classes (K=3)
p: 0.30155 0.49404 0.20441
w: 1.00000 1.00000 2.56343
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
7..2 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
7..3 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
7..4 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
7..5 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
7..6 0.000 259.8 103.2 1.3196 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908424_1_1696_MLBR_RS08030)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908424_1_1696_MLBR_RS08030)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -482.661467 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 5.260011 2.388749 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908424_1_1696_MLBR_RS08030: 0.000004, NC_002677_1_NP_302103_1_975_ML1601: 0.000004, NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755: 0.000004, NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350: 0.000004, NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785: 0.000004, NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 5.26001
Parameters in M7 (beta):
p = 2.38875 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 251.7 111.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -482.661467 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 5.259121 0.422721 0.005000 1.509555 2.093154
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908424_1_1696_MLBR_RS08030: 0.000004, NC_002677_1_NP_302103_1_975_ML1601: 0.000004, NZ_LVXE01000006_1_WP_010908424_1_2320_A3216_RS03755: 0.000004, NZ_LYPH01000002_1_WP_010908424_1_289_A8144_RS01350: 0.000004, NZ_CP029543_1_WP_010908424_1_1727_DIJ64_RS08785: 0.000004, NZ_AP014567_1_WP_010908424_1_1769_JK2ML_RS08995: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 5.25912
Parameters in M8 (beta&w>1):
p0 = 0.42272 p = 0.00500 q = 1.50955
(p1 = 0.57728) w = 2.09315
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04227 0.04227 0.04227 0.04227 0.04227 0.04227 0.04227 0.04227 0.04227 0.04227 0.57728
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.09315
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
7..2 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
7..3 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
7..4 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
7..5 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
7..6 0.000 251.7 111.3 1.2083 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908424_1_1696_MLBR_RS08030)
Pr(w>1) post mean +- SE for w
1 V 0.577 1.208
2 A 0.577 1.208
3 H 0.577 1.208
4 H 0.577 1.208
5 N 0.577 1.208
6 A 0.577 1.208
7 H 0.577 1.208
8 A 0.577 1.208
9 A 0.577 1.208
10 P 0.577 1.208
11 A 0.577 1.208
12 F 0.577 1.208
13 L 0.577 1.208
14 W 0.577 1.208
15 S 0.577 1.208
16 G 0.577 1.208
17 L 0.577 1.208
18 V 0.577 1.208
19 S 0.577 1.208
20 A 0.577 1.208
21 A 0.577 1.208
22 V 0.577 1.208
23 L 0.577 1.208
24 I 0.577 1.208
25 A 0.577 1.208
26 D 0.577 1.208
27 G 0.577 1.208
28 R 0.577 1.208
29 G 0.577 1.208
30 E 0.577 1.208
31 D 0.577 1.208
32 T 0.577 1.208
33 Y 0.577 1.208
34 L 0.577 1.208
35 P 0.577 1.208
36 I 0.577 1.208
37 I 0.577 1.208
38 S 0.577 1.208
39 I 0.577 1.208
40 Y 0.577 1.208
41 L 0.577 1.208
42 A 0.577 1.208
43 R 0.577 1.208
44 G 0.577 1.208
45 N 0.577 1.208
46 E 0.577 1.208
47 L 0.577 1.208
48 K 0.577 1.208
49 P 0.577 1.208
50 N 0.577 1.208
51 P 0.577 1.208
52 L 0.577 1.208
53 L 0.577 1.208
54 S 0.577 1.208
55 V 0.577 1.208
56 I 0.577 1.208
57 Y 0.577 1.208
58 V 0.577 1.208
59 E 0.577 1.208
60 H 0.577 1.208
61 L 0.577 1.208
62 L 0.577 1.208
63 V 0.577 1.208
64 L 0.577 1.208
65 F 0.577 1.208
66 Y 0.577 1.208
67 Q 0.577 1.208
68 S 0.577 1.208
69 V 0.577 1.208
70 G 0.577 1.208
71 D 0.577 1.208
72 H 0.577 1.208
73 C 0.577 1.208
74 G 0.577 1.208
75 F 0.577 1.208
76 G 0.577 1.208
77 R 0.577 1.208
78 Y 0.577 1.208
79 D 0.577 1.208
80 F 0.577 1.208
81 G 0.577 1.208
82 K 0.577 1.208
83 T 0.577 1.208
84 M 0.577 1.208
85 V 0.577 1.208
86 L 0.577 1.208
87 A 0.577 1.208
88 C 0.577 1.208
89 Y 0.577 1.208
90 G 0.577 1.208
91 C 0.577 1.208
92 V 0.577 1.208
93 G 0.577 1.208
94 T 0.577 1.208
95 R 0.577 1.208
96 S 0.577 1.208
97 L 0.577 1.208
98 L 0.577 1.208
99 S 0.577 1.208
100 G 0.577 1.208
101 R 0.577 1.208
102 D 0.577 1.208
103 D 0.577 1.208
104 D 0.577 1.208
105 L 0.577 1.208
106 V 0.577 1.208
107 T 0.577 1.208
108 S 0.577 1.208
109 V 0.577 1.208
110 P 0.577 1.208
111 P 0.577 1.208
112 C 0.577 1.208
113 G 0.577 1.208
114 R 0.577 1.208
115 A 0.577 1.208
116 S 0.577 1.208
117 V 0.577 1.208
118 V 0.577 1.208
119 H 0.577 1.208
120 R 0.577 1.208
121 S 0.577 1.208
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908424_1_1696_MLBR_RS08030)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -482.661467 Model 2: PositiveSelection -482.661466 Model 0: one-ratio -482.661465 Model 7: beta -482.661467 Model 8: beta&w>1 -482.661467 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
