--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:03:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1603/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -356.62 -361.26
2 -356.57 -360.04
--------------------------------------
TOTAL -356.59 -360.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885228 0.085431 0.385187 1.493255 0.853211 1501.00 1501.00 1.000
r(A<->C){all} 0.158493 0.017841 0.000080 0.429489 0.123165 304.55 354.31 1.001
r(A<->G){all} 0.156002 0.018618 0.000197 0.439065 0.117447 206.07 274.71 1.000
r(A<->T){all} 0.174896 0.020630 0.000057 0.453689 0.138155 257.66 328.14 1.003
r(C<->G){all} 0.163653 0.019526 0.000071 0.444154 0.126869 255.62 276.75 1.000
r(C<->T){all} 0.182090 0.024222 0.000092 0.497435 0.138147 142.35 258.11 1.004
r(G<->T){all} 0.164867 0.020379 0.000017 0.448379 0.126474 172.98 237.65 1.000
pi(A){all} 0.189882 0.000599 0.141059 0.235792 0.188966 1134.43 1317.71 1.000
pi(C){all} 0.270857 0.000782 0.216007 0.323805 0.270466 1204.39 1273.18 1.000
pi(G){all} 0.283241 0.000775 0.227869 0.337128 0.283218 1218.91 1340.88 1.000
pi(T){all} 0.256020 0.000731 0.202441 0.306483 0.255007 1039.08 1230.79 1.000
alpha{1,2} 0.433022 0.243669 0.000231 1.438575 0.263115 1284.70 1365.96 1.002
alpha{3} 0.462530 0.249248 0.000167 1.472590 0.290537 1051.11 1276.06 1.000
pinvar{all} 0.993801 0.000056 0.980018 0.999998 0.996230 1401.35 1437.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -345.335855
Model 2: PositiveSelection -345.335831
Model 0: one-ratio -345.335829
Model 7: beta -345.335878
Model 8: beta&w>1 -345.335829
Model 0 vs 1 5.199999998239946E-5
Model 2 vs 1 4.799999999249849E-5
Model 8 vs 7 9.799999997994746E-5
>C1
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C2
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C3
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C4
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C5
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C6
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=86
C1 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C2 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C3 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C4 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C5 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C6 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
**************************************************
C1 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C2 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C3 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C4 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C5 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C6 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2580]--->[2580]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.608 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C2 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C3 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C4 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C5 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C6 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
**************************************************
C1 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C2 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C3 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C4 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C5 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C6 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C2 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C3 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C4 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C5 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C6 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
**************************************************
C1 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C2 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C3 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C4 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C5 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C6 CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
**************************************************
C1 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C2 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C3 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C4 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C5 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C6 TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
**************************************************
C1 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C2 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C3 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C4 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C5 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C6 AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
**************************************************
C1 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C2 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C3 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C4 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C5 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C6 TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
**************************************************
C1 CCGATGCC
C2 CCGATGCC
C3 CCGATGCC
C4 CCGATGCC
C5 CCGATGCC
C6 CCGATGCC
********
>C1
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C2
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C3
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C4
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C5
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C6
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C1
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C2
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C3
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C4
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C5
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C6
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 258 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856537
Setting output file names to "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 985944143
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5461784637
Seed = 1978711383
Swapseed = 1579856537
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -577.416368 -- -24.965149
Chain 2 -- -577.416334 -- -24.965149
Chain 3 -- -577.416334 -- -24.965149
Chain 4 -- -577.416280 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -577.416368 -- -24.965149
Chain 2 -- -577.416334 -- -24.965149
Chain 3 -- -577.416334 -- -24.965149
Chain 4 -- -577.416334 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-577.416] (-577.416) (-577.416) (-577.416) * [-577.416] (-577.416) (-577.416) (-577.416)
500 -- (-373.635) (-369.605) (-365.924) [-368.672] * (-368.449) (-363.316) [-360.510] (-363.688) -- 0:00:00
1000 -- (-369.156) (-362.414) (-372.479) [-363.967] * (-366.555) [-375.028] (-371.240) (-364.928) -- 0:00:00
1500 -- (-366.206) (-368.312) (-369.152) [-368.760] * [-369.979] (-377.857) (-366.889) (-364.285) -- 0:00:00
2000 -- (-367.270) [-369.534] (-367.687) (-363.707) * (-369.993) (-376.566) [-363.406] (-362.280) -- 0:00:00
2500 -- (-364.926) [-373.854] (-370.639) (-363.751) * (-361.419) (-375.879) [-366.596] (-366.142) -- 0:00:00
3000 -- (-368.192) (-375.389) (-369.524) [-363.430] * (-369.116) (-375.320) [-368.060] (-369.312) -- 0:00:00
3500 -- (-364.861) (-369.441) (-368.453) [-362.106] * [-371.638] (-365.785) (-363.638) (-378.668) -- 0:00:00
4000 -- [-365.306] (-365.371) (-372.251) (-369.857) * (-369.400) [-368.351] (-364.961) (-368.993) -- 0:00:00
4500 -- (-368.325) (-367.690) (-367.126) [-361.730] * (-369.419) [-366.996] (-366.461) (-369.849) -- 0:00:00
5000 -- (-368.679) [-368.179] (-367.657) (-387.318) * (-358.515) (-367.316) [-363.454] (-373.833) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- [-360.377] (-388.500) (-362.558) (-371.374) * (-364.068) (-365.265) (-367.335) [-362.694] -- 0:03:00
6000 -- (-366.085) (-377.974) (-371.919) [-373.214] * (-361.671) [-363.900] (-361.396) (-366.577) -- 0:02:45
6500 -- (-369.980) (-375.492) [-368.763] (-373.116) * (-372.047) [-362.340] (-362.123) (-366.094) -- 0:02:32
7000 -- (-368.097) [-367.865] (-375.351) (-361.137) * (-371.900) (-365.870) (-367.475) [-369.998] -- 0:02:21
7500 -- [-363.747] (-370.321) (-356.958) (-364.918) * (-361.526) (-376.193) (-363.495) [-372.371] -- 0:02:12
8000 -- (-371.176) (-370.351) (-358.420) [-362.185] * (-363.869) (-368.992) [-364.806] (-363.043) -- 0:02:04
8500 -- (-365.389) (-367.411) [-356.156] (-364.242) * (-364.918) [-360.761] (-369.582) (-364.533) -- 0:01:56
9000 -- [-363.501] (-384.601) (-357.303) (-370.658) * (-367.821) [-375.303] (-363.569) (-374.705) -- 0:01:50
9500 -- (-360.012) (-368.268) (-357.816) [-365.461] * (-374.154) (-364.378) [-365.396] (-363.686) -- 0:01:44
10000 -- (-367.312) (-371.109) [-359.288] (-365.965) * (-367.277) [-364.087] (-362.964) (-372.272) -- 0:01:39
Average standard deviation of split frequencies: 0.049393
10500 -- (-367.319) [-358.175] (-360.635) (-361.205) * (-374.481) (-371.385) [-366.538] (-370.472) -- 0:01:34
11000 -- (-367.748) [-356.698] (-359.355) (-363.329) * [-363.871] (-377.085) (-377.165) (-371.979) -- 0:01:29
11500 -- (-368.826) (-358.219) (-355.834) [-371.482] * (-365.093) (-369.817) (-367.585) [-363.477] -- 0:01:25
12000 -- (-365.694) (-356.834) (-355.098) [-366.913] * [-364.329] (-369.352) (-374.434) (-368.073) -- 0:01:22
12500 -- (-355.456) (-356.001) [-355.978] (-369.448) * [-364.922] (-378.489) (-371.981) (-371.091) -- 0:01:19
13000 -- [-356.146] (-357.992) (-357.792) (-366.643) * [-364.070] (-357.537) (-363.502) (-368.758) -- 0:01:15
13500 -- (-355.365) (-356.497) [-355.906] (-364.984) * [-361.035] (-359.619) (-371.997) (-363.019) -- 0:01:13
14000 -- (-356.823) (-358.518) (-356.310) [-357.957] * (-365.310) (-358.128) [-366.530] (-378.288) -- 0:01:10
14500 -- [-358.234] (-361.030) (-357.760) (-358.171) * (-362.974) [-358.627] (-382.257) (-379.302) -- 0:01:07
15000 -- (-355.932) (-357.418) (-357.225) [-356.034] * (-367.556) [-356.249] (-363.299) (-374.644) -- 0:01:05
Average standard deviation of split frequencies: 0.044896
15500 -- [-355.969] (-360.111) (-361.493) (-355.392) * [-364.982] (-356.658) (-357.901) (-363.678) -- 0:01:03
16000 -- (-355.960) [-359.629] (-357.529) (-356.907) * (-366.190) (-356.670) (-356.569) [-356.919] -- 0:01:01
16500 -- (-361.591) (-359.273) (-358.850) [-359.765] * (-370.628) (-357.657) (-360.755) [-355.725] -- 0:00:59
17000 -- (-358.627) (-357.454) (-357.750) [-358.134] * [-367.076] (-360.390) (-355.829) (-356.372) -- 0:00:57
17500 -- (-359.025) (-361.094) (-360.663) [-357.503] * [-366.098] (-357.389) (-357.056) (-355.427) -- 0:00:56
18000 -- (-356.796) (-356.579) (-358.097) [-358.991] * [-369.446] (-356.563) (-355.878) (-356.272) -- 0:00:54
18500 -- (-357.622) (-355.756) [-357.232] (-359.598) * [-361.861] (-356.584) (-360.214) (-361.252) -- 0:00:53
19000 -- (-359.104) (-359.531) (-359.408) [-357.177] * (-367.518) [-356.151] (-355.992) (-358.184) -- 0:00:51
19500 -- (-357.202) (-359.355) [-357.985] (-356.525) * [-368.857] (-357.348) (-357.485) (-360.278) -- 0:00:50
20000 -- (-357.521) [-356.502] (-357.593) (-356.448) * (-366.890) (-358.999) [-359.569] (-355.833) -- 0:00:49
Average standard deviation of split frequencies: 0.039284
20500 -- (-359.512) (-356.405) (-359.050) [-357.140] * (-367.806) [-358.252] (-356.984) (-357.241) -- 0:00:47
21000 -- (-358.239) (-359.217) (-358.008) [-357.773] * (-364.287) (-361.773) [-361.983] (-359.137) -- 0:00:46
21500 -- [-355.400] (-356.578) (-357.177) (-357.044) * [-368.166] (-359.207) (-356.496) (-359.076) -- 0:00:45
22000 -- [-357.263] (-359.826) (-359.102) (-356.680) * (-366.821) (-356.692) (-355.732) [-356.900] -- 0:00:44
22500 -- [-355.602] (-357.071) (-359.425) (-355.985) * (-372.088) [-356.447] (-356.010) (-355.900) -- 0:01:26
23000 -- (-356.455) (-356.208) (-356.846) [-357.969] * [-368.411] (-358.821) (-358.330) (-357.872) -- 0:01:24
23500 -- (-358.590) (-356.656) (-360.222) [-356.079] * (-365.616) (-358.228) (-355.622) [-358.822] -- 0:01:23
24000 -- (-357.494) (-356.593) (-357.457) [-356.263] * (-376.171) [-360.579] (-360.567) (-356.779) -- 0:01:21
24500 -- (-358.754) [-355.796] (-358.071) (-356.868) * (-374.208) (-360.255) (-360.777) [-355.360] -- 0:01:19
25000 -- (-356.104) (-359.221) [-357.330] (-355.351) * (-378.294) (-355.828) (-360.009) [-361.606] -- 0:01:18
Average standard deviation of split frequencies: 0.046510
25500 -- (-357.393) [-356.043] (-358.530) (-359.144) * (-367.991) [-355.755] (-360.752) (-357.073) -- 0:01:16
26000 -- [-356.490] (-357.223) (-358.308) (-356.752) * (-376.828) (-355.959) (-362.155) [-355.582] -- 0:01:14
26500 -- [-356.129] (-356.919) (-360.250) (-355.242) * (-374.090) (-355.691) [-362.395] (-356.645) -- 0:01:13
27000 -- (-357.838) [-355.866] (-360.617) (-357.426) * (-368.940) (-357.037) [-359.869] (-355.562) -- 0:01:12
27500 -- [-357.686] (-356.342) (-359.001) (-355.134) * (-371.688) (-357.752) [-357.206] (-356.641) -- 0:01:10
28000 -- (-357.871) (-356.496) [-358.706] (-357.625) * (-368.584) (-355.027) (-355.718) [-362.313] -- 0:01:09
28500 -- (-356.922) (-356.829) [-356.222] (-357.003) * [-357.081] (-356.081) (-357.431) (-357.672) -- 0:01:08
29000 -- (-359.208) [-356.764] (-358.015) (-356.808) * (-359.685) (-355.469) (-359.305) [-356.137] -- 0:01:06
29500 -- (-360.067) [-356.787] (-360.254) (-358.170) * (-362.569) (-355.299) [-356.485] (-356.883) -- 0:01:05
30000 -- (-356.487) (-355.281) [-357.844] (-359.168) * (-364.762) (-356.181) [-358.615] (-356.060) -- 0:01:04
Average standard deviation of split frequencies: 0.043188
30500 -- [-356.803] (-361.654) (-357.690) (-360.499) * (-361.809) (-356.867) [-357.575] (-358.601) -- 0:01:03
31000 -- [-360.848] (-357.393) (-359.608) (-360.664) * (-357.456) (-355.396) [-355.714] (-355.172) -- 0:01:02
31500 -- [-357.086] (-356.373) (-356.294) (-355.966) * (-359.308) (-356.378) (-355.882) [-359.553] -- 0:01:01
32000 -- [-358.793] (-357.020) (-357.151) (-356.813) * (-359.260) (-359.307) (-357.795) [-355.431] -- 0:01:00
32500 -- (-357.319) (-358.671) [-356.120] (-365.751) * (-356.909) (-359.419) [-356.473] (-355.480) -- 0:00:59
33000 -- [-357.419] (-356.067) (-361.591) (-364.219) * (-359.845) (-358.483) (-359.728) [-357.967] -- 0:00:58
33500 -- (-356.699) (-355.281) (-359.945) [-358.337] * (-358.330) (-357.706) (-363.888) [-355.653] -- 0:00:57
34000 -- (-356.609) [-356.663] (-360.114) (-359.084) * (-358.888) [-356.132] (-360.951) (-358.232) -- 0:00:56
34500 -- [-357.723] (-356.608) (-356.272) (-359.190) * (-360.175) [-358.578] (-365.424) (-358.723) -- 0:00:55
35000 -- [-358.673] (-358.004) (-356.421) (-358.106) * (-361.594) (-356.868) [-355.465] (-358.392) -- 0:00:55
Average standard deviation of split frequencies: 0.044522
35500 -- (-362.107) (-359.129) (-357.293) [-356.757] * (-359.578) [-357.460] (-357.607) (-357.039) -- 0:00:54
36000 -- (-360.373) (-359.669) (-355.533) [-356.767] * (-359.604) (-356.004) [-356.158] (-355.052) -- 0:00:53
36500 -- (-355.778) (-358.310) [-361.567] (-356.099) * (-359.795) (-357.155) (-357.632) [-356.401] -- 0:00:52
37000 -- (-358.529) (-355.678) (-360.157) [-358.909] * (-356.741) (-357.844) (-356.281) [-357.080] -- 0:00:52
37500 -- (-358.528) (-357.604) (-356.294) [-356.430] * [-356.510] (-360.603) (-357.061) (-355.557) -- 0:00:51
38000 -- (-357.032) (-356.087) [-356.511] (-356.105) * [-358.627] (-359.488) (-360.251) (-357.190) -- 0:00:50
38500 -- (-357.247) [-357.490] (-360.004) (-358.026) * [-355.135] (-356.235) (-361.618) (-355.424) -- 0:00:49
39000 -- [-358.173] (-359.005) (-357.819) (-357.491) * (-358.757) (-356.630) (-359.329) [-358.439] -- 0:00:49
39500 -- (-357.421) (-358.396) (-362.234) [-355.832] * (-361.744) (-358.407) [-357.698] (-357.260) -- 0:01:12
40000 -- (-357.973) [-356.848] (-360.615) (-355.688) * (-355.727) (-360.519) [-355.385] (-356.425) -- 0:01:12
Average standard deviation of split frequencies: 0.040877
40500 -- (-357.305) (-357.635) [-359.601] (-356.348) * (-358.054) [-355.832] (-356.135) (-358.664) -- 0:01:11
41000 -- (-355.694) (-360.550) [-356.343] (-356.403) * (-355.801) [-356.157] (-356.411) (-356.100) -- 0:01:10
41500 -- (-357.780) (-357.341) [-356.730] (-355.317) * [-357.033] (-355.675) (-356.848) (-360.369) -- 0:01:09
42000 -- (-357.436) [-358.098] (-358.150) (-355.957) * (-361.882) [-356.161] (-356.836) (-360.937) -- 0:01:08
42500 -- (-356.294) [-359.303] (-358.283) (-359.921) * (-358.933) (-356.202) (-358.765) [-359.268] -- 0:01:07
43000 -- (-356.375) (-356.234) [-358.299] (-359.129) * (-359.736) [-356.057] (-357.737) (-358.511) -- 0:01:06
43500 -- (-358.096) (-357.805) (-359.477) [-358.523] * (-358.211) [-356.501] (-358.519) (-356.524) -- 0:01:05
44000 -- (-355.423) (-356.557) (-359.439) [-356.343] * (-359.625) (-359.866) [-359.205] (-356.618) -- 0:01:05
44500 -- (-356.030) [-356.548] (-356.236) (-356.543) * (-357.290) (-356.745) [-358.179] (-360.731) -- 0:01:04
45000 -- (-356.628) [-356.994] (-357.755) (-356.429) * (-359.877) [-355.883] (-355.575) (-361.125) -- 0:01:03
Average standard deviation of split frequencies: 0.044252
45500 -- [-359.708] (-354.970) (-357.442) (-356.907) * (-357.106) (-356.080) (-360.359) [-356.817] -- 0:01:02
46000 -- (-358.258) (-358.433) (-358.508) [-355.501] * (-355.702) (-356.351) (-356.779) [-355.344] -- 0:01:02
46500 -- [-356.432] (-356.970) (-357.173) (-358.663) * (-355.514) (-356.447) [-361.084] (-356.965) -- 0:01:01
47000 -- [-357.432] (-361.485) (-356.066) (-357.474) * (-356.424) (-361.200) [-355.251] (-357.604) -- 0:01:00
47500 -- (-357.367) [-358.408] (-358.268) (-357.347) * (-357.923) (-359.866) (-358.469) [-355.853] -- 0:01:00
48000 -- (-357.523) (-356.686) [-359.711] (-357.155) * (-362.501) (-361.460) (-360.333) [-357.114] -- 0:00:59
48500 -- (-357.520) (-356.540) [-357.228] (-359.154) * [-357.542] (-355.706) (-360.005) (-359.105) -- 0:00:58
49000 -- (-356.860) (-356.559) (-357.990) [-357.777] * (-357.126) (-357.212) [-355.855] (-356.052) -- 0:00:58
49500 -- (-358.435) (-355.347) [-357.584] (-357.124) * (-356.162) (-357.179) (-357.451) [-359.456] -- 0:00:57
50000 -- (-356.622) (-356.040) [-358.885] (-355.918) * [-356.978] (-360.068) (-358.553) (-358.308) -- 0:00:57
Average standard deviation of split frequencies: 0.041868
50500 -- [-356.727] (-358.143) (-357.918) (-356.464) * [-359.034] (-356.352) (-359.284) (-356.463) -- 0:00:56
51000 -- (-356.882) (-356.281) (-359.071) [-356.250] * [-357.254] (-358.611) (-358.364) (-356.888) -- 0:00:55
51500 -- (-355.818) (-358.321) [-358.838] (-356.229) * (-355.686) (-357.963) [-360.024] (-355.303) -- 0:00:55
52000 -- [-358.696] (-356.281) (-359.294) (-355.924) * (-357.485) [-356.661] (-357.793) (-355.356) -- 0:00:54
52500 -- (-357.680) (-355.783) (-356.238) [-357.061] * (-355.985) (-357.186) [-357.216] (-357.205) -- 0:00:54
53000 -- (-356.661) (-358.317) (-357.544) [-356.064] * (-359.160) [-355.718] (-356.415) (-357.998) -- 0:00:53
53500 -- [-356.646] (-355.636) (-357.263) (-355.906) * [-357.880] (-356.135) (-356.183) (-365.320) -- 0:00:53
54000 -- (-358.150) (-357.704) (-357.336) [-356.538] * (-357.115) (-356.969) [-355.280] (-360.085) -- 0:00:52
54500 -- (-356.620) (-358.061) (-356.447) [-356.223] * (-357.983) (-357.583) [-356.976] (-355.404) -- 0:00:52
55000 -- (-355.589) (-359.537) [-355.593] (-357.239) * (-357.523) (-357.051) [-358.043] (-358.370) -- 0:00:51
Average standard deviation of split frequencies: 0.043620
55500 -- (-356.510) (-358.907) (-356.400) [-358.163] * (-358.318) (-359.032) (-359.368) [-357.133] -- 0:00:51
56000 -- (-359.192) (-360.192) (-355.312) [-358.983] * (-357.414) (-355.688) (-357.496) [-358.480] -- 0:00:50
56500 -- (-358.082) (-357.869) (-356.006) [-360.623] * [-356.262] (-357.860) (-359.268) (-357.173) -- 0:00:50
57000 -- (-361.022) (-359.149) (-357.390) [-356.103] * (-357.399) [-356.059] (-358.168) (-355.602) -- 0:01:06
57500 -- (-357.502) (-357.069) (-360.177) [-357.945] * (-356.597) [-356.218] (-358.580) (-358.816) -- 0:01:05
58000 -- [-359.590] (-357.396) (-359.714) (-356.846) * (-355.925) (-355.532) (-359.626) [-356.572] -- 0:01:04
58500 -- (-355.793) (-355.530) [-359.257] (-357.113) * (-355.827) (-359.327) [-357.516] (-356.480) -- 0:01:04
59000 -- (-358.106) [-356.582] (-357.168) (-356.135) * (-356.375) (-357.544) [-355.964] (-357.214) -- 0:01:03
59500 -- (-357.257) (-358.347) [-355.584] (-356.825) * (-356.399) [-356.789] (-359.742) (-357.379) -- 0:01:03
60000 -- [-356.743] (-363.174) (-361.652) (-362.716) * [-358.225] (-358.455) (-357.557) (-358.469) -- 0:01:02
Average standard deviation of split frequencies: 0.046622
60500 -- (-360.254) (-358.444) (-357.146) [-357.622] * (-355.530) [-357.856] (-357.266) (-357.855) -- 0:01:02
61000 -- (-355.645) (-359.847) (-357.203) [-359.923] * (-357.329) (-359.945) (-357.211) [-357.426] -- 0:01:01
61500 -- [-355.990] (-357.956) (-358.789) (-359.182) * (-358.614) (-360.380) [-358.887] (-361.473) -- 0:01:01
62000 -- (-357.685) [-356.383] (-358.620) (-359.205) * [-357.273] (-356.328) (-362.038) (-357.399) -- 0:01:00
62500 -- (-358.079) [-360.600] (-355.752) (-360.264) * (-356.323) (-359.089) (-361.474) [-357.859] -- 0:01:00
63000 -- (-358.257) (-360.798) [-357.923] (-356.343) * [-356.532] (-357.173) (-359.326) (-360.605) -- 0:00:59
63500 -- [-356.440] (-357.893) (-359.325) (-358.434) * (-363.145) [-357.633] (-358.452) (-355.569) -- 0:00:58
64000 -- (-357.818) [-359.705] (-356.509) (-358.589) * (-358.264) [-358.995] (-356.995) (-361.258) -- 0:00:58
64500 -- [-356.942] (-360.468) (-357.940) (-360.826) * (-360.166) (-357.009) [-355.618] (-357.773) -- 0:00:58
65000 -- [-357.821] (-355.327) (-361.669) (-356.060) * [-357.954] (-357.481) (-355.698) (-357.968) -- 0:00:57
Average standard deviation of split frequencies: 0.045128
65500 -- (-358.458) (-357.141) [-358.953] (-358.995) * (-361.865) (-358.235) [-358.247] (-355.838) -- 0:00:57
66000 -- [-355.690] (-359.863) (-356.626) (-358.287) * (-358.431) [-357.143] (-357.288) (-358.844) -- 0:00:56
66500 -- (-355.987) (-359.620) (-357.856) [-357.195] * (-357.560) [-356.550] (-356.526) (-356.562) -- 0:00:56
67000 -- (-358.618) (-360.106) (-357.942) [-356.884] * (-359.205) (-356.854) (-356.247) [-356.872] -- 0:00:55
67500 -- [-359.962] (-355.619) (-357.491) (-357.850) * [-357.922] (-359.810) (-356.332) (-361.712) -- 0:00:55
68000 -- [-361.047] (-364.331) (-356.328) (-357.536) * (-357.054) [-356.089] (-357.702) (-361.475) -- 0:00:54
68500 -- (-357.526) (-360.373) [-356.244] (-359.247) * [-358.576] (-356.987) (-360.527) (-365.324) -- 0:00:54
69000 -- (-361.777) [-359.133] (-356.737) (-359.323) * (-356.400) (-360.422) (-357.521) [-357.929] -- 0:00:53
69500 -- (-361.736) [-358.568] (-357.554) (-359.119) * (-356.199) (-356.435) [-358.051] (-355.288) -- 0:00:53
70000 -- (-356.793) [-357.009] (-356.154) (-356.247) * (-355.928) (-355.635) [-355.917] (-356.307) -- 0:00:53
Average standard deviation of split frequencies: 0.044573
70500 -- [-357.154] (-359.034) (-355.588) (-356.966) * (-356.396) (-360.100) (-356.189) [-360.834] -- 0:00:52
71000 -- [-355.989] (-357.249) (-355.667) (-355.763) * (-359.802) (-357.095) [-356.223] (-362.808) -- 0:00:52
71500 -- (-357.267) [-356.429] (-355.803) (-356.541) * (-359.096) [-356.622] (-356.161) (-362.672) -- 0:00:51
72000 -- (-356.503) (-359.326) [-355.847] (-356.960) * (-359.679) [-355.334] (-356.414) (-359.899) -- 0:00:51
72500 -- (-358.170) (-360.034) (-357.982) [-356.394] * (-356.755) (-355.652) (-358.504) [-355.744] -- 0:00:51
73000 -- [-356.057] (-358.698) (-355.321) (-358.050) * (-357.645) (-355.764) [-357.205] (-355.565) -- 0:00:50
73500 -- (-360.894) (-359.378) (-356.116) [-358.633] * (-358.633) (-356.331) [-356.484] (-358.938) -- 0:00:50
74000 -- [-358.164] (-361.248) (-357.171) (-357.509) * (-357.562) [-362.542] (-357.119) (-355.612) -- 0:01:02
74500 -- (-357.653) (-356.762) [-355.928] (-357.568) * (-358.932) (-359.161) [-357.109] (-357.017) -- 0:01:02
75000 -- (-358.420) (-359.185) (-359.721) [-357.300] * [-355.619] (-356.888) (-359.701) (-355.551) -- 0:01:01
Average standard deviation of split frequencies: 0.043419
75500 -- (-361.332) [-360.450] (-355.730) (-361.477) * (-355.480) (-355.613) [-357.774] (-366.355) -- 0:01:01
76000 -- (-357.397) (-357.415) (-359.082) [-356.594] * [-357.370] (-355.388) (-357.237) (-359.384) -- 0:01:00
76500 -- (-356.413) (-360.383) (-355.901) [-358.411] * (-357.270) (-355.596) (-357.290) [-355.755] -- 0:01:00
77000 -- (-357.024) (-358.739) (-357.585) [-358.640] * (-357.971) [-357.242] (-355.863) (-355.636) -- 0:00:59
77500 -- (-357.141) [-357.362] (-356.716) (-358.890) * [-358.089] (-360.477) (-357.942) (-356.031) -- 0:00:59
78000 -- [-357.950] (-356.175) (-360.925) (-360.188) * (-357.716) [-358.432] (-360.951) (-357.892) -- 0:00:59
78500 -- [-357.449] (-356.281) (-356.139) (-356.154) * [-357.964] (-357.405) (-362.221) (-356.573) -- 0:00:58
79000 -- (-355.927) [-358.875] (-359.915) (-356.375) * [-356.584] (-357.176) (-355.794) (-355.991) -- 0:00:58
79500 -- (-358.544) [-355.314] (-357.530) (-360.112) * (-358.149) (-359.981) [-356.341] (-355.354) -- 0:00:57
80000 -- (-357.210) (-357.079) [-355.390] (-356.555) * (-358.207) [-359.312] (-357.846) (-356.309) -- 0:00:57
Average standard deviation of split frequencies: 0.041415
80500 -- (-357.031) (-355.649) (-360.425) [-355.982] * (-357.791) (-357.377) (-355.313) [-356.984] -- 0:00:57
81000 -- (-355.669) (-358.173) [-356.801] (-356.095) * [-358.749] (-356.450) (-357.584) (-356.511) -- 0:00:56
81500 -- (-355.127) (-359.324) [-355.696] (-359.577) * (-358.397) (-355.760) (-361.273) [-358.541] -- 0:00:56
82000 -- (-355.462) [-358.208] (-355.289) (-357.006) * (-355.767) (-358.085) (-361.848) [-356.226] -- 0:00:55
82500 -- [-357.012] (-357.869) (-359.485) (-355.144) * (-355.696) (-356.309) [-356.262] (-356.272) -- 0:00:55
83000 -- (-357.347) (-358.263) (-356.990) [-355.887] * (-357.886) (-355.629) [-356.152] (-356.538) -- 0:00:55
83500 -- [-356.307] (-356.912) (-355.915) (-356.340) * (-356.005) (-355.593) (-359.977) [-356.233] -- 0:00:54
84000 -- (-357.328) [-356.000] (-355.807) (-355.703) * (-357.818) [-355.404] (-357.100) (-355.801) -- 0:00:54
84500 -- (-358.333) [-355.191] (-355.709) (-357.308) * (-356.779) [-355.750] (-357.198) (-356.255) -- 0:00:54
85000 -- (-359.536) [-355.911] (-357.887) (-358.292) * (-358.861) (-357.014) (-358.708) [-356.541] -- 0:00:53
Average standard deviation of split frequencies: 0.038608
85500 -- (-357.361) [-356.559] (-357.652) (-356.526) * [-356.486] (-358.839) (-356.914) (-358.630) -- 0:00:53
86000 -- (-355.294) (-357.848) [-359.028] (-356.503) * (-356.257) (-357.162) (-356.100) [-356.857] -- 0:00:53
86500 -- (-358.176) [-355.320] (-356.113) (-358.883) * (-359.497) (-356.032) (-358.729) [-355.384] -- 0:00:52
87000 -- (-357.754) (-358.190) [-356.480] (-356.757) * (-358.588) (-358.043) (-355.418) [-357.049] -- 0:00:52
87500 -- [-357.200] (-360.874) (-356.470) (-356.053) * [-357.209] (-358.590) (-357.377) (-356.910) -- 0:00:52
88000 -- (-360.426) (-357.340) (-358.067) [-360.533] * (-359.023) (-357.045) (-355.883) [-356.762] -- 0:00:51
88500 -- [-358.015] (-355.367) (-358.858) (-356.520) * (-356.982) (-356.332) [-356.122] (-357.089) -- 0:00:51
89000 -- [-355.305] (-356.559) (-365.092) (-358.939) * [-364.437] (-367.700) (-357.628) (-355.857) -- 0:00:51
89500 -- (-358.582) (-362.626) [-358.463] (-359.979) * [-357.885] (-366.420) (-356.824) (-357.942) -- 0:00:50
90000 -- (-357.389) (-365.509) (-359.730) [-359.399] * (-357.362) (-359.392) [-356.612] (-355.878) -- 0:00:50
Average standard deviation of split frequencies: 0.038050
90500 -- (-357.688) [-361.212] (-356.785) (-361.573) * (-359.998) (-358.857) [-357.084] (-356.252) -- 0:00:50
91000 -- (-358.521) (-362.112) [-356.755] (-357.868) * (-357.767) (-355.666) [-356.929] (-355.832) -- 0:00:59
91500 -- (-359.047) (-359.496) (-355.380) [-355.587] * (-358.703) (-357.728) (-364.162) [-358.934] -- 0:00:59
92000 -- (-361.283) (-357.314) (-355.742) [-355.206] * (-356.231) [-357.076] (-357.891) (-362.706) -- 0:00:59
92500 -- (-356.895) (-356.714) (-355.388) [-355.236] * [-358.784] (-358.202) (-358.154) (-363.161) -- 0:00:58
93000 -- (-356.619) (-359.533) [-355.506] (-355.300) * [-356.359] (-359.691) (-357.327) (-359.029) -- 0:00:58
93500 -- [-357.201] (-358.937) (-356.044) (-358.591) * (-355.406) [-360.166] (-356.130) (-357.369) -- 0:00:58
94000 -- (-356.009) (-358.046) [-355.310] (-356.651) * (-357.900) [-358.260] (-358.910) (-361.118) -- 0:00:57
94500 -- (-362.048) (-359.924) (-357.612) [-358.656] * (-358.781) [-357.156] (-356.350) (-356.493) -- 0:00:57
95000 -- (-358.189) [-358.717] (-360.177) (-360.991) * (-359.851) (-356.896) (-356.887) [-357.069] -- 0:00:57
Average standard deviation of split frequencies: 0.039050
95500 -- (-356.268) [-359.728] (-355.203) (-357.714) * (-356.724) (-356.954) [-357.260] (-359.222) -- 0:00:56
96000 -- (-358.042) (-359.395) (-356.863) [-358.336] * [-355.670] (-357.589) (-362.462) (-358.808) -- 0:00:56
96500 -- (-357.240) (-357.311) (-356.926) [-356.492] * (-355.224) (-357.660) (-361.120) [-356.325] -- 0:00:56
97000 -- [-360.674] (-356.101) (-355.408) (-357.629) * [-354.875] (-366.527) (-362.829) (-356.128) -- 0:00:55
97500 -- (-358.545) (-357.386) [-356.223] (-356.900) * [-355.644] (-361.351) (-359.965) (-356.023) -- 0:00:55
98000 -- [-357.372] (-358.657) (-356.830) (-358.716) * (-355.162) (-358.216) (-357.187) [-358.386] -- 0:00:55
98500 -- [-356.226] (-358.270) (-359.191) (-357.658) * (-358.192) (-361.345) [-355.719] (-356.986) -- 0:00:54
99000 -- (-358.526) (-359.307) (-357.681) [-356.075] * (-357.375) (-357.516) [-355.611] (-359.120) -- 0:00:54
99500 -- (-357.871) [-358.837] (-356.847) (-357.254) * (-357.777) [-355.485] (-357.469) (-358.415) -- 0:00:54
100000 -- (-357.343) [-357.901] (-356.586) (-355.994) * (-358.692) [-356.633] (-357.246) (-357.487) -- 0:00:54
Average standard deviation of split frequencies: 0.034752
100500 -- (-360.065) (-358.885) (-355.160) [-355.405] * [-356.688] (-357.367) (-358.953) (-358.008) -- 0:00:53
101000 -- (-359.422) [-361.813] (-357.540) (-359.228) * (-358.009) (-358.131) [-358.454] (-359.366) -- 0:00:53
101500 -- (-357.226) (-357.448) [-355.963] (-358.781) * (-357.415) (-356.810) (-355.201) [-357.169] -- 0:00:53
102000 -- (-357.450) [-356.430] (-357.804) (-355.761) * (-359.404) (-358.549) (-355.863) [-357.062] -- 0:00:52
102500 -- (-356.390) [-356.810] (-358.027) (-355.484) * (-358.931) (-358.188) [-357.043] (-357.285) -- 0:00:52
103000 -- (-362.974) [-360.106] (-357.542) (-357.758) * (-361.894) [-356.734] (-356.129) (-355.737) -- 0:00:52
103500 -- (-356.042) (-359.003) [-358.856] (-356.974) * (-357.393) [-355.509] (-358.122) (-361.188) -- 0:00:51
104000 -- (-357.564) (-359.860) [-357.333] (-359.596) * (-359.814) (-357.524) (-358.453) [-356.766] -- 0:00:51
104500 -- (-358.247) [-357.823] (-357.709) (-361.502) * (-356.575) (-355.942) (-360.049) [-355.837] -- 0:00:51
105000 -- [-358.656] (-356.485) (-359.685) (-357.120) * (-356.321) (-357.400) (-357.298) [-357.340] -- 0:00:51
Average standard deviation of split frequencies: 0.035780
105500 -- (-357.242) (-357.324) (-356.039) [-358.687] * (-355.543) (-356.683) [-357.431] (-359.536) -- 0:00:50
106000 -- [-356.652] (-358.512) (-355.136) (-356.715) * [-355.729] (-357.276) (-358.380) (-355.783) -- 0:00:59
106500 -- (-357.463) (-358.746) [-357.383] (-357.154) * (-357.626) (-358.853) [-355.901] (-357.082) -- 0:00:58
107000 -- (-355.905) (-356.651) (-360.803) [-356.342] * (-364.964) (-357.635) (-357.549) [-360.134] -- 0:00:58
107500 -- (-355.986) (-358.746) [-356.572] (-357.085) * (-356.332) (-355.599) (-357.467) [-360.581] -- 0:00:58
108000 -- (-358.736) (-356.004) [-357.265] (-357.596) * (-356.628) [-358.125] (-357.785) (-357.449) -- 0:00:57
108500 -- [-357.242] (-361.977) (-355.445) (-358.330) * (-360.358) (-357.352) [-358.016] (-359.555) -- 0:00:57
109000 -- (-360.506) (-356.411) [-355.815] (-358.724) * (-356.280) (-357.775) (-361.614) [-356.469] -- 0:00:57
109500 -- (-357.867) [-355.534] (-356.149) (-360.175) * (-356.325) [-356.373] (-357.815) (-360.052) -- 0:00:56
110000 -- (-360.797) [-356.256] (-355.710) (-359.982) * (-359.080) (-356.565) [-356.484] (-356.948) -- 0:00:56
Average standard deviation of split frequencies: 0.034889
110500 -- [-357.897] (-360.443) (-356.153) (-357.730) * (-356.934) (-357.455) [-356.663] (-358.147) -- 0:00:56
111000 -- (-358.667) (-358.843) (-355.947) [-356.215] * (-356.904) (-357.401) (-357.790) [-355.878] -- 0:00:56
111500 -- [-356.635] (-359.576) (-357.316) (-356.706) * [-356.073] (-358.321) (-357.066) (-356.455) -- 0:00:55
112000 -- (-356.984) [-357.669] (-356.485) (-355.803) * (-355.539) (-355.925) [-359.955] (-358.946) -- 0:00:55
112500 -- (-358.780) [-358.547] (-359.038) (-355.948) * (-355.422) [-357.941] (-360.901) (-356.126) -- 0:00:55
113000 -- (-359.499) (-359.936) [-356.290] (-355.861) * (-358.201) [-358.088] (-358.637) (-357.055) -- 0:00:54
113500 -- (-359.608) (-358.477) [-355.199] (-356.804) * [-356.951] (-358.918) (-361.446) (-356.703) -- 0:00:54
114000 -- (-358.284) (-355.629) (-359.732) [-356.434] * (-359.125) (-358.492) (-365.514) [-355.321] -- 0:00:54
114500 -- (-356.617) (-358.340) (-363.113) [-356.921] * (-358.966) (-359.019) [-357.622] (-356.287) -- 0:00:54
115000 -- (-356.856) (-356.803) [-355.735] (-364.224) * (-356.655) (-359.394) (-363.202) [-355.414] -- 0:00:53
Average standard deviation of split frequencies: 0.033478
115500 -- [-355.273] (-364.001) (-356.592) (-359.288) * (-356.224) [-359.059] (-357.886) (-355.279) -- 0:00:53
116000 -- (-356.845) (-359.470) (-359.402) [-357.245] * (-362.124) (-358.933) (-355.336) [-357.139] -- 0:00:53
116500 -- (-356.828) (-359.235) [-360.409] (-358.831) * (-356.602) [-359.104] (-355.326) (-358.785) -- 0:00:53
117000 -- (-360.620) [-359.691] (-356.208) (-356.432) * (-360.156) (-358.229) [-355.630] (-356.397) -- 0:00:52
117500 -- (-360.638) (-359.885) (-355.400) [-355.358] * (-356.536) [-359.485] (-356.401) (-358.014) -- 0:00:52
118000 -- [-355.964] (-361.597) (-357.502) (-356.203) * [-357.470] (-356.113) (-357.106) (-356.656) -- 0:00:52
118500 -- (-357.720) (-356.423) [-357.080] (-359.247) * (-358.554) [-356.187] (-359.091) (-356.567) -- 0:00:52
119000 -- (-356.908) (-359.392) [-355.114] (-358.577) * (-357.338) [-359.036] (-355.907) (-358.449) -- 0:00:51
119500 -- [-357.404] (-356.883) (-356.544) (-361.155) * (-358.874) (-358.373) (-358.270) [-358.651] -- 0:00:51
120000 -- (-356.067) (-359.421) [-356.331] (-357.789) * (-355.389) (-356.566) (-357.500) [-356.915] -- 0:00:51
Average standard deviation of split frequencies: 0.032487
120500 -- (-355.971) (-357.472) [-356.899] (-358.364) * (-356.445) [-355.413] (-361.896) (-357.323) -- 0:00:51
121000 -- (-359.029) [-359.695] (-356.310) (-356.518) * (-355.313) (-355.652) (-359.948) [-356.793] -- 0:00:50
121500 -- (-355.543) (-355.758) (-356.333) [-357.601] * [-356.906] (-355.270) (-357.419) (-362.049) -- 0:00:50
122000 -- (-355.146) [-358.805] (-356.527) (-358.601) * (-358.004) (-358.046) [-355.543] (-358.437) -- 0:00:57
122500 -- (-356.439) (-356.565) [-357.446] (-356.574) * [-357.118] (-355.827) (-357.692) (-357.697) -- 0:00:57
123000 -- [-356.751] (-355.884) (-360.749) (-359.160) * (-357.671) [-359.374] (-361.239) (-357.171) -- 0:00:57
123500 -- (-362.694) [-356.889] (-356.096) (-358.833) * (-360.374) (-359.716) (-358.426) [-358.970] -- 0:00:56
124000 -- (-359.783) [-356.414] (-356.105) (-357.400) * (-358.717) [-357.119] (-357.804) (-358.316) -- 0:00:56
124500 -- (-356.739) [-356.741] (-356.443) (-359.901) * [-358.039] (-357.507) (-360.043) (-362.724) -- 0:00:56
125000 -- (-357.003) [-355.949] (-357.831) (-355.361) * (-357.783) [-357.458] (-355.939) (-360.844) -- 0:00:56
Average standard deviation of split frequencies: 0.030492
125500 -- (-355.370) [-355.356] (-359.870) (-357.100) * (-355.336) [-357.662] (-357.000) (-358.762) -- 0:00:55
126000 -- (-356.866) (-356.906) (-357.153) [-359.058] * [-357.138] (-356.328) (-356.221) (-358.053) -- 0:00:55
126500 -- [-358.434] (-357.509) (-357.298) (-358.763) * (-358.175) (-355.610) (-360.299) [-357.850] -- 0:00:55
127000 -- (-356.784) (-356.149) [-356.028] (-356.658) * (-357.411) [-357.563] (-356.079) (-357.882) -- 0:00:54
127500 -- (-356.761) [-356.650] (-359.092) (-358.076) * (-356.365) [-357.250] (-360.976) (-358.097) -- 0:00:54
128000 -- (-358.167) (-356.985) (-356.179) [-358.083] * (-357.376) (-356.019) [-357.139] (-360.108) -- 0:00:54
128500 -- (-355.540) [-357.316] (-356.305) (-355.962) * (-356.185) [-356.307] (-356.835) (-363.141) -- 0:00:54
129000 -- (-357.691) [-358.644] (-355.957) (-358.414) * (-363.194) [-355.771] (-356.752) (-361.941) -- 0:00:54
129500 -- [-355.662] (-356.090) (-356.891) (-357.420) * (-358.404) (-355.607) (-362.309) [-359.826] -- 0:00:53
130000 -- (-355.950) (-357.631) [-356.343] (-357.639) * (-357.165) (-355.458) [-355.530] (-358.120) -- 0:00:53
Average standard deviation of split frequencies: 0.031206
130500 -- (-355.078) (-355.981) (-361.523) [-356.091] * (-357.405) (-356.336) [-357.823] (-358.063) -- 0:00:53
131000 -- (-355.720) (-356.723) [-360.989] (-356.348) * (-355.479) (-357.903) (-355.765) [-355.061] -- 0:00:53
131500 -- [-356.305] (-355.536) (-356.284) (-355.905) * (-357.273) [-356.403] (-355.800) (-355.303) -- 0:00:52
132000 -- (-357.197) (-355.652) (-357.795) [-356.636] * (-357.615) (-360.048) (-355.517) [-355.903] -- 0:00:52
132500 -- [-359.706] (-356.249) (-356.687) (-355.816) * (-360.620) (-361.541) [-356.127] (-357.103) -- 0:00:52
133000 -- [-358.268] (-358.515) (-356.613) (-358.895) * (-358.498) [-355.536] (-355.533) (-355.818) -- 0:00:52
133500 -- [-358.093] (-356.157) (-356.897) (-356.392) * (-358.324) (-357.791) [-356.064] (-355.404) -- 0:00:51
134000 -- (-359.373) (-355.530) [-357.576] (-357.402) * (-356.554) (-356.754) [-355.492] (-358.109) -- 0:00:51
134500 -- [-357.376] (-355.997) (-356.837) (-358.733) * (-355.378) (-358.695) [-355.645] (-355.630) -- 0:00:51
135000 -- [-356.811] (-356.522) (-358.928) (-358.522) * (-356.211) [-361.783] (-357.169) (-355.551) -- 0:00:51
Average standard deviation of split frequencies: 0.028423
135500 -- (-358.158) (-355.978) (-356.410) [-355.439] * [-356.074] (-355.713) (-355.981) (-357.652) -- 0:00:51
136000 -- (-357.020) (-355.686) [-355.798] (-355.927) * (-357.332) (-359.233) (-356.688) [-355.466] -- 0:00:50
136500 -- (-361.323) (-355.221) [-356.143] (-359.285) * (-357.982) (-357.124) [-358.290] (-357.620) -- 0:00:50
137000 -- (-359.459) (-355.679) [-356.259] (-357.002) * (-357.405) [-355.968] (-356.750) (-355.579) -- 0:00:50
137500 -- (-356.358) (-356.095) (-357.247) [-357.486] * (-358.016) (-357.252) [-356.266] (-357.022) -- 0:00:56
138000 -- (-355.005) (-357.916) (-359.808) [-356.454] * (-358.432) (-356.699) [-355.874] (-365.172) -- 0:00:56
138500 -- (-355.908) [-363.789] (-358.695) (-362.487) * (-358.505) (-359.960) (-355.581) [-361.627] -- 0:00:55
139000 -- (-356.093) (-359.144) (-359.027) [-355.941] * (-356.015) (-358.079) [-356.761] (-356.678) -- 0:00:55
139500 -- (-355.793) [-357.702] (-356.685) (-357.629) * (-356.747) (-362.483) [-359.808] (-355.703) -- 0:00:55
140000 -- [-356.348] (-356.996) (-358.203) (-364.003) * (-355.900) (-356.664) [-355.727] (-357.691) -- 0:00:55
Average standard deviation of split frequencies: 0.028318
140500 -- (-356.655) (-360.297) [-356.108] (-356.466) * (-357.181) (-358.399) [-356.885] (-358.703) -- 0:00:55
141000 -- (-360.357) (-361.230) (-358.125) [-357.278] * (-357.636) (-355.796) [-358.115] (-357.986) -- 0:00:54
141500 -- (-357.401) (-359.070) (-355.521) [-357.629] * [-356.981] (-355.313) (-355.993) (-357.647) -- 0:00:54
142000 -- (-357.271) [-356.675] (-356.896) (-356.389) * (-357.298) [-356.462] (-356.111) (-356.893) -- 0:00:54
142500 -- (-357.916) (-355.825) (-356.405) [-356.370] * (-356.814) [-356.906] (-356.355) (-356.297) -- 0:00:54
143000 -- (-358.340) (-359.359) (-357.016) [-358.313] * (-355.565) [-355.725] (-357.607) (-356.767) -- 0:00:53
143500 -- (-359.809) (-357.309) [-357.279] (-355.340) * (-355.768) (-357.800) (-361.383) [-357.048] -- 0:00:53
144000 -- [-359.278] (-356.953) (-357.818) (-358.516) * (-358.685) (-360.360) (-356.215) [-357.129] -- 0:00:53
144500 -- [-358.117] (-357.750) (-356.342) (-363.589) * [-355.245] (-360.007) (-357.252) (-356.903) -- 0:00:53
145000 -- (-357.799) (-360.364) (-358.501) [-357.336] * (-356.606) [-355.171] (-357.469) (-359.902) -- 0:00:53
Average standard deviation of split frequencies: 0.028898
145500 -- (-356.711) (-357.480) (-357.972) [-356.988] * (-355.580) (-356.450) (-356.164) [-357.257] -- 0:00:52
146000 -- (-357.342) (-356.731) [-357.150] (-357.623) * (-358.649) (-357.349) (-359.558) [-356.787] -- 0:00:52
146500 -- [-358.689] (-356.673) (-358.625) (-357.552) * [-357.038] (-357.324) (-357.058) (-358.023) -- 0:00:52
147000 -- (-357.953) (-359.651) (-356.634) [-355.898] * (-356.515) [-356.717] (-356.489) (-362.964) -- 0:00:52
147500 -- (-357.027) (-356.311) [-356.830] (-357.482) * [-356.941] (-357.035) (-356.995) (-361.733) -- 0:00:52
148000 -- [-357.614] (-356.284) (-358.081) (-359.614) * (-356.461) (-357.929) (-355.528) [-363.941] -- 0:00:51
148500 -- (-356.250) (-361.046) [-356.076] (-355.677) * (-357.637) (-357.910) [-355.505] (-362.006) -- 0:00:51
149000 -- [-357.378] (-357.130) (-358.962) (-355.671) * (-357.728) [-357.424] (-357.530) (-357.809) -- 0:00:51
149500 -- (-356.994) (-356.798) [-361.273] (-355.791) * [-356.724] (-356.451) (-358.009) (-356.556) -- 0:00:51
150000 -- (-356.506) (-360.925) (-357.732) [-355.508] * [-356.245] (-360.900) (-356.533) (-363.895) -- 0:00:51
Average standard deviation of split frequencies: 0.029098
150500 -- (-359.502) (-357.004) [-357.731] (-355.771) * [-357.600] (-357.770) (-356.656) (-361.684) -- 0:00:50
151000 -- [-358.554] (-359.093) (-359.977) (-364.615) * (-355.517) (-357.986) [-355.712] (-364.409) -- 0:00:50
151500 -- (-355.770) (-365.371) (-357.067) [-356.412] * [-357.356] (-355.728) (-357.419) (-356.908) -- 0:00:50
152000 -- (-358.770) (-360.519) (-357.143) [-355.496] * [-355.763] (-361.123) (-356.426) (-358.123) -- 0:00:50
152500 -- (-355.540) [-356.254] (-363.137) (-358.979) * (-357.007) [-357.279] (-362.318) (-357.041) -- 0:00:50
153000 -- (-356.308) (-357.875) [-359.311] (-359.161) * (-357.625) (-357.845) (-357.308) [-359.411] -- 0:00:49
153500 -- (-355.126) (-361.037) [-355.005] (-355.890) * (-356.995) (-355.910) (-357.019) [-360.218] -- 0:00:55
154000 -- (-357.670) (-356.448) (-359.085) [-355.739] * (-361.697) (-356.944) [-359.314] (-357.245) -- 0:00:54
154500 -- (-356.788) (-360.178) [-357.199] (-359.073) * [-358.530] (-357.847) (-358.548) (-358.158) -- 0:00:54
155000 -- (-355.853) (-357.522) (-357.430) [-360.319] * [-358.077] (-356.688) (-357.241) (-356.042) -- 0:00:54
Average standard deviation of split frequencies: 0.027499
155500 -- (-357.494) (-357.435) [-357.392] (-357.919) * (-358.898) (-357.065) [-358.279] (-355.586) -- 0:00:54
156000 -- (-359.220) [-356.750] (-359.457) (-357.179) * (-356.121) [-357.105] (-356.074) (-356.862) -- 0:00:54
156500 -- (-355.488) (-357.879) (-356.499) [-356.945] * (-355.195) (-356.923) [-358.398] (-356.043) -- 0:00:53
157000 -- (-355.465) (-358.780) (-356.503) [-356.117] * (-358.479) (-357.755) [-360.806] (-356.273) -- 0:00:53
157500 -- (-359.315) (-357.863) (-357.698) [-358.838] * (-356.655) (-359.478) [-357.084] (-358.329) -- 0:00:53
158000 -- [-357.397] (-358.914) (-355.317) (-358.331) * [-357.969] (-356.540) (-356.463) (-356.809) -- 0:00:53
158500 -- [-356.345] (-356.299) (-360.645) (-357.827) * (-357.511) (-355.601) [-357.051] (-360.285) -- 0:00:53
159000 -- (-358.026) [-356.512] (-356.540) (-356.560) * (-356.015) (-360.668) [-355.274] (-360.089) -- 0:00:52
159500 -- (-356.226) (-357.442) [-357.006] (-357.865) * (-355.458) (-362.291) (-360.720) [-356.618] -- 0:00:52
160000 -- [-356.052] (-356.650) (-357.237) (-356.032) * (-355.535) (-356.877) [-358.957] (-357.070) -- 0:00:52
Average standard deviation of split frequencies: 0.024939
160500 -- (-356.725) (-355.887) (-359.721) [-356.353] * (-358.614) (-356.954) [-360.026] (-361.353) -- 0:00:52
161000 -- (-355.930) (-356.738) (-362.345) [-356.013] * (-356.164) (-358.626) [-357.355] (-356.464) -- 0:00:52
161500 -- (-355.333) (-359.809) (-356.165) [-356.184] * [-359.040] (-357.242) (-357.600) (-362.006) -- 0:00:51
162000 -- [-358.836] (-359.614) (-356.768) (-355.638) * (-356.141) (-356.461) (-358.144) [-357.062] -- 0:00:51
162500 -- (-358.023) [-356.489] (-356.936) (-357.788) * (-355.480) [-355.336] (-357.401) (-359.194) -- 0:00:51
163000 -- (-356.496) [-361.195] (-358.191) (-365.086) * [-356.927] (-357.002) (-356.354) (-356.999) -- 0:00:51
163500 -- (-355.888) [-356.875] (-356.832) (-362.263) * (-361.368) (-359.046) (-356.788) [-355.358] -- 0:00:51
164000 -- (-357.510) (-355.530) [-357.267] (-360.035) * (-356.686) (-355.426) [-356.707] (-359.220) -- 0:00:50
164500 -- (-359.600) (-357.256) [-356.761] (-361.484) * (-357.432) (-356.953) [-356.024] (-356.375) -- 0:00:50
165000 -- [-357.372] (-359.007) (-355.390) (-357.446) * (-360.196) (-356.552) [-358.344] (-359.236) -- 0:00:50
Average standard deviation of split frequencies: 0.022313
165500 -- (-356.270) (-358.806) [-356.223] (-356.698) * (-356.404) (-358.235) (-358.729) [-357.352] -- 0:00:50
166000 -- [-357.764] (-357.106) (-357.895) (-357.367) * (-356.762) (-360.325) (-358.057) [-358.560] -- 0:00:50
166500 -- (-360.167) (-357.621) [-356.817] (-356.997) * (-359.570) (-358.286) (-356.387) [-359.501] -- 0:00:50
167000 -- (-355.775) [-361.684] (-359.029) (-358.291) * (-358.762) (-359.162) (-360.028) [-355.479] -- 0:00:49
167500 -- [-357.680] (-364.957) (-355.627) (-356.368) * (-363.016) [-361.283] (-361.530) (-356.627) -- 0:00:49
168000 -- (-356.805) (-355.838) [-356.816] (-356.065) * [-356.562] (-356.760) (-359.015) (-358.567) -- 0:00:49
168500 -- (-356.270) (-358.511) (-355.739) [-356.334] * (-357.230) (-356.206) [-356.283] (-361.809) -- 0:00:49
169000 -- (-356.656) (-357.106) (-360.904) [-357.802] * (-357.370) (-358.841) (-356.689) [-356.596] -- 0:00:49
169500 -- (-356.027) (-356.958) (-360.071) [-356.343] * (-357.134) (-356.769) (-360.568) [-356.773] -- 0:00:48
170000 -- [-356.643] (-357.181) (-360.278) (-355.714) * (-357.000) (-361.099) (-360.911) [-356.286] -- 0:00:48
Average standard deviation of split frequencies: 0.023478
170500 -- (-357.921) [-357.270] (-358.365) (-356.659) * (-365.432) (-359.935) (-357.150) [-357.164] -- 0:00:53
171000 -- (-356.973) [-356.380] (-357.989) (-356.091) * (-357.737) (-358.822) [-357.720] (-355.972) -- 0:00:53
171500 -- (-356.538) (-356.048) [-359.469] (-362.357) * (-355.857) [-358.023] (-358.129) (-355.864) -- 0:00:53
172000 -- (-361.588) (-359.269) (-357.318) [-356.621] * [-357.620] (-356.685) (-356.051) (-360.111) -- 0:00:52
172500 -- [-357.381] (-358.750) (-358.387) (-361.498) * (-359.222) [-356.057] (-356.687) (-360.615) -- 0:00:52
173000 -- (-356.008) (-358.583) [-355.973] (-356.239) * (-356.416) [-359.943] (-355.851) (-357.174) -- 0:00:52
173500 -- (-358.701) [-361.379] (-358.041) (-355.882) * (-357.506) (-356.498) [-357.113] (-356.762) -- 0:00:52
174000 -- (-357.427) [-359.101] (-359.441) (-355.340) * (-357.204) (-357.801) [-355.323] (-355.974) -- 0:00:52
174500 -- (-358.611) (-357.428) [-356.439] (-355.269) * (-358.092) [-355.156] (-356.542) (-361.771) -- 0:00:52
175000 -- (-356.246) (-357.139) [-359.554] (-361.709) * (-356.886) (-358.700) [-360.427] (-359.368) -- 0:00:51
Average standard deviation of split frequencies: 0.021005
175500 -- (-355.568) [-356.619] (-357.700) (-357.247) * (-361.698) (-358.034) [-357.716] (-358.146) -- 0:00:51
176000 -- (-356.493) (-356.993) [-358.844] (-360.760) * (-356.107) (-358.568) [-356.969] (-356.357) -- 0:00:51
176500 -- [-357.985] (-360.676) (-358.612) (-356.116) * (-362.826) (-360.417) (-357.009) [-359.370] -- 0:00:51
177000 -- (-356.783) (-360.139) [-357.917] (-356.179) * (-358.129) (-357.205) (-358.253) [-357.557] -- 0:00:51
177500 -- (-356.500) (-356.119) (-361.590) [-356.603] * (-357.028) [-355.963] (-356.930) (-358.453) -- 0:00:50
178000 -- (-355.307) [-356.285] (-359.222) (-356.065) * (-360.550) [-360.222] (-357.896) (-355.938) -- 0:00:50
178500 -- (-355.624) (-356.319) [-360.838] (-357.720) * [-355.781] (-364.684) (-355.537) (-355.833) -- 0:00:50
179000 -- (-357.924) (-358.202) [-359.912] (-359.006) * (-360.084) [-361.865] (-357.983) (-357.793) -- 0:00:50
179500 -- (-357.638) (-361.897) [-358.036] (-360.277) * (-357.904) (-356.754) (-355.712) [-360.269] -- 0:00:50
180000 -- [-357.196] (-357.485) (-363.515) (-357.394) * [-359.228] (-358.984) (-356.971) (-358.983) -- 0:00:50
Average standard deviation of split frequencies: 0.021004
180500 -- [-356.574] (-360.383) (-357.412) (-360.762) * (-359.227) [-357.144] (-355.449) (-357.514) -- 0:00:49
181000 -- (-355.409) (-359.247) [-356.882] (-360.244) * (-356.489) [-357.611] (-357.660) (-357.088) -- 0:00:49
181500 -- [-356.267] (-355.960) (-360.367) (-360.121) * (-358.055) (-357.348) [-357.926] (-355.883) -- 0:00:49
182000 -- (-356.851) [-357.075] (-358.322) (-356.903) * [-356.669] (-363.534) (-355.576) (-359.419) -- 0:00:49
182500 -- (-357.766) [-357.791] (-361.002) (-357.191) * (-358.677) (-365.935) [-359.707] (-358.300) -- 0:00:49
183000 -- (-356.939) (-357.704) (-358.181) [-356.672] * [-355.716] (-357.365) (-358.457) (-358.218) -- 0:00:49
183500 -- (-357.291) (-362.488) (-355.343) [-357.143] * (-356.591) (-357.876) (-358.194) [-357.206] -- 0:00:48
184000 -- (-358.766) [-356.116] (-356.240) (-359.061) * (-360.962) [-359.880] (-357.302) (-357.081) -- 0:00:48
184500 -- (-360.079) (-358.539) [-358.098] (-359.066) * (-356.827) (-357.130) (-357.741) [-358.691] -- 0:00:48
185000 -- (-357.686) [-365.093] (-360.988) (-356.975) * (-360.292) [-357.816] (-360.549) (-355.820) -- 0:00:48
Average standard deviation of split frequencies: 0.020402
185500 -- (-355.785) [-356.650] (-362.256) (-357.648) * (-357.221) (-356.603) (-357.939) [-355.318] -- 0:00:48
186000 -- (-361.336) (-357.619) (-357.591) [-358.371] * (-356.153) (-357.166) [-355.486] (-357.725) -- 0:00:48
186500 -- (-355.706) [-355.634] (-358.190) (-356.621) * [-359.998] (-360.527) (-355.188) (-360.328) -- 0:00:47
187000 -- (-359.744) [-359.569] (-357.823) (-357.255) * [-357.788] (-360.052) (-357.979) (-355.611) -- 0:00:52
187500 -- [-356.803] (-356.457) (-358.423) (-354.964) * (-358.773) (-357.019) (-355.808) [-358.936] -- 0:00:52
188000 -- (-358.137) (-357.469) (-359.359) [-355.972] * (-359.302) (-356.943) [-360.058] (-357.753) -- 0:00:51
188500 -- (-361.237) [-357.898] (-356.513) (-356.559) * (-359.021) (-357.871) [-357.303] (-355.839) -- 0:00:51
189000 -- (-357.769) [-356.898] (-358.103) (-361.259) * (-357.136) (-357.588) [-357.876] (-355.879) -- 0:00:51
189500 -- [-356.652] (-356.304) (-358.794) (-355.955) * (-356.696) [-357.649] (-356.681) (-355.579) -- 0:00:51
190000 -- (-358.126) [-356.946] (-363.658) (-356.372) * (-356.441) (-356.695) [-356.278] (-356.149) -- 0:00:51
Average standard deviation of split frequencies: 0.020026
190500 -- (-356.360) [-356.927] (-358.019) (-357.173) * (-355.988) (-357.616) (-357.668) [-356.702] -- 0:00:50
191000 -- [-357.755] (-357.735) (-355.667) (-359.775) * (-356.324) [-354.902] (-355.462) (-358.324) -- 0:00:50
191500 -- [-356.192] (-361.413) (-356.021) (-355.440) * [-357.732] (-356.445) (-359.779) (-359.732) -- 0:00:50
192000 -- (-357.619) (-357.378) (-361.103) [-363.521] * (-356.479) (-357.493) [-360.116] (-355.732) -- 0:00:50
192500 -- [-358.850] (-357.420) (-360.426) (-358.625) * [-356.435] (-360.222) (-361.870) (-357.419) -- 0:00:50
193000 -- [-357.703] (-362.307) (-358.886) (-356.877) * (-356.073) (-359.738) [-357.830] (-358.355) -- 0:00:50
193500 -- (-355.047) [-356.674] (-360.944) (-355.428) * [-359.060] (-355.270) (-357.780) (-356.736) -- 0:00:50
194000 -- (-356.779) [-355.804] (-359.395) (-357.027) * [-356.909] (-355.271) (-362.898) (-356.684) -- 0:00:49
194500 -- (-355.712) [-356.635] (-357.877) (-356.733) * [-355.753] (-361.575) (-359.848) (-357.282) -- 0:00:49
195000 -- (-359.712) (-357.462) (-355.158) [-355.727] * [-360.170] (-355.989) (-358.002) (-357.410) -- 0:00:49
Average standard deviation of split frequencies: 0.020203
195500 -- (-355.644) (-360.027) (-361.062) [-355.010] * (-358.543) (-357.958) [-356.413] (-359.274) -- 0:00:49
196000 -- (-358.810) [-356.102] (-357.360) (-357.535) * (-358.043) (-357.591) [-357.433] (-361.113) -- 0:00:49
196500 -- [-356.046] (-355.563) (-358.557) (-357.991) * (-355.397) (-357.831) [-356.334] (-358.506) -- 0:00:49
197000 -- [-357.343] (-357.122) (-362.722) (-357.026) * [-357.633] (-358.399) (-358.062) (-359.315) -- 0:00:48
197500 -- [-356.949] (-359.289) (-358.837) (-355.801) * (-356.780) (-358.939) [-356.864] (-362.325) -- 0:00:48
198000 -- [-357.481] (-359.052) (-362.268) (-359.463) * (-357.078) (-361.250) [-357.806] (-357.551) -- 0:00:48
198500 -- (-359.026) [-355.851] (-361.286) (-359.368) * (-364.748) [-357.685] (-355.760) (-356.059) -- 0:00:48
199000 -- (-357.392) (-355.926) (-357.344) [-355.849] * [-358.759] (-361.728) (-358.895) (-356.042) -- 0:00:48
199500 -- [-356.994] (-357.721) (-356.065) (-355.323) * [-363.254] (-355.236) (-356.519) (-358.329) -- 0:00:48
200000 -- (-358.045) [-356.277] (-355.457) (-360.755) * [-361.529] (-356.738) (-356.167) (-355.880) -- 0:00:48
Average standard deviation of split frequencies: 0.019851
200500 -- (-356.888) (-356.660) [-356.373] (-359.395) * (-356.798) (-356.186) (-358.554) [-355.214] -- 0:00:47
201000 -- (-357.354) [-356.034] (-358.397) (-363.012) * (-356.981) (-356.485) [-357.017] (-356.657) -- 0:00:47
201500 -- [-357.491] (-356.636) (-355.376) (-359.353) * [-359.954] (-358.447) (-358.885) (-357.858) -- 0:00:47
202000 -- (-357.779) (-359.116) (-357.376) [-359.949] * [-355.304] (-355.910) (-357.980) (-361.040) -- 0:00:47
202500 -- [-356.925] (-356.719) (-357.546) (-356.673) * (-355.246) (-356.554) (-356.259) [-356.602] -- 0:00:47
203000 -- (-359.707) (-359.872) [-357.282] (-358.544) * (-356.762) (-355.523) [-356.081] (-358.979) -- 0:00:47
203500 -- [-355.718] (-358.512) (-359.217) (-358.498) * (-359.462) [-361.265] (-359.161) (-357.514) -- 0:00:50
204000 -- (-357.151) (-357.100) [-355.894] (-360.975) * [-357.822] (-355.850) (-357.147) (-356.989) -- 0:00:50
204500 -- (-356.429) (-363.994) [-356.762] (-356.712) * (-356.137) (-358.111) [-356.402] (-356.213) -- 0:00:50
205000 -- (-355.711) (-357.801) [-357.942] (-358.569) * [-357.229] (-357.543) (-355.585) (-357.670) -- 0:00:50
Average standard deviation of split frequencies: 0.018536
205500 -- [-357.772] (-356.809) (-359.471) (-359.671) * (-356.672) [-358.774] (-355.823) (-357.017) -- 0:00:50
206000 -- (-357.869) [-357.781] (-356.326) (-356.929) * (-358.956) [-357.661] (-355.485) (-357.759) -- 0:00:50
206500 -- (-355.577) (-356.741) [-356.812] (-359.899) * (-361.207) [-355.900] (-355.593) (-357.733) -- 0:00:49
207000 -- (-356.100) [-356.027] (-358.182) (-358.507) * (-359.462) [-356.852] (-356.415) (-358.835) -- 0:00:49
207500 -- (-357.793) (-358.191) [-357.882] (-357.559) * (-359.517) [-357.002] (-359.655) (-356.572) -- 0:00:49
208000 -- (-358.558) (-356.498) (-357.452) [-357.914] * (-357.616) [-355.295] (-357.735) (-356.412) -- 0:00:49
208500 -- (-360.861) (-355.413) (-355.989) [-356.699] * [-357.766] (-357.516) (-358.488) (-363.360) -- 0:00:49
209000 -- (-363.339) (-355.757) [-355.047] (-356.281) * (-358.772) (-357.875) [-362.322] (-357.439) -- 0:00:49
209500 -- (-359.910) [-356.989] (-356.898) (-357.166) * (-360.192) (-361.016) (-358.936) [-357.060] -- 0:00:49
210000 -- (-359.156) (-355.828) [-356.154] (-360.001) * (-361.899) (-357.376) (-356.815) [-359.203] -- 0:00:48
Average standard deviation of split frequencies: 0.018274
210500 -- (-355.532) (-364.080) [-355.595] (-358.227) * [-355.827] (-356.019) (-360.516) (-357.019) -- 0:00:48
211000 -- [-356.301] (-360.493) (-355.372) (-355.504) * (-355.170) (-356.461) [-356.794] (-357.972) -- 0:00:48
211500 -- (-359.593) [-362.715] (-356.270) (-356.236) * (-358.146) [-359.496] (-356.106) (-356.831) -- 0:00:48
212000 -- (-360.133) (-358.749) [-355.040] (-356.494) * (-359.378) (-361.061) (-357.505) [-357.013] -- 0:00:48
212500 -- (-357.295) (-361.544) [-354.956] (-360.380) * (-356.359) (-358.512) (-360.639) [-356.545] -- 0:00:48
213000 -- (-357.734) [-357.939] (-357.042) (-357.074) * (-357.343) (-357.416) [-357.935] (-357.145) -- 0:00:48
213500 -- (-359.143) [-359.212] (-356.797) (-356.340) * [-357.054] (-363.352) (-357.531) (-357.337) -- 0:00:47
214000 -- (-355.839) [-355.313] (-357.514) (-358.088) * (-355.780) [-356.589] (-358.252) (-356.066) -- 0:00:47
214500 -- (-357.584) (-358.611) [-358.459] (-357.023) * [-355.915] (-359.646) (-359.466) (-364.135) -- 0:00:47
215000 -- (-357.158) [-356.369] (-356.594) (-358.947) * (-356.819) [-357.916] (-359.314) (-359.418) -- 0:00:47
Average standard deviation of split frequencies: 0.017459
215500 -- (-357.242) [-358.203] (-356.853) (-356.935) * [-356.521] (-355.518) (-361.240) (-358.179) -- 0:00:47
216000 -- (-356.785) [-356.488] (-356.623) (-356.932) * (-356.986) [-356.161] (-355.129) (-357.149) -- 0:00:47
216500 -- (-356.027) [-356.115] (-356.981) (-355.449) * [-357.176] (-355.697) (-358.568) (-357.036) -- 0:00:47
217000 -- (-356.538) [-357.545] (-356.106) (-356.736) * (-356.943) (-358.863) (-355.739) [-358.338] -- 0:00:46
217500 -- (-360.327) (-358.903) (-357.253) [-355.237] * (-356.585) [-357.991] (-356.363) (-357.658) -- 0:00:46
218000 -- [-356.713] (-359.788) (-358.246) (-356.527) * (-356.533) (-358.083) [-356.348] (-357.637) -- 0:00:46
218500 -- (-358.620) (-358.677) [-358.886] (-358.148) * [-356.996] (-356.534) (-356.092) (-356.325) -- 0:00:46
219000 -- [-359.698] (-358.670) (-359.042) (-358.674) * (-356.481) (-359.788) [-356.750] (-358.163) -- 0:00:46
219500 -- (-361.054) (-355.789) (-357.566) [-358.484] * (-356.258) (-357.336) [-357.013] (-355.543) -- 0:00:46
220000 -- (-358.049) (-357.296) (-359.131) [-361.162] * (-358.338) (-356.993) (-356.185) [-356.425] -- 0:00:46
Average standard deviation of split frequencies: 0.018277
220500 -- (-360.146) [-356.263] (-359.607) (-362.259) * (-358.604) [-356.177] (-355.862) (-357.486) -- 0:00:49
221000 -- [-356.268] (-362.079) (-359.628) (-357.249) * (-356.915) (-356.775) (-360.222) [-356.083] -- 0:00:49
221500 -- [-356.402] (-358.128) (-357.042) (-356.880) * (-356.602) (-358.465) (-357.481) [-355.322] -- 0:00:49
222000 -- [-355.460] (-355.794) (-355.518) (-358.213) * [-356.603] (-358.093) (-356.568) (-355.606) -- 0:00:49
222500 -- (-359.055) (-357.970) (-361.466) [-357.044] * (-356.553) [-355.871] (-357.443) (-363.186) -- 0:00:48
223000 -- (-358.875) (-359.712) [-357.507] (-357.503) * (-355.606) (-357.446) [-358.759] (-360.642) -- 0:00:48
223500 -- (-356.900) (-356.754) [-355.518] (-357.157) * (-356.294) [-355.963] (-356.029) (-358.878) -- 0:00:48
224000 -- (-356.019) (-356.626) (-357.627) [-357.656] * [-357.987] (-357.247) (-357.957) (-356.333) -- 0:00:48
224500 -- (-359.331) (-356.190) (-356.351) [-360.969] * [-357.635] (-358.002) (-356.948) (-356.808) -- 0:00:48
225000 -- (-358.726) (-357.269) [-356.429] (-356.329) * (-357.686) (-357.603) [-357.159] (-355.806) -- 0:00:48
Average standard deviation of split frequencies: 0.017126
225500 -- [-358.763] (-356.611) (-362.061) (-361.488) * (-359.742) [-355.802] (-358.558) (-361.885) -- 0:00:48
226000 -- (-356.174) (-360.339) [-358.455] (-356.823) * (-355.942) (-356.999) [-355.423] (-361.037) -- 0:00:47
226500 -- [-355.758] (-356.933) (-357.911) (-358.316) * (-358.498) (-355.735) [-355.659] (-359.483) -- 0:00:47
227000 -- (-358.190) (-357.571) [-356.568] (-357.611) * (-359.211) (-357.159) [-356.413] (-356.453) -- 0:00:47
227500 -- (-357.774) (-361.055) [-355.603] (-362.370) * (-360.947) [-356.898] (-356.166) (-355.686) -- 0:00:47
228000 -- (-358.812) (-359.323) (-355.874) [-356.330] * (-356.561) [-356.654] (-355.956) (-359.559) -- 0:00:47
228500 -- (-358.354) (-360.346) [-358.461] (-357.273) * (-358.218) [-357.100] (-358.687) (-357.833) -- 0:00:47
229000 -- [-360.031] (-358.567) (-358.519) (-358.451) * (-358.941) (-359.624) [-355.485] (-358.448) -- 0:00:47
229500 -- (-355.994) (-357.847) (-361.887) [-357.122] * (-358.402) (-359.273) [-357.639] (-355.522) -- 0:00:47
230000 -- (-356.490) [-360.223] (-357.193) (-356.476) * [-357.900] (-357.698) (-356.138) (-355.937) -- 0:00:46
Average standard deviation of split frequencies: 0.016349
230500 -- [-358.546] (-355.924) (-355.754) (-358.420) * (-355.936) (-360.431) [-360.555] (-362.019) -- 0:00:46
231000 -- [-356.982] (-356.688) (-355.684) (-362.724) * (-357.074) [-356.291] (-359.312) (-360.499) -- 0:00:46
231500 -- (-355.417) (-357.392) (-355.672) [-355.999] * [-355.906] (-357.364) (-355.538) (-357.302) -- 0:00:46
232000 -- (-356.315) (-356.926) (-361.261) [-356.356] * [-359.501] (-355.882) (-358.623) (-360.076) -- 0:00:46
232500 -- (-357.283) (-356.228) [-358.808] (-358.416) * (-356.643) [-358.559] (-355.635) (-358.706) -- 0:00:46
233000 -- (-359.360) [-357.588] (-356.436) (-358.110) * (-357.180) (-359.137) [-357.782] (-361.617) -- 0:00:46
233500 -- (-356.878) (-357.801) (-360.288) [-356.011] * (-355.265) [-358.443] (-363.572) (-359.360) -- 0:00:45
234000 -- (-355.596) (-357.185) (-360.108) [-355.707] * (-359.613) (-359.711) (-363.447) [-356.740] -- 0:00:45
234500 -- (-356.132) (-355.460) [-359.944] (-355.626) * (-359.989) (-355.272) [-357.825] (-357.739) -- 0:00:45
235000 -- (-355.696) (-359.290) (-358.876) [-356.635] * [-359.870] (-356.633) (-368.037) (-357.700) -- 0:00:45
Average standard deviation of split frequencies: 0.016646
235500 -- (-356.144) (-358.561) [-357.073] (-357.707) * [-357.332] (-358.328) (-355.287) (-359.880) -- 0:00:45
236000 -- (-358.239) (-358.084) [-357.580] (-357.031) * [-357.436] (-357.276) (-359.794) (-356.111) -- 0:00:45
236500 -- [-357.157] (-355.562) (-359.181) (-359.555) * (-357.986) (-356.885) (-358.730) [-357.286] -- 0:00:45
237000 -- [-355.452] (-355.123) (-356.040) (-357.748) * (-359.090) (-356.080) [-356.017] (-357.035) -- 0:00:45
237500 -- (-356.091) (-356.823) (-355.669) [-357.016] * (-356.286) (-356.778) [-357.487] (-357.279) -- 0:00:48
238000 -- [-355.907] (-356.833) (-357.339) (-360.858) * [-358.535] (-356.352) (-355.478) (-359.082) -- 0:00:48
238500 -- (-354.953) [-356.909] (-357.654) (-361.337) * (-355.265) (-356.345) [-357.486] (-360.518) -- 0:00:47
239000 -- (-357.429) (-358.793) [-356.253] (-358.368) * (-357.696) (-357.427) (-357.239) [-355.320] -- 0:00:47
239500 -- [-356.481] (-358.084) (-356.187) (-359.619) * (-358.211) [-356.174] (-356.400) (-357.056) -- 0:00:47
240000 -- (-359.747) (-356.072) [-357.065] (-357.340) * (-357.756) (-355.404) [-356.519] (-360.338) -- 0:00:47
Average standard deviation of split frequencies: 0.016185
240500 -- (-357.993) [-356.904] (-357.573) (-357.641) * (-361.211) (-356.553) (-357.621) [-356.290] -- 0:00:47
241000 -- (-361.241) (-359.321) (-357.464) [-362.372] * (-357.019) [-354.987] (-358.603) (-360.052) -- 0:00:47
241500 -- (-355.626) [-356.144] (-355.549) (-359.537) * (-359.544) (-360.075) (-359.774) [-356.075] -- 0:00:47
242000 -- [-357.824] (-357.768) (-356.577) (-357.200) * (-356.650) (-358.075) (-358.552) [-355.559] -- 0:00:46
242500 -- (-357.932) (-355.116) [-357.870] (-356.560) * (-356.431) (-356.695) (-359.485) [-357.042] -- 0:00:46
243000 -- (-358.048) (-361.170) [-359.592] (-356.746) * (-357.783) (-356.142) (-355.377) [-358.153] -- 0:00:46
243500 -- (-358.349) (-359.359) [-355.707] (-358.556) * [-358.107] (-357.721) (-355.415) (-355.634) -- 0:00:46
244000 -- [-355.379] (-356.138) (-359.594) (-355.174) * [-359.453] (-361.259) (-356.192) (-356.321) -- 0:00:46
244500 -- [-355.845] (-356.890) (-358.420) (-356.363) * [-355.776] (-355.770) (-356.868) (-358.496) -- 0:00:46
245000 -- [-356.460] (-360.523) (-358.814) (-358.155) * [-357.930] (-355.692) (-358.366) (-359.154) -- 0:00:46
Average standard deviation of split frequencies: 0.016193
245500 -- [-357.761] (-357.903) (-356.452) (-359.697) * (-358.459) [-357.073] (-356.317) (-362.351) -- 0:00:46
246000 -- (-360.527) [-360.707] (-356.714) (-360.262) * (-357.077) (-356.671) [-357.346] (-357.727) -- 0:00:45
246500 -- [-358.576] (-360.794) (-356.396) (-356.847) * (-359.316) [-357.163] (-358.940) (-355.790) -- 0:00:45
247000 -- (-356.435) [-356.636] (-356.913) (-359.814) * [-357.599] (-357.869) (-356.353) (-356.827) -- 0:00:45
247500 -- (-358.908) (-356.934) [-356.192] (-355.790) * (-356.102) [-359.311] (-357.159) (-355.056) -- 0:00:45
248000 -- (-355.960) [-356.000] (-355.827) (-356.795) * (-357.157) (-358.953) (-356.613) [-356.955] -- 0:00:45
248500 -- (-357.580) (-357.451) (-357.722) [-356.184] * (-361.154) [-358.374] (-356.994) (-360.206) -- 0:00:45
249000 -- (-358.865) [-357.330] (-356.345) (-357.463) * (-360.490) (-358.383) (-355.047) [-358.373] -- 0:00:45
249500 -- (-356.975) [-356.273] (-356.370) (-362.217) * [-357.111] (-361.025) (-356.396) (-357.274) -- 0:00:45
250000 -- (-357.857) (-359.114) (-360.142) [-357.157] * [-357.228] (-356.473) (-360.864) (-361.420) -- 0:00:45
Average standard deviation of split frequencies: 0.016035
250500 -- (-355.365) (-355.593) [-358.162] (-360.762) * (-356.378) (-355.642) [-357.542] (-357.491) -- 0:00:44
251000 -- (-359.116) (-361.560) (-356.772) [-357.738] * (-356.915) [-355.177] (-357.212) (-356.652) -- 0:00:44
251500 -- (-360.402) [-355.418] (-359.079) (-356.672) * (-356.258) (-357.828) (-357.125) [-356.537] -- 0:00:44
252000 -- (-360.144) (-358.435) (-358.928) [-358.130] * (-356.794) (-358.405) [-355.378] (-355.922) -- 0:00:44
252500 -- (-366.580) (-356.964) (-357.500) [-358.253] * [-358.281] (-356.126) (-356.888) (-356.021) -- 0:00:44
253000 -- [-363.066] (-356.925) (-355.920) (-360.065) * (-359.802) (-358.131) [-355.880] (-356.715) -- 0:00:44
253500 -- (-359.147) [-355.777] (-359.809) (-360.997) * [-355.858] (-358.111) (-360.764) (-356.957) -- 0:00:44
254000 -- (-357.780) [-357.609] (-356.172) (-359.607) * [-357.765] (-360.230) (-356.397) (-355.837) -- 0:00:46
254500 -- (-357.778) [-356.731] (-356.940) (-356.099) * [-356.332] (-357.296) (-355.992) (-359.848) -- 0:00:46
255000 -- (-357.601) (-358.845) (-356.100) [-360.480] * [-356.957] (-360.576) (-356.714) (-358.904) -- 0:00:46
Average standard deviation of split frequencies: 0.015836
255500 -- (-355.968) [-360.879] (-356.959) (-357.739) * (-357.858) (-357.172) [-356.531] (-356.453) -- 0:00:46
256000 -- (-356.073) (-359.525) (-357.412) [-358.384] * (-357.535) (-356.010) [-358.220] (-355.205) -- 0:00:46
256500 -- [-357.697] (-356.508) (-360.589) (-362.214) * (-357.427) [-357.442] (-358.119) (-355.497) -- 0:00:46
257000 -- (-357.060) [-356.262] (-358.684) (-358.070) * (-358.141) [-357.238] (-356.203) (-359.090) -- 0:00:46
257500 -- (-356.492) [-356.970] (-358.180) (-360.284) * (-361.552) [-355.163] (-355.921) (-362.140) -- 0:00:46
258000 -- (-356.226) (-357.015) [-358.110] (-359.583) * (-362.797) (-356.527) [-358.638] (-356.471) -- 0:00:46
258500 -- (-358.979) (-356.829) [-355.899] (-359.273) * (-355.607) (-359.038) (-359.047) [-357.029] -- 0:00:45
259000 -- (-355.955) (-357.960) [-355.519] (-358.000) * (-358.898) (-360.264) (-357.912) [-355.770] -- 0:00:45
259500 -- (-355.281) (-358.210) [-359.714] (-357.136) * (-355.629) (-360.086) (-356.329) [-355.626] -- 0:00:45
260000 -- (-355.725) (-359.120) (-359.132) [-357.795] * (-357.656) (-356.072) [-357.794] (-358.192) -- 0:00:45
Average standard deviation of split frequencies: 0.016095
260500 -- [-357.744] (-358.414) (-360.057) (-357.620) * (-357.300) (-357.086) [-357.874] (-359.537) -- 0:00:45
261000 -- [-356.766] (-358.517) (-358.927) (-358.157) * (-355.814) (-359.009) (-358.246) [-355.346] -- 0:00:45
261500 -- (-359.211) (-358.461) [-355.473] (-356.302) * (-356.970) [-356.769] (-362.423) (-355.774) -- 0:00:45
262000 -- (-360.195) (-355.268) [-356.056] (-357.999) * (-356.560) (-358.347) [-360.852] (-357.757) -- 0:00:45
262500 -- (-361.067) (-358.162) [-355.599] (-357.554) * (-355.185) (-361.737) (-359.233) [-357.250] -- 0:00:44
263000 -- (-356.969) (-360.494) (-355.599) [-355.659] * (-355.391) (-356.891) [-356.103] (-355.788) -- 0:00:44
263500 -- (-355.923) (-357.031) (-356.685) [-356.797] * (-356.830) (-356.559) [-357.459] (-359.790) -- 0:00:44
264000 -- (-356.272) (-356.814) [-358.055] (-356.472) * (-357.934) (-356.376) [-357.937] (-360.773) -- 0:00:44
264500 -- (-356.686) [-357.192] (-357.871) (-355.881) * (-360.148) [-355.926] (-356.974) (-357.215) -- 0:00:44
265000 -- (-355.524) (-358.417) (-357.885) [-356.569] * (-358.395) (-355.832) (-357.381) [-361.205] -- 0:00:44
Average standard deviation of split frequencies: 0.016514
265500 -- (-356.321) (-358.845) [-356.060] (-357.271) * (-357.535) (-355.703) [-356.434] (-359.961) -- 0:00:44
266000 -- (-359.499) (-360.780) [-357.542] (-356.208) * (-357.371) (-355.058) (-358.850) [-358.698] -- 0:00:44
266500 -- (-356.217) [-356.200] (-357.510) (-358.385) * (-357.291) (-357.612) [-359.231] (-360.603) -- 0:00:44
267000 -- (-365.201) [-356.601] (-356.301) (-359.085) * [-357.244] (-358.248) (-357.394) (-356.596) -- 0:00:43
267500 -- (-356.187) (-357.588) [-356.478] (-355.845) * (-356.757) (-358.102) (-361.270) [-356.047] -- 0:00:43
268000 -- (-355.571) [-358.830] (-356.872) (-356.423) * (-357.086) (-356.224) (-356.717) [-356.858] -- 0:00:43
268500 -- (-357.694) (-358.857) [-360.597] (-358.593) * [-355.281] (-359.080) (-358.669) (-356.169) -- 0:00:43
269000 -- (-358.123) (-359.464) (-357.921) [-360.195] * (-358.909) (-357.214) (-357.265) [-356.052] -- 0:00:43
269500 -- (-359.358) (-356.851) (-358.829) [-359.743] * (-355.645) (-357.768) [-356.601] (-356.514) -- 0:00:43
270000 -- (-358.358) (-356.144) [-357.896] (-355.963) * (-356.790) (-359.714) [-360.529] (-356.974) -- 0:00:43
Average standard deviation of split frequencies: 0.016150
270500 -- [-358.340] (-355.652) (-356.557) (-356.767) * [-357.757] (-359.953) (-355.350) (-357.093) -- 0:00:43
271000 -- (-355.375) (-361.299) (-357.184) [-357.938] * (-358.338) (-357.092) (-357.198) [-356.541] -- 0:00:43
271500 -- (-358.012) [-356.073] (-362.072) (-360.661) * (-356.392) (-357.095) (-356.439) [-360.697] -- 0:00:45
272000 -- (-358.314) (-355.462) [-359.517] (-360.196) * (-356.777) [-360.038] (-356.871) (-356.549) -- 0:00:45
272500 -- (-359.297) (-357.312) [-357.121] (-359.924) * [-359.267] (-357.098) (-356.994) (-361.320) -- 0:00:45
273000 -- [-357.913] (-356.539) (-356.127) (-359.051) * [-357.316] (-362.166) (-357.268) (-359.845) -- 0:00:45
273500 -- (-356.242) (-358.369) (-357.496) [-356.296] * (-356.649) [-358.617] (-356.705) (-356.656) -- 0:00:45
274000 -- (-357.142) (-356.997) [-355.289] (-355.556) * [-356.419] (-357.794) (-357.082) (-358.982) -- 0:00:45
274500 -- (-359.261) (-356.063) (-358.675) [-357.240] * (-356.959) [-357.205] (-359.808) (-359.559) -- 0:00:44
275000 -- (-360.391) (-360.373) [-357.158] (-356.574) * (-356.312) (-360.935) [-357.080] (-355.645) -- 0:00:44
Average standard deviation of split frequencies: 0.015941
275500 -- (-361.434) (-356.796) (-356.324) [-357.083] * (-355.397) (-357.952) [-355.005] (-356.347) -- 0:00:44
276000 -- [-356.599] (-358.594) (-358.654) (-356.575) * (-357.272) [-357.070] (-355.751) (-360.484) -- 0:00:44
276500 -- (-357.086) [-357.037] (-355.966) (-359.507) * (-359.486) (-358.241) (-357.965) [-360.794] -- 0:00:44
277000 -- [-356.780] (-356.577) (-358.482) (-361.259) * (-356.478) (-357.219) [-356.034] (-358.973) -- 0:00:44
277500 -- (-355.936) [-359.555] (-360.048) (-356.530) * (-357.587) (-357.692) (-357.176) [-359.523] -- 0:00:44
278000 -- [-356.571] (-357.660) (-357.149) (-356.324) * (-361.420) (-357.670) (-358.632) [-356.064] -- 0:00:44
278500 -- (-355.979) (-357.381) [-358.469] (-356.412) * [-356.858] (-357.120) (-357.914) (-357.589) -- 0:00:44
279000 -- (-357.909) (-356.434) (-357.349) [-355.032] * (-356.754) [-357.127] (-357.917) (-356.815) -- 0:00:43
279500 -- [-357.379] (-355.691) (-356.340) (-355.409) * (-356.902) [-362.712] (-359.652) (-356.044) -- 0:00:43
280000 -- (-356.846) (-356.440) [-357.090] (-357.293) * [-358.420] (-357.496) (-357.861) (-357.097) -- 0:00:43
Average standard deviation of split frequencies: 0.016208
280500 -- (-356.915) [-358.054] (-357.024) (-357.341) * (-355.885) (-358.773) [-357.836] (-356.978) -- 0:00:43
281000 -- (-357.659) (-358.322) [-358.309] (-356.386) * (-356.860) [-357.850] (-357.271) (-358.557) -- 0:00:43
281500 -- (-356.778) (-357.990) (-356.718) [-357.492] * [-358.858] (-360.184) (-356.984) (-357.325) -- 0:00:43
282000 -- (-356.000) (-357.448) (-357.530) [-358.415] * [-355.861] (-363.708) (-356.607) (-356.295) -- 0:00:43
282500 -- (-357.341) (-359.559) (-355.266) [-358.451] * [-355.704] (-356.473) (-358.301) (-357.849) -- 0:00:43
283000 -- (-355.559) [-358.374] (-356.273) (-356.335) * [-357.585] (-356.844) (-355.932) (-362.477) -- 0:00:43
283500 -- (-355.710) [-361.128] (-356.644) (-360.712) * (-357.590) (-361.129) [-360.264] (-359.011) -- 0:00:42
284000 -- (-356.760) (-357.220) [-358.613] (-363.728) * (-356.737) (-356.140) (-360.067) [-358.116] -- 0:00:42
284500 -- (-356.713) (-358.038) [-357.017] (-361.488) * (-357.287) (-355.327) [-355.540] (-358.290) -- 0:00:42
285000 -- (-355.258) (-359.345) [-356.554] (-355.933) * [-355.960] (-357.236) (-356.354) (-356.078) -- 0:00:42
Average standard deviation of split frequencies: 0.016071
285500 -- (-359.785) (-358.837) (-357.028) [-355.186] * (-357.110) [-358.810] (-357.937) (-355.837) -- 0:00:42
286000 -- [-358.893] (-357.025) (-361.812) (-359.999) * [-358.765] (-358.841) (-357.619) (-358.391) -- 0:00:42
286500 -- (-356.396) (-360.960) (-355.657) [-356.166] * [-356.732] (-357.350) (-362.517) (-357.051) -- 0:00:42
287000 -- (-356.820) (-361.336) (-360.977) [-357.187] * (-355.521) [-355.670] (-355.096) (-355.254) -- 0:00:42
287500 -- (-356.410) (-357.563) [-356.101] (-358.084) * (-355.376) (-355.771) (-356.794) [-355.879] -- 0:00:42
288000 -- [-358.660] (-359.085) (-356.237) (-359.145) * (-358.767) (-360.045) (-358.870) [-355.103] -- 0:00:42
288500 -- (-357.527) [-357.437] (-359.199) (-357.244) * [-357.944] (-357.291) (-356.061) (-356.677) -- 0:00:44
289000 -- (-355.386) [-360.506] (-359.119) (-356.448) * [-356.802] (-356.043) (-356.150) (-362.887) -- 0:00:44
289500 -- (-359.452) (-357.332) [-359.158] (-358.332) * (-355.348) [-359.205] (-355.559) (-358.000) -- 0:00:44
290000 -- (-359.291) [-357.390] (-358.216) (-357.362) * [-356.629] (-357.991) (-356.511) (-359.904) -- 0:00:44
Average standard deviation of split frequencies: 0.015962
290500 -- (-360.284) (-358.473) (-359.510) [-355.903] * [-355.697] (-355.749) (-357.118) (-356.372) -- 0:00:43
291000 -- (-356.595) (-356.702) (-356.136) [-356.509] * (-357.175) (-356.137) (-357.194) [-357.747] -- 0:00:43
291500 -- (-358.550) [-356.642] (-356.381) (-357.905) * [-360.930] (-357.913) (-360.611) (-356.388) -- 0:00:43
292000 -- (-360.194) [-359.619] (-356.906) (-355.170) * (-358.159) (-356.002) [-359.464] (-356.350) -- 0:00:43
292500 -- (-360.166) [-356.766] (-356.199) (-356.218) * (-358.085) [-355.901] (-356.865) (-356.750) -- 0:00:43
293000 -- [-356.301] (-358.976) (-356.668) (-356.261) * (-355.928) (-362.336) [-358.207] (-357.362) -- 0:00:43
293500 -- (-357.982) [-360.125] (-360.554) (-356.362) * (-357.884) [-356.335] (-358.357) (-356.896) -- 0:00:43
294000 -- (-358.654) (-361.788) [-358.341] (-357.524) * [-357.415] (-361.975) (-360.215) (-356.600) -- 0:00:43
294500 -- (-359.941) [-355.609] (-361.513) (-356.718) * [-357.611] (-355.080) (-356.946) (-357.993) -- 0:00:43
295000 -- (-361.278) [-357.186] (-355.442) (-360.415) * (-356.351) [-361.214] (-357.738) (-358.432) -- 0:00:43
Average standard deviation of split frequencies: 0.016191
295500 -- (-355.586) (-358.325) [-357.358] (-355.420) * (-358.392) [-356.141] (-355.884) (-356.652) -- 0:00:42
296000 -- (-357.627) (-359.331) [-355.991] (-356.727) * (-359.155) (-357.902) (-357.057) [-355.500] -- 0:00:42
296500 -- (-357.294) (-355.825) [-357.283] (-357.953) * (-358.900) [-358.887] (-359.686) (-358.676) -- 0:00:42
297000 -- (-356.606) (-361.148) [-356.605] (-356.857) * (-356.778) [-356.626] (-357.129) (-356.303) -- 0:00:42
297500 -- [-355.598] (-357.597) (-355.320) (-356.343) * (-356.174) (-359.284) [-355.457] (-357.933) -- 0:00:42
298000 -- [-355.251] (-356.888) (-355.907) (-356.672) * [-355.571] (-358.703) (-358.245) (-356.840) -- 0:00:42
298500 -- (-356.006) (-355.984) [-356.795] (-356.127) * (-357.678) (-356.366) (-356.468) [-355.876] -- 0:00:42
299000 -- [-357.792] (-357.756) (-356.055) (-357.248) * [-357.820] (-357.641) (-360.595) (-357.105) -- 0:00:42
299500 -- (-357.592) (-356.680) (-356.667) [-356.004] * [-359.182] (-355.790) (-355.410) (-358.774) -- 0:00:42
300000 -- (-357.236) [-356.704] (-357.174) (-357.217) * [-355.304] (-358.441) (-355.313) (-359.524) -- 0:00:42
Average standard deviation of split frequencies: 0.015844
300500 -- (-356.066) [-356.368] (-358.242) (-356.151) * (-357.416) (-356.891) [-356.934] (-360.578) -- 0:00:41
301000 -- [-358.434] (-360.626) (-356.681) (-356.997) * (-356.614) (-358.423) [-355.852] (-357.318) -- 0:00:41
301500 -- (-356.785) [-355.914] (-357.693) (-360.212) * (-356.401) (-358.533) (-359.605) [-356.250] -- 0:00:41
302000 -- (-358.980) [-360.171] (-357.593) (-360.463) * [-361.125] (-356.013) (-361.267) (-358.211) -- 0:00:41
302500 -- (-358.033) (-361.005) [-360.436] (-356.334) * (-355.567) (-362.520) [-357.331] (-358.988) -- 0:00:41
303000 -- (-359.059) [-356.175] (-356.708) (-356.224) * (-357.125) (-358.042) (-358.336) [-356.511] -- 0:00:41
303500 -- (-357.314) [-360.782] (-356.559) (-357.865) * [-357.562] (-358.427) (-356.099) (-358.807) -- 0:00:41
304000 -- (-360.949) (-356.958) (-356.166) [-356.827] * (-356.088) (-358.908) (-361.547) [-356.954] -- 0:00:41
304500 -- (-359.465) (-358.418) (-356.358) [-357.705] * (-362.081) [-360.380] (-359.517) (-357.077) -- 0:00:41
305000 -- (-358.375) (-361.189) (-356.448) [-356.426] * (-358.236) (-357.070) (-356.964) [-360.508] -- 0:00:41
Average standard deviation of split frequencies: 0.015251
305500 -- (-357.713) (-361.668) [-356.718] (-357.912) * (-357.602) (-359.330) [-356.544] (-357.588) -- 0:00:43
306000 -- (-362.046) (-357.790) (-357.903) [-357.366] * [-356.708] (-359.942) (-358.110) (-358.047) -- 0:00:43
306500 -- [-359.983] (-356.221) (-361.091) (-355.955) * (-355.040) (-358.147) [-360.797] (-357.274) -- 0:00:42
307000 -- (-357.718) (-355.649) (-356.028) [-355.886] * (-358.113) [-357.407] (-358.033) (-361.850) -- 0:00:42
307500 -- (-357.011) (-358.119) (-357.622) [-357.426] * (-356.186) (-358.205) [-356.587] (-356.030) -- 0:00:42
308000 -- (-355.694) [-356.388] (-357.249) (-356.131) * (-356.436) (-361.392) (-359.414) [-357.967] -- 0:00:42
308500 -- (-359.405) (-356.400) (-357.186) [-356.621] * [-357.525] (-357.152) (-356.796) (-359.512) -- 0:00:42
309000 -- (-355.669) [-357.745] (-355.102) (-359.440) * (-356.273) (-358.654) (-359.202) [-357.763] -- 0:00:42
309500 -- (-357.418) (-356.986) [-356.690] (-356.496) * (-357.549) [-357.194] (-356.390) (-356.133) -- 0:00:42
310000 -- (-361.786) (-359.008) [-356.182] (-359.189) * (-356.502) [-356.741] (-356.745) (-358.970) -- 0:00:42
Average standard deviation of split frequencies: 0.013257
310500 -- (-360.092) (-360.362) (-356.920) [-358.562] * (-355.108) (-359.534) (-356.412) [-358.171] -- 0:00:42
311000 -- (-363.258) (-356.908) (-356.610) [-358.077] * (-359.763) (-357.819) [-357.977] (-357.274) -- 0:00:42
311500 -- (-358.064) [-357.344] (-361.244) (-360.379) * (-357.060) (-357.172) (-356.308) [-356.180] -- 0:00:41
312000 -- (-356.608) [-357.065] (-357.852) (-357.226) * (-356.888) [-357.032] (-360.906) (-358.162) -- 0:00:41
312500 -- (-357.807) (-357.232) (-361.795) [-357.031] * (-355.742) [-356.721] (-360.174) (-361.021) -- 0:00:41
313000 -- (-356.793) (-354.984) (-357.146) [-357.286] * (-356.677) [-355.900] (-356.804) (-358.361) -- 0:00:41
313500 -- (-356.140) (-367.911) [-359.521] (-355.530) * (-355.484) (-356.519) [-358.265] (-357.992) -- 0:00:41
314000 -- (-357.252) (-359.716) (-357.892) [-359.110] * [-356.148] (-357.451) (-357.924) (-358.879) -- 0:00:41
314500 -- (-354.904) (-359.390) [-355.848] (-355.505) * (-358.402) (-356.713) (-357.216) [-357.196] -- 0:00:41
315000 -- (-357.959) (-358.922) (-359.131) [-355.631] * (-357.786) [-362.386] (-357.243) (-358.349) -- 0:00:41
Average standard deviation of split frequencies: 0.015084
315500 -- [-357.375] (-356.097) (-355.530) (-357.213) * [-356.004] (-358.789) (-360.072) (-356.289) -- 0:00:41
316000 -- (-355.795) (-355.497) [-354.964] (-358.427) * [-356.358] (-359.854) (-356.124) (-357.964) -- 0:00:41
316500 -- (-356.265) [-357.833] (-361.823) (-362.624) * (-357.397) [-356.472] (-362.775) (-355.682) -- 0:00:41
317000 -- [-355.497] (-357.393) (-358.175) (-360.666) * (-361.141) (-356.599) [-358.731] (-359.648) -- 0:00:40
317500 -- (-355.419) (-361.152) (-355.962) [-358.538] * [-357.515] (-356.873) (-357.379) (-360.989) -- 0:00:40
318000 -- [-357.879] (-358.709) (-356.214) (-359.125) * [-357.752] (-356.717) (-361.575) (-355.462) -- 0:00:40
318500 -- (-356.630) (-357.552) (-357.465) [-357.079] * (-360.594) (-356.694) (-355.528) [-358.845] -- 0:00:40
319000 -- [-364.465] (-357.681) (-356.835) (-356.593) * (-356.716) (-357.896) [-360.328] (-360.492) -- 0:00:40
319500 -- (-358.298) [-357.111] (-355.929) (-357.990) * (-359.072) (-356.503) [-358.276] (-357.243) -- 0:00:40
320000 -- [-357.526] (-356.112) (-355.130) (-357.056) * (-355.627) (-357.912) (-357.650) [-358.422] -- 0:00:40
Average standard deviation of split frequencies: 0.013577
320500 -- [-359.255] (-357.127) (-357.833) (-356.543) * (-358.357) (-358.041) (-357.084) [-357.030] -- 0:00:40
321000 -- (-356.907) (-357.095) [-359.238] (-356.895) * (-360.836) (-356.692) (-358.002) [-355.755] -- 0:00:40
321500 -- (-357.067) [-356.427] (-357.266) (-355.691) * (-358.152) [-357.528] (-358.871) (-359.654) -- 0:00:40
322000 -- (-358.214) (-358.062) (-357.989) [-357.510] * (-355.998) [-357.408] (-355.978) (-359.362) -- 0:00:42
322500 -- (-357.664) [-359.631] (-359.096) (-356.007) * [-356.526] (-360.061) (-357.653) (-355.290) -- 0:00:42
323000 -- (-355.929) [-357.218] (-358.156) (-356.087) * (-362.136) [-358.130] (-357.563) (-356.492) -- 0:00:41
323500 -- (-356.785) [-358.364] (-359.520) (-358.144) * (-359.782) [-361.883] (-356.419) (-359.483) -- 0:00:41
324000 -- (-357.433) [-358.304] (-363.603) (-357.487) * (-357.379) (-359.149) (-356.464) [-358.581] -- 0:00:41
324500 -- [-356.935] (-359.764) (-367.316) (-358.101) * (-359.462) (-356.874) (-357.759) [-358.270] -- 0:00:41
325000 -- (-358.731) (-356.799) [-358.699] (-356.570) * (-361.266) (-363.324) (-356.376) [-359.107] -- 0:00:41
Average standard deviation of split frequencies: 0.015111
325500 -- (-357.126) (-356.418) (-362.239) [-358.537] * [-358.250] (-358.210) (-356.137) (-357.317) -- 0:00:41
326000 -- [-357.108] (-355.241) (-361.672) (-355.286) * (-355.145) [-356.339] (-358.282) (-356.038) -- 0:00:41
326500 -- [-356.870] (-355.873) (-357.596) (-356.428) * [-358.491] (-356.529) (-355.346) (-356.203) -- 0:00:41
327000 -- (-356.615) [-356.609] (-356.669) (-357.676) * (-359.455) (-356.057) (-356.248) [-355.712] -- 0:00:41
327500 -- (-357.772) (-355.289) (-358.999) [-357.196] * (-355.951) (-356.439) (-361.012) [-355.250] -- 0:00:41
328000 -- (-357.393) (-355.839) [-360.339] (-356.449) * (-359.764) (-357.686) (-357.548) [-361.319] -- 0:00:40
328500 -- (-362.361) (-356.047) [-356.444] (-356.379) * (-359.620) [-356.102] (-359.316) (-358.060) -- 0:00:40
329000 -- (-358.421) [-361.276] (-356.866) (-360.933) * [-356.856] (-358.735) (-356.686) (-358.744) -- 0:00:40
329500 -- [-358.366] (-356.757) (-357.556) (-355.943) * [-358.257] (-357.865) (-357.281) (-361.237) -- 0:00:40
330000 -- (-357.744) [-359.252] (-357.039) (-356.571) * (-361.558) (-358.122) [-357.154] (-357.791) -- 0:00:40
Average standard deviation of split frequencies: 0.015907
330500 -- [-356.502] (-359.277) (-356.161) (-356.841) * (-358.703) (-358.967) [-355.496] (-357.695) -- 0:00:40
331000 -- (-357.263) (-356.926) (-356.453) [-356.453] * (-358.091) (-360.728) (-360.641) [-357.105] -- 0:00:40
331500 -- (-358.033) (-356.047) [-358.610] (-357.611) * (-361.515) (-357.931) (-355.407) [-361.943] -- 0:00:40
332000 -- [-357.107] (-355.829) (-358.486) (-359.070) * (-359.759) [-356.454] (-358.773) (-360.136) -- 0:00:40
332500 -- [-355.272] (-356.991) (-358.012) (-357.344) * (-358.040) (-360.020) [-358.927] (-357.198) -- 0:00:40
333000 -- [-355.932] (-355.710) (-363.572) (-357.105) * [-358.474] (-360.154) (-356.217) (-355.468) -- 0:00:40
333500 -- [-356.148] (-356.255) (-356.991) (-358.868) * (-358.409) (-359.616) (-357.747) [-358.157] -- 0:00:39
334000 -- (-355.984) (-357.712) (-359.240) [-357.480] * (-359.092) [-359.928] (-354.929) (-357.619) -- 0:00:39
334500 -- [-356.053] (-357.719) (-358.439) (-355.685) * (-357.076) [-358.207] (-356.240) (-357.504) -- 0:00:39
335000 -- (-357.622) (-357.461) (-356.458) [-356.499] * (-358.694) [-360.293] (-357.178) (-358.065) -- 0:00:39
Average standard deviation of split frequencies: 0.015728
335500 -- (-355.513) (-358.344) [-359.693] (-358.576) * [-356.174] (-360.720) (-356.753) (-358.099) -- 0:00:39
336000 -- (-356.639) (-359.365) [-357.903] (-355.254) * [-357.526] (-358.119) (-355.611) (-357.731) -- 0:00:39
336500 -- [-356.036] (-358.865) (-355.695) (-357.552) * (-362.572) (-358.516) [-359.248] (-357.953) -- 0:00:39
337000 -- (-359.707) (-356.184) [-358.295] (-356.770) * (-359.741) (-355.510) (-359.431) [-355.881] -- 0:00:39
337500 -- (-358.270) (-357.071) [-355.448] (-359.409) * (-357.949) (-358.571) [-359.733] (-362.594) -- 0:00:39
338000 -- [-356.590] (-357.001) (-355.366) (-355.598) * (-356.658) (-360.130) [-355.408] (-362.294) -- 0:00:39
338500 -- (-355.825) [-357.601] (-356.736) (-358.209) * (-356.000) (-356.425) [-356.721] (-358.655) -- 0:00:39
339000 -- (-358.000) (-355.887) (-356.244) [-355.686] * (-362.454) [-355.862] (-357.425) (-356.604) -- 0:00:40
339500 -- (-358.456) (-359.758) [-358.366] (-355.043) * (-367.467) (-357.036) [-356.425] (-356.009) -- 0:00:40
340000 -- (-356.577) [-363.128] (-357.069) (-356.207) * (-357.585) (-357.078) [-356.239] (-357.674) -- 0:00:40
Average standard deviation of split frequencies: 0.015836
340500 -- [-357.442] (-359.054) (-359.293) (-361.505) * [-357.398] (-356.126) (-356.127) (-357.461) -- 0:00:40
341000 -- (-357.485) (-357.379) [-356.653] (-355.480) * [-358.872] (-358.955) (-357.118) (-355.599) -- 0:00:40
341500 -- (-358.388) [-357.593] (-356.891) (-355.635) * (-361.197) [-355.987] (-358.404) (-356.047) -- 0:00:40
342000 -- (-359.139) (-355.731) (-357.568) [-357.614] * (-358.502) (-357.683) (-358.872) [-356.423] -- 0:00:40
342500 -- [-356.176] (-357.707) (-356.352) (-362.814) * [-358.536] (-355.944) (-359.067) (-356.600) -- 0:00:40
343000 -- (-356.973) [-357.423] (-355.603) (-358.223) * [-356.448] (-357.716) (-358.070) (-357.526) -- 0:00:40
343500 -- (-359.591) [-356.639] (-356.190) (-357.343) * (-359.129) (-357.131) (-356.902) [-359.320] -- 0:00:40
344000 -- (-359.862) [-357.158] (-356.697) (-361.770) * (-356.291) [-358.121] (-357.022) (-361.079) -- 0:00:40
344500 -- (-357.075) (-355.153) [-359.957] (-356.939) * (-361.091) [-357.226] (-358.802) (-358.285) -- 0:00:39
345000 -- (-359.073) [-357.785] (-359.538) (-356.160) * (-357.796) (-357.431) [-355.549] (-355.715) -- 0:00:39
Average standard deviation of split frequencies: 0.016206
345500 -- (-355.569) (-357.003) (-359.797) [-355.690] * (-357.599) (-357.821) (-358.524) [-357.745] -- 0:00:39
346000 -- (-355.760) [-356.389] (-357.980) (-355.533) * (-356.102) [-357.275] (-361.724) (-356.555) -- 0:00:39
346500 -- [-358.959] (-356.823) (-357.679) (-357.193) * [-356.752] (-357.063) (-362.649) (-356.966) -- 0:00:39
347000 -- (-357.242) (-358.165) [-356.659] (-355.651) * (-357.942) (-357.840) [-357.927] (-360.569) -- 0:00:39
347500 -- (-357.886) [-356.843] (-361.649) (-358.362) * (-358.443) [-357.168] (-355.442) (-358.143) -- 0:00:39
348000 -- (-356.383) (-361.630) [-358.797] (-357.313) * (-357.434) (-355.499) [-355.343] (-358.620) -- 0:00:39
348500 -- [-358.057] (-356.032) (-358.041) (-358.093) * (-357.010) (-357.533) (-361.788) [-358.502] -- 0:00:39
349000 -- (-356.117) (-358.370) [-359.809] (-358.541) * (-359.210) (-356.410) [-358.959] (-362.991) -- 0:00:39
349500 -- (-356.207) [-355.567] (-356.510) (-357.676) * (-357.302) (-360.012) [-360.291] (-358.937) -- 0:00:39
350000 -- [-356.329] (-358.300) (-355.790) (-357.386) * (-355.572) (-358.635) (-358.391) [-355.520] -- 0:00:39
Average standard deviation of split frequencies: 0.016485
350500 -- [-359.696] (-356.872) (-356.052) (-357.007) * (-355.835) [-355.500] (-356.817) (-357.819) -- 0:00:38
351000 -- (-357.216) [-357.734] (-358.281) (-357.848) * [-358.789] (-355.532) (-356.274) (-362.783) -- 0:00:38
351500 -- (-359.824) [-356.582] (-357.123) (-357.022) * (-356.911) (-359.145) [-356.657] (-360.689) -- 0:00:38
352000 -- (-356.611) (-356.451) [-358.003] (-357.589) * (-357.460) [-359.677] (-356.983) (-358.708) -- 0:00:38
352500 -- [-355.360] (-356.259) (-361.243) (-355.884) * (-355.816) (-359.796) [-359.938] (-357.061) -- 0:00:38
353000 -- (-362.018) (-358.685) (-357.573) [-356.822] * [-357.218] (-360.047) (-357.801) (-360.536) -- 0:00:38
353500 -- (-360.551) (-356.841) (-366.733) [-355.120] * (-358.035) (-358.511) [-357.640] (-357.004) -- 0:00:38
354000 -- (-356.782) (-358.024) (-361.357) [-358.432] * [-359.075] (-367.508) (-359.334) (-364.802) -- 0:00:38
354500 -- [-357.420] (-360.392) (-357.472) (-357.790) * (-356.916) (-355.650) [-355.674] (-361.491) -- 0:00:38
355000 -- (-358.980) [-359.217] (-360.376) (-358.065) * (-360.364) (-356.017) [-355.562] (-357.079) -- 0:00:38
Average standard deviation of split frequencies: 0.016587
355500 -- (-356.981) (-358.084) (-356.191) [-356.162] * (-357.271) (-355.683) (-357.275) [-356.220] -- 0:00:38
356000 -- (-358.147) (-356.961) (-356.577) [-356.560] * (-358.286) [-359.629] (-355.205) (-357.288) -- 0:00:39
356500 -- (-356.979) (-357.549) [-357.039] (-357.431) * (-356.973) [-358.804] (-356.088) (-355.077) -- 0:00:39
357000 -- (-356.678) (-359.668) (-356.344) [-357.587] * (-357.212) (-356.803) [-355.515] (-355.548) -- 0:00:39
357500 -- (-359.306) [-358.916] (-357.127) (-358.798) * (-355.950) (-355.738) (-356.057) [-357.745] -- 0:00:39
358000 -- (-356.675) (-359.910) [-355.572] (-357.716) * (-356.241) (-355.753) (-359.578) [-355.617] -- 0:00:39
358500 -- (-356.961) (-359.760) [-356.315] (-356.858) * [-356.262] (-360.913) (-361.381) (-358.922) -- 0:00:39
359000 -- (-356.626) [-358.130] (-357.336) (-357.697) * (-356.038) (-360.386) [-357.272] (-358.187) -- 0:00:39
359500 -- (-357.801) (-356.310) (-356.226) [-357.083] * [-358.105] (-363.984) (-356.969) (-355.853) -- 0:00:39
360000 -- (-357.628) [-357.318] (-357.262) (-360.553) * [-357.617] (-356.968) (-356.985) (-358.498) -- 0:00:39
Average standard deviation of split frequencies: 0.015612
360500 -- (-355.663) (-356.744) (-357.213) [-359.880] * (-358.736) [-356.103] (-355.082) (-358.015) -- 0:00:39
361000 -- [-355.933] (-358.822) (-357.952) (-357.111) * (-356.264) (-357.758) [-355.494] (-357.775) -- 0:00:38
361500 -- (-356.761) (-357.690) [-358.199] (-357.378) * (-357.014) [-361.644] (-357.327) (-355.405) -- 0:00:38
362000 -- (-359.826) (-358.450) [-358.807] (-356.220) * (-358.279) (-356.873) [-360.856] (-357.868) -- 0:00:38
362500 -- (-361.878) (-362.116) (-356.901) [-356.699] * (-359.107) (-357.507) [-360.084] (-360.752) -- 0:00:38
363000 -- [-357.131] (-357.677) (-360.488) (-357.270) * (-358.302) (-356.193) [-358.041] (-356.003) -- 0:00:38
363500 -- [-355.650] (-356.250) (-362.600) (-359.410) * [-356.490] (-359.061) (-357.139) (-357.396) -- 0:00:38
364000 -- [-356.939] (-356.355) (-365.806) (-358.230) * [-359.859] (-357.653) (-356.297) (-359.106) -- 0:00:38
364500 -- (-359.491) [-355.799] (-356.669) (-357.138) * (-357.739) (-356.001) [-358.694] (-356.228) -- 0:00:38
365000 -- [-357.053] (-357.615) (-357.914) (-362.401) * (-359.148) (-356.401) [-356.796] (-358.600) -- 0:00:38
Average standard deviation of split frequencies: 0.015527
365500 -- [-356.815] (-360.627) (-359.898) (-356.721) * (-358.056) [-355.765] (-358.955) (-357.875) -- 0:00:38
366000 -- (-358.236) (-356.548) [-357.180] (-356.913) * (-359.190) [-357.503] (-358.606) (-358.164) -- 0:00:38
366500 -- (-359.851) (-356.928) (-360.864) [-359.912] * (-355.571) (-358.236) [-357.527] (-360.366) -- 0:00:38
367000 -- (-356.769) (-358.104) [-359.736] (-359.206) * (-355.529) [-357.974] (-357.145) (-357.480) -- 0:00:37
367500 -- (-358.117) [-363.329] (-356.144) (-356.459) * [-356.041] (-359.564) (-356.189) (-360.836) -- 0:00:37
368000 -- (-357.847) (-359.905) [-357.232] (-361.802) * [-359.717] (-360.272) (-355.450) (-358.315) -- 0:00:37
368500 -- (-356.409) (-357.852) (-356.566) [-359.961] * (-361.178) [-358.231] (-356.552) (-359.286) -- 0:00:37
369000 -- (-356.569) (-356.793) (-359.545) [-356.071] * (-358.697) (-357.143) [-355.556] (-355.456) -- 0:00:37
369500 -- (-357.185) [-358.901] (-357.306) (-359.476) * [-356.279] (-357.042) (-356.208) (-355.538) -- 0:00:37
370000 -- (-356.371) [-356.320] (-355.594) (-355.649) * (-357.030) (-357.935) [-356.374] (-356.248) -- 0:00:37
Average standard deviation of split frequencies: 0.014943
370500 -- (-357.790) [-357.876] (-358.673) (-357.706) * (-356.180) (-356.071) [-356.553] (-357.231) -- 0:00:37
371000 -- (-359.568) [-356.067] (-366.884) (-357.205) * (-358.540) (-356.960) (-355.632) [-359.003] -- 0:00:37
371500 -- (-357.139) [-356.882] (-359.250) (-364.329) * (-357.628) (-357.061) [-356.276] (-357.504) -- 0:00:37
372000 -- (-357.190) [-356.608] (-356.665) (-357.314) * [-356.154] (-357.595) (-357.877) (-357.539) -- 0:00:37
372500 -- (-356.745) [-358.818] (-357.699) (-356.028) * (-359.110) [-358.447] (-362.007) (-363.953) -- 0:00:37
373000 -- [-359.245] (-359.684) (-361.325) (-355.168) * (-362.579) [-355.890] (-355.157) (-363.791) -- 0:00:38
373500 -- [-357.553] (-364.273) (-356.619) (-357.763) * (-361.264) (-356.385) [-355.316] (-362.769) -- 0:00:38
374000 -- [-357.106] (-360.789) (-358.923) (-355.644) * (-360.516) [-355.849] (-355.410) (-358.253) -- 0:00:38
374500 -- (-357.396) [-359.458] (-358.116) (-356.369) * (-357.045) (-355.690) (-359.129) [-358.026] -- 0:00:38
375000 -- [-360.878] (-357.683) (-355.780) (-359.251) * (-355.606) (-356.287) (-356.843) [-361.915] -- 0:00:38
Average standard deviation of split frequencies: 0.014653
375500 -- (-356.855) [-357.132] (-355.958) (-357.090) * [-360.119] (-361.992) (-357.258) (-359.181) -- 0:00:38
376000 -- (-357.703) (-357.512) [-357.758] (-356.622) * [-357.263] (-359.443) (-355.750) (-357.540) -- 0:00:38
376500 -- (-359.889) [-358.414] (-356.018) (-359.162) * (-359.641) (-356.953) (-359.391) [-356.489] -- 0:00:38
377000 -- (-357.536) [-358.118] (-359.791) (-359.457) * (-355.932) (-357.768) (-356.868) [-355.851] -- 0:00:38
377500 -- [-356.662] (-356.494) (-360.098) (-360.062) * (-361.437) (-360.344) (-359.613) [-356.079] -- 0:00:37
378000 -- (-359.367) [-356.827] (-362.897) (-358.763) * [-356.645] (-355.750) (-357.516) (-358.225) -- 0:00:37
378500 -- (-357.349) (-356.920) [-358.763] (-355.872) * (-356.325) [-356.243] (-355.497) (-359.163) -- 0:00:37
379000 -- (-358.946) [-355.765] (-359.554) (-356.149) * [-355.317] (-356.555) (-356.592) (-357.149) -- 0:00:37
379500 -- (-358.901) [-356.339] (-356.372) (-356.663) * (-357.289) [-357.878] (-358.726) (-356.085) -- 0:00:37
380000 -- (-360.698) [-356.257] (-356.309) (-355.153) * [-357.803] (-356.814) (-363.175) (-357.558) -- 0:00:37
Average standard deviation of split frequencies: 0.015402
380500 -- [-357.823] (-355.218) (-356.089) (-355.282) * [-357.792] (-355.132) (-356.678) (-357.488) -- 0:00:37
381000 -- (-357.515) (-355.991) [-355.730] (-355.929) * (-355.543) (-355.462) [-355.609] (-357.736) -- 0:00:37
381500 -- (-357.534) [-357.600] (-356.483) (-356.790) * (-356.827) (-356.170) [-356.409] (-355.617) -- 0:00:37
382000 -- (-358.047) (-359.159) [-357.828] (-358.692) * (-356.974) (-355.739) [-356.630] (-356.797) -- 0:00:37
382500 -- [-357.425] (-356.725) (-359.788) (-356.146) * (-356.649) (-355.514) [-356.447] (-358.724) -- 0:00:37
383000 -- (-358.901) [-359.957] (-357.253) (-363.162) * [-356.384] (-359.508) (-355.914) (-355.451) -- 0:00:37
383500 -- (-356.944) [-356.328] (-358.808) (-356.416) * (-355.943) (-359.463) [-356.803] (-357.180) -- 0:00:36
384000 -- [-355.701] (-359.128) (-357.071) (-357.478) * (-357.536) (-359.047) [-356.987] (-357.815) -- 0:00:36
384500 -- (-357.154) (-356.480) [-357.085] (-359.114) * [-357.827] (-359.165) (-356.056) (-359.488) -- 0:00:36
385000 -- (-356.360) (-357.416) [-355.254] (-360.636) * [-359.483] (-358.886) (-355.652) (-355.858) -- 0:00:36
Average standard deviation of split frequencies: 0.015661
385500 -- (-356.356) (-359.198) [-356.419] (-356.229) * (-355.848) (-357.883) [-356.176] (-355.640) -- 0:00:36
386000 -- [-356.210] (-359.099) (-359.695) (-357.880) * (-357.069) (-358.331) (-355.633) [-355.590] -- 0:00:36
386500 -- [-356.120] (-357.726) (-355.368) (-357.856) * (-362.975) (-356.556) [-356.592] (-361.161) -- 0:00:36
387000 -- (-357.688) (-356.812) (-359.946) [-357.748] * (-356.231) (-358.001) [-355.789] (-361.775) -- 0:00:36
387500 -- (-359.358) (-358.719) [-355.328] (-359.134) * [-361.391] (-362.192) (-355.674) (-357.355) -- 0:00:36
388000 -- (-358.237) [-358.408] (-357.269) (-360.217) * (-358.040) (-357.279) [-355.463] (-358.302) -- 0:00:36
388500 -- (-355.917) (-355.307) (-355.774) [-355.843] * [-361.154] (-357.769) (-356.518) (-358.019) -- 0:00:36
389000 -- (-357.717) (-355.781) [-357.812] (-357.923) * (-357.667) [-356.125] (-357.502) (-360.599) -- 0:00:36
389500 -- (-356.200) [-357.291] (-356.191) (-358.003) * (-356.787) (-363.453) (-358.611) [-355.928] -- 0:00:36
390000 -- [-356.371] (-359.877) (-359.606) (-357.548) * (-357.428) (-359.625) (-356.425) [-356.308] -- 0:00:37
Average standard deviation of split frequencies: 0.015261
390500 -- (-358.953) (-359.562) [-356.349] (-358.104) * (-357.455) [-356.231] (-357.539) (-357.577) -- 0:00:37
391000 -- [-358.701] (-356.996) (-357.278) (-359.357) * (-357.244) (-355.926) [-358.606] (-356.480) -- 0:00:37
391500 -- (-358.783) (-355.228) (-357.473) [-356.328] * (-356.737) [-357.132] (-360.288) (-358.901) -- 0:00:37
392000 -- (-357.146) (-356.508) (-359.155) [-357.276] * (-357.096) (-357.892) [-358.153] (-357.481) -- 0:00:37
392500 -- [-356.789] (-362.166) (-360.638) (-356.400) * (-358.640) [-355.725] (-356.194) (-361.010) -- 0:00:37
393000 -- [-357.597] (-358.021) (-356.877) (-362.294) * (-358.260) [-358.648] (-358.777) (-355.355) -- 0:00:37
393500 -- [-360.538] (-356.563) (-356.661) (-357.457) * (-359.164) [-356.960] (-359.245) (-356.272) -- 0:00:36
394000 -- (-360.524) (-356.187) (-359.535) [-355.364] * (-356.559) [-359.079] (-355.254) (-358.933) -- 0:00:36
394500 -- (-355.435) (-357.340) [-360.496] (-358.546) * [-359.387] (-359.705) (-356.456) (-362.175) -- 0:00:36
395000 -- (-355.668) (-355.002) (-357.897) [-359.112] * (-358.910) (-361.735) (-358.855) [-358.967] -- 0:00:36
Average standard deviation of split frequencies: 0.014915
395500 -- (-355.709) (-356.564) (-358.392) [-359.831] * (-355.129) (-357.326) (-356.342) [-357.307] -- 0:00:36
396000 -- (-356.334) (-356.633) (-358.925) [-356.773] * (-355.106) (-355.591) (-356.823) [-359.273] -- 0:00:36
396500 -- (-356.044) (-355.722) (-356.896) [-360.790] * [-355.940] (-355.481) (-357.240) (-359.940) -- 0:00:36
397000 -- [-356.343] (-356.279) (-356.403) (-357.663) * (-358.548) (-358.613) (-356.527) [-359.890] -- 0:00:36
397500 -- (-355.718) (-356.162) (-358.426) [-355.928] * (-357.783) (-361.228) (-356.917) [-356.548] -- 0:00:36
398000 -- (-356.989) [-356.171] (-364.532) (-355.849) * (-357.384) (-358.189) (-360.489) [-357.367] -- 0:00:36
398500 -- (-360.899) [-359.953] (-363.526) (-359.733) * [-358.039] (-355.605) (-358.770) (-355.574) -- 0:00:36
399000 -- (-356.731) [-359.295] (-358.916) (-357.456) * (-357.984) (-355.238) [-357.594] (-358.493) -- 0:00:36
399500 -- (-360.554) [-356.374] (-356.065) (-357.749) * (-356.530) (-355.643) [-358.847] (-358.668) -- 0:00:36
400000 -- (-356.699) (-360.938) [-356.568] (-357.192) * [-357.274] (-356.676) (-358.004) (-356.690) -- 0:00:36
Average standard deviation of split frequencies: 0.013923
400500 -- (-357.920) (-360.460) [-357.121] (-358.251) * (-358.690) [-356.563] (-356.998) (-356.503) -- 0:00:35
401000 -- (-357.707) [-356.543] (-360.475) (-358.934) * (-356.599) (-359.887) (-359.626) [-357.967] -- 0:00:35
401500 -- [-355.611] (-356.645) (-362.658) (-357.377) * [-357.480] (-360.298) (-357.496) (-356.508) -- 0:00:35
402000 -- (-357.324) (-361.336) (-358.232) [-355.606] * (-357.508) (-359.208) (-357.581) [-355.386] -- 0:00:35
402500 -- (-356.534) [-357.357] (-357.547) (-358.019) * (-356.193) (-356.163) (-357.338) [-360.076] -- 0:00:35
403000 -- (-357.257) (-357.228) [-358.146] (-356.833) * (-355.262) [-355.705] (-356.720) (-357.266) -- 0:00:35
403500 -- (-358.602) (-358.235) (-357.271) [-356.119] * [-357.043] (-355.962) (-355.901) (-356.397) -- 0:00:35
404000 -- (-360.576) (-356.762) (-357.117) [-356.918] * (-356.719) (-357.282) (-357.016) [-358.624] -- 0:00:35
404500 -- (-357.633) (-356.034) [-355.704] (-357.321) * (-357.685) (-359.280) [-355.170] (-358.093) -- 0:00:35
405000 -- (-356.026) (-356.904) (-358.528) [-355.652] * (-355.433) (-358.168) (-356.679) [-355.713] -- 0:00:35
Average standard deviation of split frequencies: 0.012901
405500 -- (-359.621) (-355.420) [-357.187] (-357.340) * (-358.062) (-356.351) [-357.146] (-358.753) -- 0:00:35
406000 -- (-358.282) (-359.703) [-357.243] (-360.396) * (-357.057) (-357.875) [-355.722] (-355.786) -- 0:00:35
406500 -- (-357.071) (-357.700) [-357.196] (-355.784) * [-355.212] (-359.036) (-356.654) (-357.054) -- 0:00:36
407000 -- (-356.663) (-357.644) [-359.499] (-356.102) * [-358.074] (-361.925) (-358.061) (-355.501) -- 0:00:36
407500 -- (-358.085) (-357.375) (-363.608) [-357.582] * [-362.333] (-357.887) (-357.863) (-357.907) -- 0:00:36
408000 -- (-357.677) (-360.863) [-358.389] (-359.581) * (-358.889) [-355.490] (-361.878) (-357.598) -- 0:00:36
408500 -- (-356.718) [-361.316] (-356.598) (-359.836) * (-356.422) (-355.568) [-359.198] (-365.292) -- 0:00:36
409000 -- [-356.452] (-355.482) (-355.673) (-356.445) * (-358.261) (-356.330) (-360.022) [-359.755] -- 0:00:36
409500 -- [-357.170] (-357.034) (-356.377) (-356.546) * (-358.221) (-356.838) [-356.465] (-359.620) -- 0:00:36
410000 -- (-355.371) (-356.788) [-357.175] (-359.182) * [-355.953] (-358.100) (-357.140) (-356.222) -- 0:00:35
Average standard deviation of split frequencies: 0.013520
410500 -- (-356.251) (-356.722) [-357.465] (-358.333) * [-355.590] (-359.594) (-357.592) (-355.826) -- 0:00:35
411000 -- (-357.565) (-355.247) (-359.054) [-355.542] * (-358.360) (-356.650) (-355.990) [-356.319] -- 0:00:35
411500 -- [-357.116] (-357.654) (-357.293) (-356.080) * (-357.376) (-356.050) (-356.571) [-357.237] -- 0:00:35
412000 -- [-356.991] (-355.063) (-360.875) (-355.515) * [-355.124] (-357.108) (-355.882) (-360.458) -- 0:00:35
412500 -- (-355.714) [-355.420] (-358.334) (-355.747) * (-355.342) (-356.132) (-361.386) [-358.684] -- 0:00:35
413000 -- [-356.297] (-356.358) (-355.875) (-356.166) * (-355.482) [-356.267] (-358.764) (-358.115) -- 0:00:35
413500 -- (-359.800) (-355.465) [-356.735] (-356.752) * (-355.516) (-355.649) (-360.967) [-359.520] -- 0:00:35
414000 -- (-357.174) (-357.857) (-357.135) [-357.253] * [-357.554] (-358.386) (-359.516) (-359.856) -- 0:00:35
414500 -- (-356.354) [-360.958] (-358.222) (-356.953) * [-356.241] (-360.210) (-355.819) (-359.631) -- 0:00:35
415000 -- [-357.404] (-357.475) (-355.866) (-357.541) * (-357.630) (-357.137) [-355.303] (-357.883) -- 0:00:35
Average standard deviation of split frequencies: 0.013661
415500 -- (-358.137) (-356.819) [-357.074] (-356.466) * (-356.775) (-358.277) (-358.242) [-361.221] -- 0:00:35
416000 -- [-363.520] (-355.798) (-358.302) (-358.670) * (-356.486) (-355.792) [-357.889] (-362.275) -- 0:00:35
416500 -- (-355.816) (-357.500) (-359.693) [-359.855] * (-356.943) (-357.778) [-355.842] (-360.388) -- 0:00:35
417000 -- (-357.289) (-357.953) (-356.565) [-355.524] * [-358.700] (-355.368) (-357.090) (-357.831) -- 0:00:34
417500 -- (-357.888) (-355.257) (-359.141) [-355.598] * (-356.985) [-357.267] (-358.476) (-357.534) -- 0:00:34
418000 -- [-356.149] (-357.279) (-355.122) (-355.762) * (-357.410) (-357.438) (-357.365) [-355.921] -- 0:00:34
418500 -- (-356.500) (-356.415) (-357.282) [-355.966] * (-358.054) (-355.732) [-359.485] (-355.432) -- 0:00:34
419000 -- (-358.906) [-357.830] (-359.435) (-357.148) * (-357.574) (-355.421) (-362.675) [-357.206] -- 0:00:34
419500 -- (-359.973) [-357.689] (-360.351) (-355.892) * (-357.086) [-357.662] (-357.478) (-361.820) -- 0:00:34
420000 -- (-359.694) (-357.124) (-356.415) [-356.077] * (-356.547) (-359.501) [-361.182] (-357.929) -- 0:00:34
Average standard deviation of split frequencies: 0.012825
420500 -- (-360.016) (-356.803) (-357.187) [-355.298] * (-357.257) (-358.407) (-355.367) [-355.606] -- 0:00:34
421000 -- (-359.503) [-357.143] (-357.504) (-359.123) * (-355.836) (-357.498) [-355.554] (-358.386) -- 0:00:34
421500 -- [-358.386] (-357.000) (-356.948) (-359.510) * (-359.282) (-355.623) [-355.802] (-358.289) -- 0:00:34
422000 -- (-358.080) (-355.280) [-358.066] (-359.498) * (-355.434) (-360.958) (-358.189) [-358.364] -- 0:00:34
422500 -- [-359.175] (-360.667) (-356.547) (-356.549) * [-357.288] (-358.529) (-357.708) (-356.500) -- 0:00:34
423000 -- (-356.901) (-360.264) [-358.561] (-360.252) * (-358.215) [-356.740] (-357.282) (-357.112) -- 0:00:34
423500 -- (-355.427) [-361.398] (-357.298) (-357.796) * [-358.253] (-361.076) (-355.364) (-357.952) -- 0:00:35
424000 -- (-358.149) [-356.229] (-358.364) (-363.092) * (-355.458) (-360.661) [-356.813] (-361.972) -- 0:00:35
424500 -- (-356.366) [-359.579] (-355.675) (-357.372) * [-356.223] (-357.453) (-356.502) (-357.561) -- 0:00:35
425000 -- (-356.583) (-356.591) [-357.539] (-358.318) * [-361.179] (-355.471) (-356.785) (-356.942) -- 0:00:35
Average standard deviation of split frequencies: 0.012603
425500 -- (-356.677) [-357.334] (-360.003) (-359.213) * [-361.574] (-356.982) (-358.041) (-357.438) -- 0:00:35
426000 -- [-357.217] (-356.610) (-358.939) (-360.404) * (-366.323) (-357.609) (-357.313) [-361.499] -- 0:00:35
426500 -- (-357.513) (-356.986) (-359.170) [-357.820] * (-367.614) (-355.881) (-359.626) [-355.936] -- 0:00:34
427000 -- [-357.731] (-357.696) (-359.621) (-358.399) * (-355.989) (-356.894) [-356.716] (-357.178) -- 0:00:34
427500 -- (-358.475) (-356.940) (-358.203) [-355.805] * [-359.559] (-358.097) (-357.053) (-357.509) -- 0:00:34
428000 -- (-356.685) (-358.642) (-360.864) [-357.058] * (-356.486) (-358.482) (-361.235) [-364.116] -- 0:00:34
428500 -- (-357.295) (-359.958) [-359.475] (-355.225) * [-357.190] (-361.908) (-356.119) (-359.874) -- 0:00:34
429000 -- [-361.336] (-356.648) (-356.261) (-356.225) * (-355.520) (-362.032) [-357.779] (-357.727) -- 0:00:34
429500 -- (-358.718) (-356.068) [-356.013] (-358.631) * (-357.245) (-357.046) [-356.796] (-358.838) -- 0:00:34
430000 -- (-361.302) [-356.336] (-358.742) (-356.715) * [-357.598] (-355.867) (-357.128) (-355.452) -- 0:00:34
Average standard deviation of split frequencies: 0.012101
430500 -- (-360.688) (-355.821) (-358.272) [-356.162] * [-357.058] (-355.719) (-357.138) (-356.819) -- 0:00:34
431000 -- (-356.159) [-359.001] (-358.856) (-356.351) * (-357.237) (-355.768) (-355.386) [-356.570] -- 0:00:34
431500 -- (-355.136) (-357.558) [-357.876] (-355.764) * (-356.388) (-356.216) (-356.928) [-357.698] -- 0:00:34
432000 -- (-359.101) [-356.648] (-356.136) (-356.795) * (-356.490) (-356.878) (-359.427) [-358.015] -- 0:00:34
432500 -- (-356.726) [-357.391] (-356.618) (-356.387) * (-358.237) (-358.122) (-355.378) [-360.451] -- 0:00:34
433000 -- (-356.976) (-356.364) [-356.922] (-359.942) * (-357.837) (-356.134) (-360.260) [-356.314] -- 0:00:34
433500 -- [-356.859] (-359.731) (-356.401) (-355.799) * [-355.388] (-357.623) (-359.224) (-356.130) -- 0:00:33
434000 -- (-355.596) (-360.103) (-356.708) [-358.248] * [-356.969] (-357.035) (-359.116) (-357.186) -- 0:00:33
434500 -- [-357.259] (-361.498) (-355.854) (-355.971) * [-355.396] (-357.862) (-360.310) (-357.302) -- 0:00:33
435000 -- (-359.325) (-360.559) [-356.915] (-355.975) * [-355.960] (-359.404) (-356.612) (-356.636) -- 0:00:33
Average standard deviation of split frequencies: 0.011830
435500 -- [-357.088] (-358.074) (-359.346) (-357.309) * (-355.886) (-359.198) (-356.995) [-355.528] -- 0:00:33
436000 -- (-355.108) (-359.846) (-357.099) [-357.145] * (-357.442) (-355.781) [-356.342] (-356.217) -- 0:00:33
436500 -- [-355.646] (-361.336) (-356.019) (-357.588) * (-359.554) [-360.257] (-356.596) (-361.762) -- 0:00:33
437000 -- (-357.715) (-357.235) [-355.327] (-358.124) * (-360.976) (-358.077) [-358.762] (-357.094) -- 0:00:33
437500 -- [-358.265] (-358.197) (-357.209) (-358.055) * [-359.626] (-358.248) (-357.483) (-358.265) -- 0:00:33
438000 -- [-357.586] (-360.006) (-357.298) (-358.735) * (-359.383) [-358.421] (-356.698) (-358.232) -- 0:00:33
438500 -- (-355.988) [-361.828] (-357.145) (-357.572) * (-356.980) [-355.241] (-357.770) (-359.046) -- 0:00:33
439000 -- [-359.423] (-357.987) (-359.421) (-357.589) * [-358.509] (-355.851) (-355.587) (-358.041) -- 0:00:33
439500 -- [-359.745] (-356.104) (-358.507) (-355.816) * (-358.524) [-356.567] (-356.980) (-356.468) -- 0:00:33
440000 -- [-357.751] (-357.559) (-360.395) (-358.881) * (-355.520) (-360.263) [-355.381] (-357.985) -- 0:00:33
Average standard deviation of split frequencies: 0.012436
440500 -- (-355.343) [-356.452] (-358.402) (-355.206) * [-359.627] (-359.087) (-357.828) (-360.544) -- 0:00:34
441000 -- (-359.955) (-357.240) [-361.117] (-356.069) * (-357.139) (-357.760) (-357.767) [-355.975] -- 0:00:34
441500 -- (-359.682) [-356.004] (-361.040) (-357.751) * (-356.161) (-361.937) (-356.100) [-358.823] -- 0:00:34
442000 -- (-356.032) [-357.803] (-356.225) (-360.827) * (-357.018) (-359.358) (-360.625) [-359.263] -- 0:00:34
442500 -- (-356.316) [-356.332] (-359.030) (-356.841) * [-357.741] (-357.534) (-356.735) (-358.974) -- 0:00:34
443000 -- [-358.659] (-355.151) (-359.069) (-356.667) * (-356.939) (-356.036) (-358.872) [-358.432] -- 0:00:33
443500 -- (-358.374) (-357.260) (-357.811) [-355.638] * (-356.619) (-356.959) [-355.817] (-358.830) -- 0:00:33
444000 -- [-359.379] (-355.732) (-357.896) (-355.443) * (-356.091) (-358.231) (-357.038) [-356.732] -- 0:00:33
444500 -- (-358.451) (-355.165) [-356.096] (-358.499) * (-357.223) (-355.631) (-358.043) [-355.974] -- 0:00:33
445000 -- [-357.879] (-357.777) (-357.608) (-357.297) * [-355.671] (-357.477) (-356.213) (-360.464) -- 0:00:33
Average standard deviation of split frequencies: 0.012214
445500 -- (-359.615) [-357.457] (-361.103) (-357.786) * (-359.810) (-359.912) [-357.327] (-355.545) -- 0:00:33
446000 -- (-359.391) (-356.005) [-357.441] (-355.341) * (-355.816) (-362.956) (-358.231) [-358.278] -- 0:00:33
446500 -- (-355.746) [-356.238] (-358.188) (-357.386) * (-356.901) (-357.639) (-359.015) [-356.104] -- 0:00:33
447000 -- (-357.032) [-358.695] (-358.240) (-355.386) * (-359.580) (-356.019) [-355.896] (-359.740) -- 0:00:33
447500 -- [-357.496] (-357.392) (-358.138) (-355.749) * (-356.020) [-355.954] (-357.834) (-358.226) -- 0:00:33
448000 -- (-356.380) (-357.168) (-357.215) [-357.129] * (-355.933) (-355.601) [-357.676] (-360.430) -- 0:00:33
448500 -- (-358.430) [-355.833] (-359.461) (-357.769) * (-356.964) [-355.645] (-357.865) (-360.639) -- 0:00:33
449000 -- (-359.021) [-360.226] (-357.554) (-358.412) * (-359.085) [-355.053] (-359.133) (-357.806) -- 0:00:33
449500 -- (-356.804) (-355.493) (-357.910) [-356.729] * (-356.808) (-357.005) (-356.650) [-356.539] -- 0:00:33
450000 -- (-356.703) [-356.769] (-357.643) (-357.078) * (-356.029) (-356.873) [-357.935] (-356.783) -- 0:00:33
Average standard deviation of split frequencies: 0.011768
450500 -- (-358.404) [-356.811] (-360.803) (-358.394) * (-357.564) [-361.548] (-361.449) (-356.373) -- 0:00:32
451000 -- (-358.335) (-361.111) (-357.122) [-359.270] * (-358.569) [-357.712] (-357.722) (-355.909) -- 0:00:32
451500 -- [-356.137] (-356.560) (-357.609) (-355.510) * (-357.081) (-357.989) [-358.024] (-357.281) -- 0:00:32
452000 -- [-355.921] (-355.996) (-357.235) (-355.275) * (-357.308) [-356.992] (-357.763) (-357.116) -- 0:00:32
452500 -- (-357.068) [-358.764] (-356.157) (-356.277) * [-356.533] (-356.518) (-357.276) (-355.579) -- 0:00:32
453000 -- (-359.407) (-364.040) [-357.130] (-356.554) * (-356.115) [-355.519] (-356.771) (-357.992) -- 0:00:32
453500 -- (-357.976) (-358.421) [-358.393] (-357.417) * (-357.037) (-356.743) [-355.699] (-357.277) -- 0:00:32
454000 -- (-358.834) (-357.205) [-355.784] (-359.218) * (-357.428) (-357.791) [-356.283] (-357.041) -- 0:00:32
454500 -- (-359.311) [-356.742] (-356.839) (-356.879) * (-356.106) (-356.349) [-356.915] (-358.475) -- 0:00:32
455000 -- (-357.054) (-355.368) [-357.012] (-359.837) * (-357.616) (-356.077) [-355.387] (-355.772) -- 0:00:32
Average standard deviation of split frequencies: 0.011311
455500 -- [-357.503] (-358.498) (-358.233) (-355.452) * [-358.884] (-359.553) (-356.944) (-356.145) -- 0:00:32
456000 -- [-360.006] (-356.327) (-362.383) (-354.982) * (-357.943) (-357.017) (-358.100) [-358.098] -- 0:00:32
456500 -- (-361.576) [-359.823] (-361.577) (-356.382) * [-356.214] (-359.206) (-360.173) (-358.871) -- 0:00:32
457000 -- (-355.988) [-359.401] (-357.204) (-356.825) * (-358.486) [-357.212] (-358.355) (-357.816) -- 0:00:33
457500 -- [-356.506] (-356.286) (-356.216) (-355.703) * (-360.395) [-355.703] (-360.529) (-357.544) -- 0:00:33
458000 -- (-358.182) [-361.566] (-358.897) (-356.280) * (-358.340) [-356.328] (-357.428) (-360.149) -- 0:00:33
458500 -- (-359.756) [-359.384] (-358.534) (-356.870) * (-357.061) (-356.339) (-360.197) [-356.584] -- 0:00:33
459000 -- (-356.943) [-364.685] (-358.328) (-355.139) * (-358.095) (-355.471) [-358.375] (-356.877) -- 0:00:33
459500 -- (-357.748) (-360.684) [-360.596] (-357.875) * (-357.832) (-356.852) [-358.514] (-358.993) -- 0:00:32
460000 -- (-358.817) (-355.718) (-357.234) [-355.501] * (-359.172) [-355.984] (-358.351) (-357.283) -- 0:00:32
Average standard deviation of split frequencies: 0.010835
460500 -- (-359.152) [-360.325] (-357.643) (-357.322) * (-357.884) [-356.323] (-358.344) (-356.023) -- 0:00:32
461000 -- (-361.486) (-357.505) (-361.170) [-359.600] * (-356.025) [-356.065] (-357.311) (-356.395) -- 0:00:32
461500 -- (-359.375) [-356.264] (-359.823) (-356.961) * (-356.341) (-359.549) [-358.500] (-357.393) -- 0:00:32
462000 -- (-359.223) (-357.085) (-359.680) [-356.612] * (-359.651) (-358.178) (-357.765) [-355.946] -- 0:00:32
462500 -- (-356.233) [-357.827] (-356.378) (-355.672) * (-357.365) (-357.120) [-356.901] (-363.296) -- 0:00:32
463000 -- [-355.500] (-359.639) (-359.549) (-356.594) * (-358.181) [-358.031] (-359.596) (-359.419) -- 0:00:32
463500 -- [-358.916] (-356.589) (-356.765) (-356.703) * (-360.009) [-357.325] (-356.117) (-356.626) -- 0:00:32
464000 -- (-360.015) (-356.787) [-359.398] (-358.337) * (-358.601) (-359.766) (-359.097) [-355.426] -- 0:00:32
464500 -- (-357.553) (-356.509) (-357.467) [-357.941] * (-358.806) (-362.896) (-358.899) [-356.008] -- 0:00:32
465000 -- (-359.148) [-355.721] (-356.259) (-359.998) * (-357.070) [-357.621] (-356.013) (-355.566) -- 0:00:32
Average standard deviation of split frequencies: 0.011071
465500 -- (-358.348) [-355.495] (-355.369) (-357.521) * [-358.379] (-359.252) (-360.365) (-355.574) -- 0:00:32
466000 -- [-357.570] (-356.041) (-357.755) (-355.876) * (-358.599) [-356.095] (-355.983) (-358.329) -- 0:00:32
466500 -- (-360.955) (-358.926) [-358.730] (-356.987) * [-360.315] (-358.388) (-355.476) (-355.266) -- 0:00:32
467000 -- (-356.803) (-356.831) (-357.295) [-359.394] * (-355.489) (-355.688) (-356.634) [-356.257] -- 0:00:31
467500 -- (-356.796) (-361.807) (-359.570) [-360.343] * [-359.002] (-361.061) (-356.591) (-357.293) -- 0:00:31
468000 -- [-359.704] (-356.366) (-356.907) (-357.539) * [-356.665] (-357.290) (-358.202) (-355.453) -- 0:00:31
468500 -- [-356.036] (-355.310) (-357.129) (-357.036) * [-357.190] (-357.439) (-360.109) (-355.773) -- 0:00:31
469000 -- (-358.576) [-358.717] (-357.170) (-359.096) * [-356.568] (-357.454) (-358.832) (-356.872) -- 0:00:31
469500 -- (-358.476) [-359.136] (-357.121) (-356.583) * [-356.944] (-355.810) (-356.145) (-357.026) -- 0:00:31
470000 -- (-357.156) (-359.960) (-356.260) [-356.412] * (-356.205) (-356.820) [-357.959] (-359.504) -- 0:00:31
Average standard deviation of split frequencies: 0.010134
470500 -- (-356.924) [-356.484] (-357.645) (-357.106) * (-359.761) (-360.159) [-356.490] (-357.427) -- 0:00:31
471000 -- [-357.072] (-356.179) (-357.873) (-360.327) * (-364.074) (-362.161) [-355.790] (-358.733) -- 0:00:31
471500 -- (-355.789) [-359.855] (-359.125) (-356.779) * [-360.322] (-359.868) (-357.002) (-357.118) -- 0:00:31
472000 -- [-355.678] (-359.299) (-356.571) (-356.065) * (-357.013) [-360.712] (-355.337) (-355.625) -- 0:00:31
472500 -- (-355.574) (-357.545) [-357.968] (-355.669) * [-356.947] (-362.365) (-356.266) (-355.289) -- 0:00:31
473000 -- (-361.404) (-358.893) [-355.498] (-361.598) * (-358.791) (-356.478) [-355.848] (-355.339) -- 0:00:31
473500 -- (-356.894) (-359.424) [-358.322] (-356.284) * [-356.725] (-357.750) (-357.161) (-355.453) -- 0:00:32
474000 -- (-356.985) (-355.452) (-359.393) [-356.775] * (-357.585) (-356.449) [-359.688] (-358.993) -- 0:00:32
474500 -- (-358.630) (-362.178) [-358.822] (-358.078) * [-356.639] (-355.568) (-356.750) (-361.221) -- 0:00:32
475000 -- (-356.867) [-356.432] (-359.800) (-359.947) * (-361.644) [-355.543] (-356.578) (-359.503) -- 0:00:32
Average standard deviation of split frequencies: 0.010289
475500 -- (-356.752) [-356.994] (-359.882) (-356.909) * (-358.025) (-356.010) [-357.244] (-356.532) -- 0:00:31
476000 -- (-358.034) [-357.701] (-356.790) (-357.734) * (-357.701) (-358.609) [-358.204] (-355.687) -- 0:00:31
476500 -- (-357.720) (-359.315) [-356.741] (-358.197) * (-356.000) [-356.398] (-357.769) (-360.845) -- 0:00:31
477000 -- (-355.419) (-362.043) (-356.379) [-359.099] * (-356.436) (-356.409) [-359.462] (-356.638) -- 0:00:31
477500 -- (-355.960) (-358.358) (-356.568) [-357.369] * (-356.316) (-357.830) (-356.666) [-356.996] -- 0:00:31
478000 -- (-358.140) (-357.408) [-357.873] (-359.381) * (-355.649) [-355.853] (-356.517) (-358.568) -- 0:00:31
478500 -- [-359.037] (-357.323) (-359.022) (-358.188) * [-355.523] (-355.990) (-357.071) (-356.400) -- 0:00:31
479000 -- [-355.527] (-357.550) (-357.890) (-357.044) * [-355.837] (-359.539) (-356.465) (-359.002) -- 0:00:31
479500 -- [-355.894] (-358.077) (-360.053) (-356.229) * (-356.358) (-359.043) (-356.261) [-355.499] -- 0:00:31
480000 -- (-355.894) (-357.571) [-358.105] (-357.599) * (-361.899) (-357.460) [-357.449] (-358.658) -- 0:00:31
Average standard deviation of split frequencies: 0.009971
480500 -- [-359.148] (-357.572) (-355.121) (-357.632) * (-359.927) [-355.185] (-358.773) (-355.827) -- 0:00:31
481000 -- (-356.051) [-356.112] (-355.393) (-356.462) * [-356.284] (-358.787) (-359.446) (-356.006) -- 0:00:31
481500 -- [-359.539] (-356.682) (-356.322) (-357.378) * (-357.224) [-356.134] (-357.192) (-357.962) -- 0:00:31
482000 -- (-357.949) (-357.129) [-355.616] (-356.007) * (-357.289) [-357.808] (-357.367) (-356.652) -- 0:00:31
482500 -- [-357.240] (-358.749) (-357.496) (-356.208) * (-355.497) (-358.638) [-355.401] (-355.730) -- 0:00:31
483000 -- (-356.323) [-361.450] (-356.613) (-357.136) * (-363.104) (-355.230) [-355.727] (-359.516) -- 0:00:31
483500 -- (-356.167) [-358.806] (-356.300) (-355.247) * (-359.691) [-355.678] (-355.399) (-358.682) -- 0:00:30
484000 -- (-355.708) (-356.254) (-357.846) [-356.132] * (-356.024) (-359.174) [-358.366] (-355.982) -- 0:00:30
484500 -- (-357.239) [-355.354] (-356.352) (-356.729) * (-356.762) (-356.049) [-355.757] (-356.286) -- 0:00:30
485000 -- (-358.619) (-357.743) [-356.306] (-356.240) * (-355.307) (-357.631) (-358.958) [-356.051] -- 0:00:30
Average standard deviation of split frequencies: 0.010767
485500 -- [-357.195] (-357.932) (-357.057) (-357.976) * [-355.668] (-357.415) (-357.045) (-357.393) -- 0:00:30
486000 -- (-356.910) (-361.820) [-358.721] (-355.739) * [-356.327] (-359.263) (-358.411) (-356.028) -- 0:00:30
486500 -- [-358.614] (-357.705) (-355.623) (-360.617) * (-355.919) (-358.539) (-356.331) [-356.059] -- 0:00:30
487000 -- (-357.357) [-358.862] (-355.564) (-356.410) * (-356.728) [-355.634] (-355.173) (-355.314) -- 0:00:30
487500 -- (-360.211) (-358.273) [-355.810] (-358.423) * (-357.775) [-355.635] (-358.457) (-357.780) -- 0:00:30
488000 -- [-357.402] (-361.121) (-356.361) (-360.156) * (-357.289) (-355.578) [-356.904] (-356.772) -- 0:00:30
488500 -- [-357.540] (-358.450) (-358.359) (-355.734) * [-356.843] (-356.233) (-359.330) (-356.629) -- 0:00:30
489000 -- (-356.162) (-361.310) [-355.437] (-357.447) * (-358.868) (-356.696) (-356.279) [-355.988] -- 0:00:31
489500 -- (-358.750) [-357.465] (-356.692) (-359.251) * (-362.633) [-356.363] (-356.394) (-357.501) -- 0:00:31
490000 -- (-356.460) [-359.094] (-356.536) (-359.312) * (-358.528) (-356.803) (-357.625) [-356.396] -- 0:00:31
Average standard deviation of split frequencies: 0.010195
490500 -- [-355.602] (-357.114) (-358.117) (-357.356) * (-356.390) (-355.327) [-360.100] (-356.905) -- 0:00:31
491000 -- (-356.433) [-358.673] (-359.200) (-358.159) * (-355.952) [-356.508] (-358.630) (-358.540) -- 0:00:31
491500 -- (-356.622) (-358.174) [-361.482] (-359.136) * (-356.458) (-355.501) (-355.674) [-356.974] -- 0:00:31
492000 -- (-357.090) (-358.600) (-361.532) [-358.746] * (-356.106) (-359.068) (-356.860) [-356.244] -- 0:00:30
492500 -- (-359.553) [-356.550] (-359.892) (-356.834) * (-356.206) [-358.015] (-356.020) (-356.758) -- 0:00:30
493000 -- (-360.498) (-356.669) (-361.170) [-356.746] * (-357.447) (-359.312) (-358.375) [-358.331] -- 0:00:30
493500 -- (-358.561) (-356.099) (-360.080) [-355.937] * (-359.880) (-359.200) (-356.749) [-355.565] -- 0:00:30
494000 -- [-357.364] (-355.899) (-360.405) (-358.388) * [-357.455] (-356.779) (-356.559) (-357.190) -- 0:00:30
494500 -- (-356.059) (-355.899) (-356.338) [-357.882] * (-355.728) (-360.818) [-357.920] (-358.773) -- 0:00:30
495000 -- [-355.908] (-356.664) (-359.353) (-358.828) * (-356.926) (-357.277) [-355.933] (-356.090) -- 0:00:30
Average standard deviation of split frequencies: 0.010402
495500 -- [-357.413] (-356.249) (-358.944) (-356.646) * (-358.529) (-357.455) [-356.716] (-357.015) -- 0:00:30
496000 -- [-356.458] (-357.205) (-355.921) (-356.294) * (-358.021) [-357.773] (-356.947) (-358.009) -- 0:00:30
496500 -- [-355.640] (-357.218) (-357.087) (-359.874) * (-362.550) (-359.150) [-356.824] (-358.594) -- 0:00:30
497000 -- (-355.980) (-356.633) (-357.866) [-357.169] * (-357.420) [-356.659] (-357.622) (-356.186) -- 0:00:30
497500 -- (-356.011) (-360.146) (-357.892) [-356.392] * (-356.886) (-357.336) (-357.047) [-358.530] -- 0:00:30
498000 -- [-356.735] (-359.662) (-358.425) (-356.609) * (-360.134) [-355.973] (-359.039) (-358.907) -- 0:00:30
498500 -- (-357.076) [-356.544] (-355.354) (-362.310) * (-364.007) (-364.024) (-357.772) [-356.038] -- 0:00:30
499000 -- (-358.649) (-359.766) [-355.582] (-361.926) * (-358.820) [-360.609] (-358.712) (-357.300) -- 0:00:30
499500 -- [-357.416] (-363.040) (-356.850) (-359.466) * (-355.983) (-357.622) (-356.202) [-358.268] -- 0:00:30
500000 -- [-355.564] (-360.846) (-358.811) (-357.906) * [-356.057] (-358.827) (-355.856) (-357.757) -- 0:00:30
Average standard deviation of split frequencies: 0.010800
500500 -- [-361.980] (-362.456) (-357.427) (-359.352) * (-357.228) (-358.835) (-356.867) [-356.253] -- 0:00:29
501000 -- [-356.561] (-359.412) (-358.302) (-362.528) * [-358.386] (-358.549) (-356.480) (-356.503) -- 0:00:29
501500 -- (-356.445) (-357.893) (-356.366) [-360.439] * (-357.160) (-360.244) [-356.777] (-358.588) -- 0:00:29
502000 -- [-357.024] (-359.932) (-357.682) (-358.865) * (-356.386) (-360.108) [-360.236] (-362.335) -- 0:00:29
502500 -- (-360.091) (-359.667) [-357.630] (-356.724) * (-356.610) (-359.591) (-355.953) [-355.312] -- 0:00:29
503000 -- (-356.080) (-357.573) (-359.047) [-356.154] * (-357.827) [-360.341] (-355.748) (-364.922) -- 0:00:29
503500 -- [-356.718] (-357.856) (-358.572) (-357.036) * [-355.682] (-356.969) (-356.212) (-355.977) -- 0:00:29
504000 -- (-357.720) (-357.260) (-356.994) [-356.684] * (-357.910) (-358.807) [-356.831] (-356.672) -- 0:00:29
504500 -- [-355.445] (-359.967) (-356.894) (-356.521) * (-355.746) (-358.781) (-358.069) [-357.274] -- 0:00:29
505000 -- (-359.865) (-356.844) [-357.815] (-358.157) * (-355.685) (-355.572) [-359.776] (-356.025) -- 0:00:29
Average standard deviation of split frequencies: 0.010851
505500 -- [-360.530] (-357.615) (-362.166) (-360.182) * (-357.052) [-356.588] (-358.120) (-356.732) -- 0:00:30
506000 -- (-356.423) (-358.072) (-359.449) [-356.899] * (-356.734) [-357.794] (-359.571) (-358.064) -- 0:00:30
506500 -- (-359.379) (-360.839) [-357.486] (-356.096) * (-358.571) [-356.978] (-357.549) (-356.365) -- 0:00:30
507000 -- (-357.363) (-356.299) [-356.804] (-356.084) * [-358.887] (-355.872) (-358.038) (-356.777) -- 0:00:30
507500 -- [-357.177] (-357.522) (-355.938) (-355.536) * (-356.642) [-356.693] (-358.436) (-357.938) -- 0:00:30
508000 -- [-360.660] (-356.590) (-355.676) (-356.582) * [-355.389] (-360.191) (-356.764) (-359.105) -- 0:00:30
508500 -- [-362.237] (-360.217) (-356.003) (-355.770) * (-358.826) [-355.514] (-358.115) (-360.161) -- 0:00:29
509000 -- [-359.354] (-356.428) (-357.786) (-357.359) * (-357.367) [-357.569] (-356.572) (-356.608) -- 0:00:29
509500 -- (-356.275) (-356.170) (-360.980) [-357.619] * (-358.419) [-355.888] (-357.280) (-356.882) -- 0:00:29
510000 -- [-357.228] (-356.442) (-359.530) (-356.979) * (-361.019) [-357.540] (-355.655) (-355.221) -- 0:00:29
Average standard deviation of split frequencies: 0.010914
510500 -- (-359.460) [-355.907] (-357.283) (-356.760) * (-364.505) (-359.376) (-356.862) [-356.970] -- 0:00:29
511000 -- (-356.257) (-356.909) [-355.058] (-357.378) * [-357.996] (-359.495) (-357.058) (-357.052) -- 0:00:29
511500 -- [-355.069] (-355.885) (-357.538) (-358.588) * (-358.059) (-357.300) (-357.936) [-356.293] -- 0:00:29
512000 -- [-355.825] (-357.455) (-359.347) (-359.471) * (-356.219) (-357.783) (-355.889) [-357.957] -- 0:00:29
512500 -- (-357.627) (-357.739) (-359.479) [-361.481] * (-357.606) [-356.605] (-356.935) (-361.158) -- 0:00:29
513000 -- (-358.058) [-357.136] (-358.297) (-356.902) * (-356.911) (-361.092) (-359.046) [-355.885] -- 0:00:29
513500 -- (-355.753) (-358.389) [-358.492] (-364.546) * [-356.561] (-357.591) (-356.496) (-356.998) -- 0:00:29
514000 -- (-358.365) (-358.042) [-357.648] (-355.473) * (-358.996) [-357.024] (-358.584) (-363.150) -- 0:00:29
514500 -- [-358.656] (-360.044) (-359.669) (-359.843) * (-357.358) (-356.526) (-355.399) [-357.646] -- 0:00:29
515000 -- [-359.459] (-356.892) (-355.936) (-359.286) * (-356.990) [-358.237] (-359.398) (-358.724) -- 0:00:29
Average standard deviation of split frequencies: 0.011248
515500 -- (-357.345) (-359.333) [-356.497] (-357.007) * (-359.598) (-356.693) (-357.428) [-358.937] -- 0:00:29
516000 -- [-355.508] (-359.981) (-363.386) (-356.857) * (-361.611) [-356.244] (-362.844) (-359.583) -- 0:00:29
516500 -- (-355.161) (-357.096) [-355.710] (-355.930) * (-358.421) (-356.244) [-361.584] (-356.302) -- 0:00:29
517000 -- (-361.161) (-356.965) (-355.234) [-356.180] * [-356.451] (-356.720) (-362.172) (-359.766) -- 0:00:28
517500 -- (-359.482) [-356.314] (-355.278) (-358.165) * [-355.779] (-357.918) (-359.997) (-356.925) -- 0:00:28
518000 -- (-356.551) (-358.669) [-356.371] (-358.274) * [-363.973] (-356.424) (-357.607) (-360.294) -- 0:00:28
518500 -- (-355.712) [-356.121] (-356.796) (-357.254) * (-359.196) [-357.888] (-356.279) (-360.744) -- 0:00:28
519000 -- [-356.112] (-355.580) (-355.521) (-358.331) * (-356.264) (-358.738) [-360.406] (-357.051) -- 0:00:28
519500 -- (-360.524) (-357.166) [-357.013] (-356.142) * (-356.639) [-355.493] (-355.442) (-359.207) -- 0:00:28
520000 -- (-360.686) [-355.569] (-357.893) (-356.566) * (-355.783) [-355.765] (-359.673) (-359.509) -- 0:00:28
Average standard deviation of split frequencies: 0.011317
520500 -- (-356.671) (-357.231) (-357.444) [-361.790] * [-358.893] (-356.890) (-357.160) (-358.049) -- 0:00:28
521000 -- [-355.776] (-359.465) (-361.001) (-356.321) * (-356.402) (-355.548) [-360.133] (-356.944) -- 0:00:28
521500 -- (-356.968) (-359.163) (-360.891) [-355.417] * (-359.200) [-355.662] (-360.267) (-356.642) -- 0:00:28
522000 -- (-356.130) (-358.237) [-357.196] (-357.710) * (-359.033) (-355.571) [-361.791] (-358.853) -- 0:00:29
522500 -- (-358.096) (-361.721) (-359.079) [-355.929] * (-357.393) (-355.769) (-357.950) [-360.287] -- 0:00:29
523000 -- (-357.689) [-361.364] (-359.614) (-355.740) * (-360.218) (-361.746) [-355.982] (-355.996) -- 0:00:29
523500 -- (-359.424) (-357.277) [-360.682] (-356.897) * (-355.644) [-356.717] (-357.547) (-360.531) -- 0:00:29
524000 -- [-356.938] (-355.725) (-358.055) (-357.991) * (-361.073) [-356.858] (-356.515) (-355.177) -- 0:00:29
524500 -- (-358.301) (-356.458) (-358.035) [-356.003] * [-356.116] (-358.364) (-356.957) (-359.935) -- 0:00:29
525000 -- [-355.289] (-357.613) (-358.645) (-360.069) * (-355.788) (-358.617) [-359.601] (-361.711) -- 0:00:28
Average standard deviation of split frequencies: 0.010923
525500 -- [-355.473] (-360.562) (-356.941) (-357.533) * (-355.827) (-357.635) (-358.426) [-356.667] -- 0:00:28
526000 -- [-360.650] (-356.898) (-356.813) (-359.805) * (-356.397) (-356.688) [-357.314] (-357.129) -- 0:00:28
526500 -- (-356.249) [-357.311] (-357.640) (-357.707) * (-363.192) (-357.715) [-355.408] (-358.526) -- 0:00:28
527000 -- (-358.159) [-357.878] (-358.539) (-360.074) * (-356.209) (-357.171) [-357.589] (-360.547) -- 0:00:28
527500 -- (-357.281) (-359.092) [-355.736] (-357.164) * [-355.854] (-359.601) (-357.250) (-358.011) -- 0:00:28
528000 -- (-357.064) (-357.560) [-357.365] (-356.058) * (-356.051) (-357.675) [-356.271] (-356.055) -- 0:00:28
528500 -- (-355.962) (-359.396) [-357.014] (-355.771) * [-356.104] (-358.685) (-357.864) (-357.359) -- 0:00:28
529000 -- (-356.279) (-356.224) [-357.393] (-357.590) * (-356.900) [-356.646] (-357.170) (-357.149) -- 0:00:28
529500 -- (-359.439) (-356.813) [-356.084] (-360.113) * (-357.075) (-355.801) [-356.554] (-358.612) -- 0:00:28
530000 -- (-359.876) (-359.274) (-358.966) [-358.185] * (-357.750) [-360.117] (-356.208) (-359.723) -- 0:00:28
Average standard deviation of split frequencies: 0.010549
530500 -- (-358.106) [-357.067] (-356.282) (-359.642) * (-358.074) (-356.857) (-360.791) [-358.200] -- 0:00:28
531000 -- (-356.621) (-358.204) [-358.661] (-356.202) * (-356.886) (-356.256) [-357.527] (-358.663) -- 0:00:28
531500 -- (-356.483) (-358.891) (-364.669) [-355.465] * [-355.620] (-358.559) (-357.035) (-356.953) -- 0:00:28
532000 -- (-357.598) (-359.903) (-362.198) [-360.249] * (-358.720) (-362.069) [-358.441] (-355.883) -- 0:00:28
532500 -- (-357.611) (-361.593) (-357.079) [-356.736] * (-358.597) [-359.154] (-356.562) (-355.450) -- 0:00:28
533000 -- (-357.685) [-357.418] (-357.043) (-359.836) * (-357.369) [-357.256] (-357.127) (-358.000) -- 0:00:28
533500 -- (-357.661) (-358.612) [-357.712] (-356.963) * (-355.722) (-357.615) [-358.633] (-360.017) -- 0:00:27
534000 -- (-356.033) [-355.907] (-357.257) (-358.091) * (-358.504) (-357.871) [-356.052] (-358.015) -- 0:00:27
534500 -- [-357.912] (-358.483) (-356.368) (-356.131) * [-356.793] (-357.580) (-355.896) (-357.668) -- 0:00:27
535000 -- (-356.970) [-356.736] (-358.110) (-356.052) * (-355.734) (-357.047) (-357.113) [-357.238] -- 0:00:27
Average standard deviation of split frequencies: 0.010444
535500 -- (-358.875) (-356.211) [-355.144] (-359.538) * [-355.750] (-355.890) (-358.316) (-355.486) -- 0:00:27
536000 -- (-357.436) (-358.163) [-355.585] (-359.630) * [-355.415] (-355.580) (-356.908) (-357.034) -- 0:00:27
536500 -- (-357.432) (-359.868) [-356.197] (-359.604) * [-357.067] (-357.905) (-356.148) (-359.516) -- 0:00:27
537000 -- [-358.477] (-358.663) (-360.255) (-357.038) * (-356.892) [-355.656] (-357.289) (-357.504) -- 0:00:27
537500 -- (-365.251) (-356.375) [-358.509] (-356.142) * [-356.576] (-357.784) (-357.368) (-356.727) -- 0:00:27
538000 -- (-358.189) (-359.171) (-361.560) [-357.274] * [-358.014] (-360.480) (-358.435) (-356.048) -- 0:00:27
538500 -- [-358.848] (-362.566) (-358.827) (-357.864) * [-355.659] (-361.559) (-356.506) (-356.791) -- 0:00:27
539000 -- (-356.445) [-359.354] (-356.137) (-355.820) * [-356.919] (-356.824) (-356.933) (-359.378) -- 0:00:28
539500 -- [-356.054] (-357.015) (-357.763) (-355.748) * [-356.379] (-357.873) (-357.806) (-355.614) -- 0:00:28
540000 -- (-360.136) (-361.206) [-355.939] (-356.946) * [-355.605] (-357.170) (-357.791) (-356.392) -- 0:00:28
Average standard deviation of split frequencies: 0.009754
540500 -- (-359.591) (-357.270) [-355.230] (-356.828) * (-355.828) [-356.060] (-356.438) (-359.337) -- 0:00:28
541000 -- [-356.640] (-357.318) (-355.282) (-356.116) * (-356.120) (-358.725) (-360.080) [-359.493] -- 0:00:27
541500 -- (-355.383) [-355.981] (-356.915) (-355.850) * (-355.888) (-357.925) (-357.490) [-361.294] -- 0:00:27
542000 -- (-356.203) (-356.579) [-358.628] (-357.252) * (-358.119) (-356.042) (-357.241) [-359.526] -- 0:00:27
542500 -- (-356.548) (-357.501) [-360.363] (-357.383) * (-361.394) (-361.495) (-356.862) [-358.796] -- 0:00:27
543000 -- (-355.528) [-356.523] (-356.336) (-358.426) * (-357.397) (-361.707) (-360.911) [-358.360] -- 0:00:27
543500 -- (-356.228) [-355.677] (-355.499) (-357.704) * (-358.065) (-357.438) (-356.612) [-357.693] -- 0:00:27
544000 -- (-358.898) (-356.375) [-358.394] (-357.628) * (-357.034) (-358.763) [-356.109] (-356.814) -- 0:00:27
544500 -- (-359.790) [-357.746] (-356.610) (-356.617) * (-358.418) (-356.076) [-356.697] (-358.660) -- 0:00:27
545000 -- [-358.599] (-355.301) (-356.475) (-355.976) * (-362.489) (-362.792) (-356.546) [-356.546] -- 0:00:27
Average standard deviation of split frequencies: 0.009497
545500 -- [-359.425] (-357.064) (-355.402) (-360.479) * (-357.330) (-359.638) [-357.455] (-359.436) -- 0:00:27
546000 -- (-356.294) [-357.680] (-362.760) (-359.860) * [-356.153] (-357.424) (-355.773) (-359.623) -- 0:00:27
546500 -- (-356.448) (-358.423) [-356.891] (-359.196) * (-356.205) (-355.838) [-359.943] (-356.228) -- 0:00:27
547000 -- (-355.066) (-358.999) [-356.069] (-356.082) * (-356.768) (-356.148) [-355.829] (-357.591) -- 0:00:27
547500 -- (-356.270) [-357.725] (-357.558) (-356.321) * [-355.242] (-357.348) (-357.093) (-356.765) -- 0:00:27
548000 -- (-358.246) (-356.813) [-356.907] (-356.243) * (-356.071) (-358.244) (-357.765) [-356.488] -- 0:00:27
548500 -- [-356.232] (-358.020) (-358.967) (-358.729) * (-356.332) (-355.651) (-358.157) [-359.845] -- 0:00:27
549000 -- (-357.861) (-361.291) [-364.870] (-357.611) * [-357.213] (-357.465) (-355.473) (-359.002) -- 0:00:27
549500 -- (-359.260) (-360.535) (-358.960) [-359.776] * [-358.813] (-356.998) (-357.348) (-356.288) -- 0:00:27
550000 -- [-355.567] (-355.796) (-357.461) (-355.605) * (-357.723) (-356.977) (-356.632) [-357.364] -- 0:00:27
Average standard deviation of split frequencies: 0.009577
550500 -- (-355.674) (-357.661) [-357.378] (-355.585) * (-358.796) (-356.797) [-355.445] (-355.952) -- 0:00:26
551000 -- [-356.569] (-357.286) (-358.166) (-355.516) * (-357.724) [-355.421] (-356.464) (-356.516) -- 0:00:26
551500 -- (-356.066) (-356.178) [-355.552] (-360.297) * [-358.918] (-357.398) (-357.416) (-356.347) -- 0:00:26
552000 -- (-359.150) [-356.796] (-357.813) (-361.672) * (-359.059) (-358.889) [-356.701] (-356.992) -- 0:00:26
552500 -- (-358.368) (-357.832) (-360.952) [-355.445] * (-357.679) [-358.430] (-359.010) (-358.528) -- 0:00:26
553000 -- (-357.393) [-358.626] (-359.578) (-359.954) * [-356.267] (-363.420) (-357.702) (-356.013) -- 0:00:26
553500 -- [-358.392] (-361.096) (-362.109) (-356.771) * (-359.490) [-359.441] (-355.561) (-357.730) -- 0:00:26
554000 -- (-355.935) [-355.513] (-358.991) (-356.552) * (-359.012) (-360.445) [-357.269] (-357.652) -- 0:00:26
554500 -- (-359.039) (-355.697) (-358.826) [-361.105] * (-355.620) (-359.553) [-356.139] (-357.946) -- 0:00:26
555000 -- [-356.213] (-356.988) (-356.989) (-358.680) * (-355.246) (-355.811) (-361.106) [-357.029] -- 0:00:26
Average standard deviation of split frequencies: 0.009114
555500 -- [-359.748] (-355.303) (-356.792) (-357.223) * (-357.938) (-356.545) (-357.661) [-355.538] -- 0:00:26
556000 -- (-358.444) [-355.816] (-359.436) (-359.544) * (-356.342) [-355.550] (-357.222) (-359.393) -- 0:00:27
556500 -- (-359.774) (-355.984) (-359.186) [-356.746] * (-359.292) (-358.388) [-358.987] (-357.674) -- 0:00:27
557000 -- (-362.000) (-355.676) [-356.019] (-355.838) * (-356.069) (-355.848) [-356.875] (-356.318) -- 0:00:27
557500 -- (-357.718) [-355.976] (-355.875) (-358.469) * (-361.187) (-356.981) (-355.557) [-356.247] -- 0:00:26
558000 -- [-356.250] (-355.239) (-357.554) (-358.252) * (-358.406) (-357.089) (-355.554) [-355.319] -- 0:00:26
558500 -- (-360.966) (-356.426) [-356.346] (-360.421) * (-357.372) (-361.798) [-355.434] (-355.190) -- 0:00:26
559000 -- (-358.833) [-355.572] (-357.051) (-358.864) * (-363.152) (-358.179) (-359.450) [-358.935] -- 0:00:26
559500 -- (-355.458) (-356.343) [-357.810] (-357.457) * (-356.168) (-356.918) (-358.413) [-358.119] -- 0:00:26
560000 -- (-358.162) (-357.531) (-357.448) [-360.106] * (-358.685) (-356.395) [-357.833] (-357.974) -- 0:00:26
Average standard deviation of split frequencies: 0.009249
560500 -- [-358.878] (-355.620) (-357.363) (-359.170) * (-355.893) (-359.173) [-357.766] (-359.074) -- 0:00:26
561000 -- (-358.409) (-355.885) (-359.056) [-355.963] * [-356.302] (-357.361) (-358.297) (-358.294) -- 0:00:26
561500 -- (-359.568) (-354.986) (-355.806) [-357.291] * (-356.335) (-356.568) (-356.724) [-356.199] -- 0:00:26
562000 -- (-358.972) [-355.709] (-357.034) (-358.336) * (-357.968) (-358.029) (-358.231) [-355.594] -- 0:00:26
562500 -- (-358.940) (-356.121) [-358.233] (-358.505) * (-360.920) [-355.520] (-356.979) (-361.084) -- 0:00:26
563000 -- (-356.907) (-355.869) [-356.839] (-356.613) * (-362.584) [-355.161] (-358.634) (-356.409) -- 0:00:26
563500 -- (-361.442) (-359.677) (-355.752) [-357.311] * [-360.104] (-355.178) (-360.225) (-358.785) -- 0:00:26
564000 -- (-357.791) [-358.781] (-356.985) (-357.030) * [-357.017] (-357.425) (-357.995) (-361.224) -- 0:00:26
564500 -- (-357.642) (-356.061) [-357.013] (-358.481) * (-357.247) (-355.460) [-355.346] (-357.393) -- 0:00:26
565000 -- (-357.677) [-358.522] (-357.175) (-356.338) * (-358.182) [-356.927] (-356.750) (-357.378) -- 0:00:26
Average standard deviation of split frequencies: 0.008849
565500 -- [-358.533] (-356.684) (-355.020) (-355.083) * (-359.325) (-356.640) [-361.554] (-357.980) -- 0:00:26
566000 -- (-358.030) (-358.518) [-358.200] (-355.048) * [-356.933] (-355.701) (-357.640) (-355.983) -- 0:00:26
566500 -- (-356.509) [-358.922] (-357.094) (-360.900) * [-355.052] (-355.814) (-360.305) (-357.687) -- 0:00:26
567000 -- (-356.778) (-357.525) [-358.867] (-357.296) * (-356.973) (-357.608) (-360.318) [-359.223] -- 0:00:25
567500 -- (-355.980) (-358.503) (-358.477) [-358.717] * (-356.580) [-357.430] (-359.128) (-360.690) -- 0:00:25
568000 -- [-357.388] (-356.352) (-357.041) (-359.698) * (-358.783) [-356.643] (-356.072) (-358.667) -- 0:00:25
568500 -- (-355.864) (-358.670) [-361.123] (-359.781) * (-362.486) (-359.811) [-360.455] (-357.605) -- 0:00:25
569000 -- (-355.574) (-355.400) [-359.406] (-358.618) * (-358.885) (-362.339) [-355.402] (-356.557) -- 0:00:25
569500 -- (-355.505) (-358.696) [-358.191] (-355.796) * (-359.853) (-361.786) (-355.289) [-355.474] -- 0:00:25
570000 -- (-357.765) [-357.696] (-357.666) (-356.928) * (-356.198) [-356.540] (-358.354) (-356.404) -- 0:00:25
Average standard deviation of split frequencies: 0.008622
570500 -- (-358.570) [-358.360] (-362.049) (-356.975) * (-358.171) (-356.776) (-358.190) [-356.662] -- 0:00:25
571000 -- (-356.874) (-357.958) (-358.145) [-356.322] * (-359.020) (-360.151) (-356.261) [-356.919] -- 0:00:25
571500 -- (-355.198) (-359.203) [-359.990] (-356.788) * (-356.583) (-361.354) (-355.235) [-355.639] -- 0:00:25
572000 -- [-357.636] (-357.817) (-358.090) (-356.354) * (-355.412) (-366.702) [-355.493] (-356.347) -- 0:00:25
572500 -- [-356.209] (-358.066) (-358.408) (-356.648) * (-355.564) [-358.268] (-357.390) (-359.601) -- 0:00:25
573000 -- [-355.005] (-360.404) (-359.525) (-360.973) * (-356.118) (-356.762) (-355.704) [-358.311] -- 0:00:26
573500 -- (-355.130) (-356.380) (-357.135) [-358.120] * [-355.764] (-356.675) (-360.980) (-361.441) -- 0:00:26
574000 -- (-358.016) (-358.234) (-357.324) [-356.655] * (-356.254) (-356.648) (-363.029) [-362.474] -- 0:00:25
574500 -- (-356.912) (-358.207) [-355.065] (-355.699) * (-358.946) (-355.160) (-359.980) [-355.631] -- 0:00:25
575000 -- (-357.217) (-355.752) (-356.344) [-358.770] * (-358.316) (-357.215) [-355.903] (-357.096) -- 0:00:25
Average standard deviation of split frequencies: 0.008644
575500 -- (-360.132) [-356.062] (-355.661) (-356.119) * [-358.048] (-355.275) (-357.765) (-357.156) -- 0:00:25
576000 -- (-357.380) (-355.712) (-355.490) [-357.600] * (-355.814) (-357.202) (-357.152) [-356.039] -- 0:00:25
576500 -- (-358.747) [-358.897] (-357.644) (-357.601) * (-360.549) [-355.907] (-359.093) (-357.242) -- 0:00:25
577000 -- (-362.899) (-357.587) [-360.763] (-357.471) * (-356.059) (-359.444) [-355.356] (-357.010) -- 0:00:25
577500 -- [-359.386] (-357.777) (-360.528) (-359.656) * (-356.029) (-358.121) [-355.096] (-357.025) -- 0:00:25
578000 -- (-356.007) (-357.145) [-356.685] (-355.764) * (-355.986) (-358.019) [-357.356] (-357.271) -- 0:00:25
578500 -- (-356.141) [-355.342] (-363.296) (-355.776) * (-357.809) (-356.067) (-355.070) [-357.522] -- 0:00:25
579000 -- [-356.624] (-356.075) (-357.919) (-359.891) * (-361.862) (-355.212) [-355.885] (-358.234) -- 0:00:25
579500 -- [-355.662] (-357.524) (-355.129) (-356.281) * (-357.243) (-355.855) [-356.837] (-356.437) -- 0:00:25
580000 -- [-356.414] (-355.327) (-359.870) (-355.807) * (-356.999) (-356.945) (-358.054) [-356.090] -- 0:00:25
Average standard deviation of split frequencies: 0.008474
580500 -- (-359.597) (-358.776) (-362.116) [-355.656] * (-357.027) (-356.869) [-355.390] (-357.617) -- 0:00:25
581000 -- (-356.274) (-355.766) [-356.526] (-356.061) * (-360.486) (-358.204) (-357.664) [-356.900] -- 0:00:25
581500 -- [-358.951] (-355.203) (-357.099) (-357.933) * (-360.835) (-361.640) [-358.075] (-355.963) -- 0:00:25
582000 -- [-356.719] (-355.605) (-359.043) (-360.040) * (-358.449) (-359.059) [-355.212] (-358.923) -- 0:00:25
582500 -- [-356.339] (-356.658) (-357.302) (-359.698) * (-356.271) (-356.306) (-357.246) [-356.790] -- 0:00:25
583000 -- (-359.290) (-356.019) (-359.773) [-355.572] * (-359.191) [-358.230] (-361.601) (-358.615) -- 0:00:25
583500 -- (-358.920) [-355.302] (-355.644) (-356.462) * (-358.237) (-357.556) (-356.150) [-359.370] -- 0:00:24
584000 -- (-357.738) [-356.621] (-356.297) (-356.557) * (-356.116) (-359.310) [-355.839] (-357.860) -- 0:00:24
584500 -- (-357.523) (-356.874) (-357.046) [-357.095] * (-355.895) [-359.010] (-358.309) (-357.483) -- 0:00:24
585000 -- (-356.700) [-359.336] (-357.312) (-358.599) * (-355.951) [-356.039] (-357.009) (-358.895) -- 0:00:24
Average standard deviation of split frequencies: 0.008547
585500 -- [-355.470] (-357.144) (-355.502) (-357.518) * (-359.528) (-364.159) (-360.011) [-358.633] -- 0:00:24
586000 -- (-356.481) [-358.000] (-356.622) (-357.626) * (-356.289) [-357.843] (-358.287) (-358.637) -- 0:00:24
586500 -- (-357.136) (-358.791) [-356.752] (-357.149) * (-356.315) (-362.441) [-362.202] (-357.507) -- 0:00:24
587000 -- (-358.380) (-361.805) (-356.778) [-356.451] * (-356.969) (-356.484) [-356.054] (-357.025) -- 0:00:24
587500 -- (-358.193) [-356.534] (-357.061) (-356.000) * (-356.008) (-356.620) [-358.009] (-361.065) -- 0:00:24
588000 -- (-356.709) [-358.699] (-361.368) (-356.745) * [-356.620] (-356.169) (-356.245) (-357.169) -- 0:00:24
588500 -- (-359.119) (-357.771) (-359.298) [-356.992] * (-356.435) [-358.773] (-357.113) (-357.365) -- 0:00:24
589000 -- (-356.583) [-357.299] (-355.854) (-359.931) * (-358.093) [-361.223] (-359.242) (-356.208) -- 0:00:24
589500 -- (-357.671) (-356.940) (-360.117) [-360.286] * (-357.303) (-358.306) (-359.267) [-358.683] -- 0:00:24
590000 -- (-358.345) [-357.631] (-364.686) (-358.623) * (-355.923) (-359.778) (-357.393) [-361.499] -- 0:00:25
Average standard deviation of split frequencies: 0.008829
590500 -- [-357.854] (-359.303) (-360.626) (-355.281) * (-357.535) [-356.010] (-359.097) (-358.220) -- 0:00:24
591000 -- (-358.415) [-355.699] (-358.770) (-356.340) * (-359.356) (-358.880) [-357.094] (-361.588) -- 0:00:24
591500 -- (-358.068) [-357.508] (-355.798) (-357.654) * (-358.107) [-356.105] (-356.727) (-357.787) -- 0:00:24
592000 -- (-356.385) [-355.754] (-355.848) (-360.848) * (-359.652) (-360.980) [-356.136] (-355.120) -- 0:00:24
592500 -- (-355.363) [-356.390] (-355.634) (-358.543) * (-355.964) (-359.704) [-356.463] (-355.299) -- 0:00:24
593000 -- (-355.838) (-358.894) (-356.561) [-356.217] * [-356.759] (-357.523) (-356.544) (-355.868) -- 0:00:24
593500 -- (-355.402) (-358.506) (-355.495) [-355.262] * [-358.573] (-357.034) (-356.404) (-356.771) -- 0:00:24
594000 -- [-358.191] (-358.150) (-355.868) (-357.596) * (-358.362) (-359.551) [-355.872] (-356.578) -- 0:00:24
594500 -- (-356.103) (-356.693) (-356.183) [-359.189] * (-355.334) [-357.398] (-355.733) (-361.474) -- 0:00:24
595000 -- [-358.063] (-355.931) (-356.917) (-358.350) * [-355.428] (-356.441) (-357.419) (-357.542) -- 0:00:24
Average standard deviation of split frequencies: 0.009544
595500 -- (-357.894) (-357.838) (-360.972) [-355.454] * [-356.443] (-364.049) (-356.137) (-357.625) -- 0:00:24
596000 -- (-357.040) [-358.905] (-359.785) (-356.643) * (-358.822) (-358.590) (-356.585) [-359.053] -- 0:00:24
596500 -- [-355.865] (-365.038) (-359.286) (-357.168) * (-357.611) [-357.651] (-359.575) (-364.389) -- 0:00:24
597000 -- [-356.401] (-359.365) (-359.000) (-359.238) * (-357.251) (-357.779) [-355.145] (-355.144) -- 0:00:24
597500 -- [-358.402] (-356.086) (-356.114) (-359.153) * (-359.605) (-356.605) (-356.722) [-359.042] -- 0:00:24
598000 -- (-357.611) (-359.406) [-357.283] (-357.526) * (-355.798) (-355.929) (-355.901) [-356.921] -- 0:00:24
598500 -- (-360.780) (-358.137) (-362.791) [-357.081] * [-358.761] (-356.848) (-356.281) (-357.186) -- 0:00:24
599000 -- [-355.953] (-357.198) (-359.735) (-360.238) * (-356.407) (-360.629) [-356.696] (-356.378) -- 0:00:24
599500 -- [-359.090] (-358.431) (-359.988) (-359.607) * (-360.282) [-357.217] (-357.594) (-358.080) -- 0:00:24
600000 -- (-357.289) (-355.983) [-358.250] (-356.240) * (-360.108) (-357.431) (-357.418) [-355.813] -- 0:00:24
Average standard deviation of split frequencies: 0.009925
600500 -- (-355.939) (-359.900) [-361.287] (-360.329) * (-356.312) [-355.004] (-357.921) (-359.067) -- 0:00:23
601000 -- [-355.474] (-363.267) (-357.574) (-355.835) * (-356.238) (-355.226) (-358.265) [-356.873] -- 0:00:23
601500 -- [-355.661] (-358.715) (-356.386) (-356.505) * [-358.077] (-356.877) (-356.213) (-356.812) -- 0:00:23
602000 -- [-357.062] (-362.017) (-355.591) (-358.101) * (-356.631) (-355.746) (-357.860) [-355.886] -- 0:00:23
602500 -- [-360.189] (-359.056) (-355.754) (-355.958) * (-356.955) [-355.709] (-356.388) (-356.840) -- 0:00:23
603000 -- [-356.638] (-355.833) (-358.901) (-355.840) * [-356.969] (-356.723) (-357.391) (-360.883) -- 0:00:23
603500 -- (-357.858) (-357.266) [-362.154] (-357.692) * [-358.868] (-356.683) (-356.453) (-356.237) -- 0:00:23
604000 -- [-356.349] (-360.309) (-356.562) (-355.707) * [-359.840] (-359.766) (-359.133) (-357.560) -- 0:00:23
604500 -- (-357.846) [-355.279] (-358.937) (-360.610) * (-356.240) [-358.743] (-359.688) (-356.723) -- 0:00:23
605000 -- (-356.854) [-355.675] (-360.190) (-356.985) * (-358.164) (-357.055) (-357.836) [-357.159] -- 0:00:23
Average standard deviation of split frequencies: 0.009884
605500 -- (-357.161) (-358.903) (-357.807) [-358.493] * [-359.447] (-357.243) (-357.037) (-358.495) -- 0:00:23
606000 -- (-357.843) [-355.990] (-356.846) (-362.774) * [-358.106] (-359.797) (-356.372) (-356.508) -- 0:00:23
606500 -- (-359.007) (-356.614) (-357.769) [-356.891] * (-360.818) (-356.119) (-355.750) [-358.128] -- 0:00:24
607000 -- (-357.922) [-355.524] (-359.235) (-356.139) * [-357.890] (-356.172) (-355.739) (-356.595) -- 0:00:23
607500 -- [-356.827] (-358.686) (-364.516) (-356.453) * (-355.816) [-359.845] (-357.402) (-357.394) -- 0:00:23
608000 -- (-359.350) (-356.384) (-357.728) [-358.749] * (-359.453) (-359.091) (-355.169) [-355.897] -- 0:00:23
608500 -- (-357.725) (-357.313) [-355.375] (-357.899) * (-355.535) (-361.347) (-355.591) [-355.799] -- 0:00:23
609000 -- (-358.355) [-356.297] (-360.537) (-357.236) * [-358.152] (-361.933) (-356.384) (-355.540) -- 0:00:23
609500 -- (-356.217) (-355.935) [-355.254] (-357.387) * [-356.123] (-359.008) (-355.429) (-358.865) -- 0:00:23
610000 -- (-355.841) (-357.156) (-355.518) [-357.293] * (-358.316) [-358.147] (-358.690) (-357.713) -- 0:00:23
Average standard deviation of split frequencies: 0.009400
610500 -- [-356.067] (-356.452) (-362.940) (-356.040) * (-356.373) (-359.459) [-359.048] (-358.884) -- 0:00:23
611000 -- [-358.156] (-357.191) (-357.558) (-363.625) * (-357.811) (-357.051) [-356.514] (-361.425) -- 0:00:23
611500 -- [-358.030] (-355.553) (-357.609) (-362.346) * [-356.046] (-359.473) (-358.462) (-356.970) -- 0:00:23
612000 -- [-355.902] (-359.680) (-355.898) (-363.068) * [-359.284] (-356.318) (-359.652) (-355.387) -- 0:00:23
612500 -- (-356.404) [-355.562] (-357.976) (-360.342) * (-360.615) (-359.849) (-357.547) [-360.047] -- 0:00:23
613000 -- (-360.979) [-360.363] (-356.031) (-356.858) * (-357.639) [-356.641] (-359.897) (-355.525) -- 0:00:23
613500 -- (-358.564) [-357.253] (-357.139) (-360.059) * (-357.843) [-357.254] (-357.157) (-357.169) -- 0:00:23
614000 -- (-357.969) (-356.711) [-356.652] (-356.108) * (-358.985) [-356.187] (-358.269) (-359.067) -- 0:00:23
614500 -- (-356.889) [-356.189] (-356.930) (-358.840) * (-357.625) [-360.424] (-357.212) (-359.456) -- 0:00:23
615000 -- (-359.461) (-357.298) [-355.696] (-356.639) * (-357.323) [-356.164] (-356.026) (-356.040) -- 0:00:23
Average standard deviation of split frequencies: 0.009693
615500 -- [-359.349] (-357.350) (-357.347) (-355.643) * [-358.114] (-355.233) (-359.843) (-355.502) -- 0:00:23
616000 -- [-355.958] (-359.135) (-357.252) (-355.754) * (-356.130) [-357.019] (-358.111) (-355.981) -- 0:00:23
616500 -- [-360.094] (-357.213) (-357.230) (-361.616) * (-354.913) (-359.312) [-357.351] (-356.085) -- 0:00:23
617000 -- (-361.834) [-358.070] (-357.509) (-361.810) * (-357.148) [-356.761] (-355.719) (-358.989) -- 0:00:22
617500 -- (-357.077) (-358.314) [-355.923] (-358.181) * (-358.403) (-355.646) [-357.387] (-356.979) -- 0:00:22
618000 -- [-357.462] (-355.668) (-357.168) (-357.956) * (-358.629) (-356.745) (-360.118) [-355.298] -- 0:00:22
618500 -- (-355.852) (-360.031) [-356.232] (-357.728) * (-357.858) (-357.473) [-359.390] (-357.254) -- 0:00:22
619000 -- [-357.711] (-357.412) (-356.469) (-356.671) * (-355.824) (-360.518) (-358.219) [-355.883] -- 0:00:22
619500 -- (-356.708) (-355.920) [-356.668] (-358.658) * (-355.491) (-356.321) (-358.241) [-359.167] -- 0:00:22
620000 -- [-357.401] (-356.213) (-356.986) (-355.387) * (-359.549) [-356.350] (-359.519) (-356.109) -- 0:00:22
Average standard deviation of split frequencies: 0.009921
620500 -- [-356.574] (-361.253) (-359.152) (-355.369) * (-357.354) [-357.094] (-357.774) (-355.914) -- 0:00:22
621000 -- (-357.626) [-356.667] (-358.974) (-355.524) * (-356.617) [-357.065] (-357.143) (-359.927) -- 0:00:22
621500 -- (-355.454) (-362.091) (-355.727) [-358.049] * [-355.341] (-358.018) (-355.754) (-355.511) -- 0:00:22
622000 -- (-357.873) (-356.912) [-356.599] (-358.288) * (-356.072) [-356.364] (-357.067) (-357.142) -- 0:00:22
622500 -- (-359.825) (-356.296) [-355.581] (-359.442) * (-355.781) [-355.482] (-356.619) (-357.651) -- 0:00:22
623000 -- (-358.003) [-357.001] (-356.718) (-357.328) * (-357.055) (-356.267) (-356.964) [-357.981] -- 0:00:22
623500 -- (-358.420) (-358.417) (-356.094) [-359.717] * (-357.974) (-360.951) (-361.024) [-358.547] -- 0:00:22
624000 -- (-357.655) [-356.938] (-355.628) (-355.754) * (-360.262) (-357.538) (-360.157) [-356.452] -- 0:00:22
624500 -- (-357.747) (-356.901) [-355.773] (-356.490) * (-358.627) (-357.357) (-360.911) [-356.243] -- 0:00:22
625000 -- [-357.479] (-356.680) (-356.634) (-357.354) * (-360.079) (-356.914) (-361.854) [-356.092] -- 0:00:22
Average standard deviation of split frequencies: 0.010191
625500 -- [-355.523] (-358.419) (-358.449) (-363.579) * [-357.626] (-361.759) (-361.020) (-356.022) -- 0:00:22
626000 -- (-355.423) [-357.356] (-358.758) (-359.682) * (-356.043) [-356.665] (-357.698) (-355.437) -- 0:00:22
626500 -- [-355.809] (-358.425) (-358.357) (-357.358) * (-356.987) [-357.014] (-363.349) (-356.020) -- 0:00:22
627000 -- (-359.177) (-360.054) [-356.612] (-358.604) * (-358.913) (-360.604) [-356.094] (-358.883) -- 0:00:22
627500 -- [-357.022] (-362.442) (-358.812) (-358.090) * (-361.063) [-358.855] (-362.005) (-359.304) -- 0:00:22
628000 -- (-357.777) (-358.642) (-364.371) [-359.659] * (-355.613) (-358.169) [-357.338] (-358.961) -- 0:00:22
628500 -- [-357.724] (-356.684) (-355.944) (-358.667) * (-359.064) (-355.616) [-356.955] (-358.482) -- 0:00:22
629000 -- (-356.555) (-357.742) (-362.579) [-355.693] * (-357.381) [-357.771] (-356.711) (-361.931) -- 0:00:22
629500 -- (-356.532) (-358.232) (-362.029) [-356.631] * (-356.025) (-355.888) [-355.930] (-357.184) -- 0:00:22
630000 -- (-356.575) [-356.078] (-365.183) (-357.407) * (-355.953) [-357.390] (-357.814) (-359.181) -- 0:00:22
Average standard deviation of split frequencies: 0.010465
630500 -- (-356.356) (-357.649) [-360.660] (-358.246) * (-355.785) (-357.885) (-356.992) [-356.411] -- 0:00:22
631000 -- [-356.912] (-356.482) (-364.156) (-359.201) * [-357.758] (-359.620) (-355.389) (-364.929) -- 0:00:22
631500 -- [-358.163] (-355.031) (-357.745) (-356.352) * (-356.377) [-359.343] (-356.783) (-360.539) -- 0:00:22
632000 -- (-357.442) [-358.468] (-357.865) (-358.676) * (-356.555) [-357.561] (-359.404) (-358.346) -- 0:00:22
632500 -- [-357.400] (-358.063) (-365.146) (-358.805) * (-357.062) [-358.260] (-359.093) (-358.132) -- 0:00:22
633000 -- [-356.879] (-356.589) (-362.102) (-357.293) * (-355.657) [-355.513] (-358.671) (-360.019) -- 0:00:22
633500 -- [-355.523] (-358.837) (-360.611) (-360.172) * (-357.651) (-358.028) (-356.515) [-358.332] -- 0:00:21
634000 -- (-356.710) [-362.303] (-362.529) (-356.231) * (-356.616) (-359.186) (-355.633) [-357.211] -- 0:00:21
634500 -- (-357.228) (-359.319) (-369.087) [-358.497] * (-358.527) (-358.006) [-355.725] (-355.777) -- 0:00:21
635000 -- (-355.779) (-356.686) (-359.063) [-356.967] * (-355.431) [-355.459] (-358.153) (-357.174) -- 0:00:21
Average standard deviation of split frequencies: 0.009984
635500 -- [-357.872] (-356.884) (-359.891) (-364.179) * (-355.356) (-357.185) (-356.921) [-356.733] -- 0:00:21
636000 -- (-356.078) (-356.124) (-357.766) [-356.409] * [-355.410] (-360.298) (-357.159) (-356.500) -- 0:00:21
636500 -- (-357.872) [-355.767] (-356.212) (-357.729) * (-356.305) (-356.911) [-359.003] (-357.129) -- 0:00:21
637000 -- (-361.395) (-359.261) [-360.959] (-358.893) * (-356.189) [-358.004] (-355.845) (-359.036) -- 0:00:21
637500 -- [-357.453] (-355.562) (-359.126) (-358.919) * (-356.848) (-356.511) [-359.813] (-358.010) -- 0:00:21
638000 -- (-362.154) [-359.253] (-359.164) (-358.128) * (-357.500) (-357.270) (-356.332) [-357.952] -- 0:00:21
638500 -- (-360.098) (-358.037) [-358.687] (-356.382) * (-358.499) (-360.642) [-358.104] (-356.328) -- 0:00:21
639000 -- (-356.972) [-359.011] (-356.003) (-362.717) * (-357.784) [-357.393] (-359.951) (-355.685) -- 0:00:21
639500 -- [-355.665] (-356.454) (-358.032) (-358.186) * [-356.107] (-355.752) (-357.759) (-359.799) -- 0:00:21
640000 -- (-356.346) [-357.203] (-356.226) (-356.860) * (-355.420) (-356.603) [-356.149] (-361.765) -- 0:00:21
Average standard deviation of split frequencies: 0.010128
640500 -- (-357.808) [-357.057] (-357.055) (-356.232) * [-356.251] (-359.260) (-359.190) (-359.592) -- 0:00:21
641000 -- (-358.591) [-355.141] (-357.178) (-357.110) * (-356.020) [-359.641] (-356.901) (-359.800) -- 0:00:21
641500 -- (-361.342) (-356.429) (-357.728) [-355.770] * (-360.959) (-356.233) (-356.025) [-355.335] -- 0:00:21
642000 -- [-358.200] (-361.396) (-360.650) (-355.920) * [-360.477] (-359.888) (-355.673) (-359.323) -- 0:00:21
642500 -- [-358.274] (-358.612) (-360.540) (-358.854) * (-357.179) (-355.212) [-357.686] (-358.200) -- 0:00:21
643000 -- (-357.501) (-359.232) [-359.595] (-358.652) * [-357.690] (-356.389) (-362.345) (-355.657) -- 0:00:21
643500 -- [-356.882] (-359.100) (-357.577) (-359.171) * [-357.501] (-357.780) (-359.358) (-356.407) -- 0:00:21
644000 -- (-356.468) (-359.187) [-355.874] (-358.175) * [-355.369] (-357.102) (-358.128) (-356.234) -- 0:00:21
644500 -- (-357.458) (-356.895) [-355.436] (-355.719) * (-356.817) [-358.218] (-360.063) (-356.268) -- 0:00:21
645000 -- [-356.303] (-362.316) (-358.674) (-356.370) * (-357.446) (-363.598) (-360.055) [-355.339] -- 0:00:21
Average standard deviation of split frequencies: 0.010431
645500 -- (-363.805) (-355.778) [-355.733] (-357.304) * (-355.516) [-355.329] (-356.760) (-358.325) -- 0:00:21
646000 -- [-357.014] (-358.520) (-358.647) (-358.194) * (-356.542) (-356.470) (-359.426) [-359.307] -- 0:00:21
646500 -- [-355.471] (-359.379) (-362.395) (-357.459) * [-356.070] (-357.703) (-357.748) (-359.876) -- 0:00:21
647000 -- (-356.691) (-357.494) (-357.072) [-359.093] * (-355.461) [-356.736] (-358.038) (-359.878) -- 0:00:21
647500 -- [-356.592] (-359.273) (-356.482) (-355.763) * (-357.358) (-356.740) [-358.409] (-356.857) -- 0:00:21
648000 -- (-356.856) (-360.495) [-355.166] (-359.129) * (-356.487) (-357.421) (-356.436) [-358.079] -- 0:00:21
648500 -- (-356.555) [-355.348] (-361.522) (-357.482) * (-358.106) (-358.679) (-356.430) [-359.516] -- 0:00:21
649000 -- (-355.484) (-356.537) (-357.713) [-359.323] * (-360.629) [-355.873] (-362.059) (-357.870) -- 0:00:21
649500 -- (-356.810) (-357.032) [-360.166] (-359.384) * (-359.124) [-358.934] (-358.413) (-355.848) -- 0:00:21
650000 -- (-358.282) (-355.817) [-356.357] (-359.931) * (-357.564) (-362.216) [-359.750] (-356.863) -- 0:00:21
Average standard deviation of split frequencies: 0.010526
650500 -- (-356.111) (-357.752) (-358.422) [-359.674] * (-359.078) [-360.088] (-360.304) (-356.499) -- 0:00:20
651000 -- (-361.857) [-356.891] (-356.561) (-358.452) * [-356.342] (-359.325) (-357.200) (-355.961) -- 0:00:20
651500 -- (-358.067) [-356.424] (-359.085) (-358.306) * (-358.173) (-357.819) (-356.956) [-356.677] -- 0:00:20
652000 -- [-357.353] (-359.104) (-356.773) (-356.405) * (-358.297) (-360.211) (-358.718) [-356.907] -- 0:00:20
652500 -- (-356.867) (-355.951) [-357.326] (-357.786) * (-360.062) (-356.452) (-356.070) [-355.908] -- 0:00:20
653000 -- (-357.955) (-356.008) (-357.965) [-357.053] * (-357.029) (-357.635) [-356.969] (-357.351) -- 0:00:20
653500 -- (-359.985) [-356.638] (-356.392) (-356.458) * [-357.544] (-356.926) (-356.170) (-357.049) -- 0:00:20
654000 -- (-357.875) (-359.000) (-355.513) [-358.673] * (-357.257) [-355.807] (-357.365) (-357.282) -- 0:00:20
654500 -- (-360.302) (-355.351) (-356.586) [-362.114] * (-358.271) [-357.587] (-356.500) (-358.450) -- 0:00:20
655000 -- (-357.112) [-357.721] (-355.989) (-361.590) * (-357.455) (-357.593) (-363.902) [-359.233] -- 0:00:20
Average standard deviation of split frequencies: 0.010441
655500 -- (-355.980) (-359.206) [-355.057] (-358.163) * (-355.993) (-359.426) (-356.457) [-358.863] -- 0:00:20
656000 -- (-355.360) [-355.610] (-356.278) (-355.242) * (-357.963) (-356.245) (-358.423) [-359.859] -- 0:00:20
656500 -- (-355.842) (-360.069) (-356.394) [-355.490] * [-356.840] (-357.701) (-356.871) (-356.296) -- 0:00:20
657000 -- (-357.541) [-356.449] (-358.093) (-358.033) * (-356.213) (-357.971) (-359.210) [-358.662] -- 0:00:20
657500 -- [-359.302] (-357.220) (-357.929) (-360.539) * [-355.696] (-356.972) (-361.131) (-355.656) -- 0:00:20
658000 -- [-356.042] (-356.463) (-358.157) (-358.522) * [-355.417] (-356.817) (-357.580) (-360.136) -- 0:00:20
658500 -- [-356.872] (-357.412) (-356.751) (-359.701) * (-356.001) (-361.094) (-361.398) [-356.397] -- 0:00:20
659000 -- (-359.018) (-359.719) [-357.967] (-368.170) * (-358.211) [-358.783] (-359.992) (-358.718) -- 0:00:20
659500 -- (-357.987) (-357.423) [-357.066] (-358.766) * (-355.182) [-357.547] (-356.022) (-358.321) -- 0:00:20
660000 -- (-355.194) (-356.066) (-356.672) [-358.465] * [-358.469] (-359.816) (-356.155) (-357.668) -- 0:00:20
Average standard deviation of split frequencies: 0.010283
660500 -- (-360.556) (-358.331) [-356.226] (-356.225) * (-356.513) (-358.177) (-355.527) [-356.655] -- 0:00:20
661000 -- (-356.985) (-359.048) (-356.295) [-357.319] * [-356.634] (-357.890) (-355.504) (-357.001) -- 0:00:20
661500 -- [-356.658] (-356.569) (-355.500) (-356.569) * (-356.354) (-357.869) [-356.010] (-356.489) -- 0:00:20
662000 -- (-355.900) [-357.575] (-355.896) (-357.242) * (-357.380) [-364.221] (-357.424) (-356.790) -- 0:00:20
662500 -- (-360.186) (-357.633) (-357.392) [-356.371] * (-357.800) [-357.122] (-359.591) (-357.723) -- 0:00:20
663000 -- [-357.874] (-355.151) (-357.869) (-355.974) * (-357.647) [-356.090] (-358.749) (-357.562) -- 0:00:20
663500 -- (-359.715) (-355.806) [-357.598] (-357.012) * (-357.684) (-355.138) [-355.428] (-357.016) -- 0:00:20
664000 -- [-366.213] (-358.394) (-356.904) (-357.896) * (-361.718) (-358.315) (-356.783) [-359.772] -- 0:00:20
664500 -- (-361.569) (-359.201) (-356.770) [-356.284] * (-360.438) (-355.461) (-356.545) [-358.337] -- 0:00:20
665000 -- (-357.597) (-356.154) (-363.917) [-355.833] * (-357.481) (-359.383) (-356.897) [-358.908] -- 0:00:20
Average standard deviation of split frequencies: 0.010242
665500 -- (-356.149) [-356.613] (-359.536) (-356.531) * (-356.254) (-356.426) (-356.149) [-359.372] -- 0:00:20
666000 -- (-356.874) (-356.688) (-359.916) [-356.199] * (-356.225) (-357.526) (-355.922) [-355.630] -- 0:00:20
666500 -- [-356.140] (-356.539) (-356.680) (-358.937) * (-360.601) (-356.658) [-358.257] (-356.926) -- 0:00:20
667000 -- (-355.525) (-357.299) (-356.457) [-358.333] * (-357.026) (-359.863) (-355.817) [-356.721] -- 0:00:19
667500 -- (-355.760) (-356.982) [-362.450] (-360.095) * (-356.702) (-358.284) (-362.566) [-356.330] -- 0:00:19
668000 -- [-357.164] (-357.427) (-356.551) (-360.398) * (-358.974) (-356.210) [-356.985] (-358.188) -- 0:00:19
668500 -- (-355.238) [-357.889] (-355.648) (-362.053) * (-358.403) [-356.912] (-356.730) (-359.483) -- 0:00:19
669000 -- (-362.348) (-358.925) (-359.630) [-356.038] * (-357.666) [-355.999] (-356.154) (-355.828) -- 0:00:19
669500 -- (-357.940) (-357.392) (-356.346) [-357.492] * (-358.517) [-355.849] (-360.079) (-357.381) -- 0:00:19
670000 -- (-356.120) (-356.572) [-356.014] (-359.669) * (-361.699) [-357.324] (-358.526) (-358.564) -- 0:00:19
Average standard deviation of split frequencies: 0.010089
670500 -- (-360.148) [-356.021] (-356.260) (-357.414) * (-362.209) [-357.783] (-359.657) (-355.929) -- 0:00:19
671000 -- (-358.253) (-357.432) (-358.060) [-357.288] * (-357.214) (-359.653) (-357.446) [-356.569] -- 0:00:19
671500 -- (-359.284) [-355.914] (-360.675) (-360.009) * (-355.566) [-363.204] (-357.377) (-357.719) -- 0:00:19
672000 -- (-356.460) (-361.540) (-358.370) [-355.833] * (-356.395) (-357.872) [-356.243] (-355.960) -- 0:00:19
672500 -- [-356.337] (-356.649) (-356.505) (-356.131) * (-358.479) [-362.456] (-360.979) (-355.583) -- 0:00:19
673000 -- (-357.466) (-357.311) [-358.429] (-356.207) * (-356.102) [-359.367] (-357.110) (-358.094) -- 0:00:19
673500 -- (-357.782) (-356.070) (-357.149) [-355.882] * (-358.670) (-359.567) (-355.263) [-355.959] -- 0:00:19
674000 -- (-358.018) (-356.612) (-357.439) [-356.166] * (-359.668) (-358.772) [-356.187] (-359.034) -- 0:00:19
674500 -- (-355.611) [-357.562] (-356.286) (-359.879) * (-356.388) (-357.972) [-356.499] (-358.285) -- 0:00:19
675000 -- [-358.623] (-356.562) (-361.445) (-360.212) * (-356.203) (-356.042) (-359.872) [-356.506] -- 0:00:19
Average standard deviation of split frequencies: 0.010050
675500 -- [-358.294] (-357.844) (-357.608) (-356.311) * (-357.053) (-357.360) (-355.609) [-357.160] -- 0:00:19
676000 -- [-359.080] (-355.957) (-358.143) (-359.495) * (-356.659) (-358.950) [-355.126] (-357.678) -- 0:00:19
676500 -- (-356.183) (-356.431) [-356.073] (-360.214) * (-355.780) (-358.233) (-357.510) [-356.711] -- 0:00:19
677000 -- [-358.369] (-355.757) (-356.957) (-363.559) * [-356.989] (-357.154) (-357.971) (-360.225) -- 0:00:19
677500 -- (-356.420) [-357.348] (-356.126) (-358.167) * (-356.424) (-357.990) [-356.354] (-359.043) -- 0:00:19
678000 -- [-357.782] (-361.712) (-359.829) (-361.697) * (-356.382) [-359.452] (-358.611) (-356.087) -- 0:00:19
678500 -- (-358.506) [-368.196] (-355.796) (-357.481) * [-356.925] (-359.126) (-358.737) (-355.693) -- 0:00:19
679000 -- (-359.304) (-361.127) [-355.853] (-358.744) * [-355.786] (-358.540) (-358.457) (-355.379) -- 0:00:19
679500 -- (-356.484) [-355.858] (-357.659) (-358.788) * (-355.674) (-355.435) (-356.019) [-355.761] -- 0:00:19
680000 -- (-356.967) (-356.119) (-356.515) [-357.974] * (-358.692) (-355.363) [-356.360] (-355.848) -- 0:00:19
Average standard deviation of split frequencies: 0.009981
680500 -- (-356.277) (-355.222) [-356.146] (-357.198) * (-356.694) (-356.034) [-357.041] (-355.741) -- 0:00:19
681000 -- (-360.190) (-356.130) (-356.742) [-358.130] * (-357.739) (-355.698) (-359.578) [-358.669] -- 0:00:19
681500 -- (-356.051) (-356.508) [-355.275] (-355.152) * (-355.513) (-357.498) [-356.545] (-359.627) -- 0:00:19
682000 -- (-358.496) [-356.504] (-355.299) (-356.697) * (-357.144) (-358.207) [-356.408] (-357.117) -- 0:00:19
682500 -- (-357.974) (-357.151) [-356.337] (-358.087) * (-361.719) [-357.101] (-356.716) (-359.134) -- 0:00:19
683000 -- (-360.507) [-355.980] (-355.081) (-356.723) * [-360.694] (-356.782) (-358.353) (-359.468) -- 0:00:19
683500 -- (-357.369) (-356.916) (-354.998) [-357.155] * [-358.743] (-357.845) (-361.721) (-356.146) -- 0:00:18
684000 -- [-358.891] (-362.030) (-355.191) (-357.317) * [-356.043] (-355.599) (-363.145) (-357.825) -- 0:00:18
684500 -- (-357.976) (-365.630) [-355.127] (-357.868) * (-356.601) (-356.903) [-356.262] (-356.295) -- 0:00:18
685000 -- (-358.600) (-359.080) [-356.613] (-356.158) * [-357.714] (-357.060) (-357.612) (-358.737) -- 0:00:18
Average standard deviation of split frequencies: 0.009661
685500 -- (-359.421) (-358.494) (-356.218) [-355.814] * (-356.171) [-355.250] (-356.657) (-362.140) -- 0:00:18
686000 -- [-358.698] (-359.489) (-356.473) (-357.269) * (-355.619) (-357.377) [-356.497] (-357.125) -- 0:00:18
686500 -- [-358.817] (-357.513) (-356.340) (-358.035) * (-357.630) (-356.680) [-355.454] (-357.344) -- 0:00:18
687000 -- (-358.631) (-356.140) (-357.360) [-357.370] * [-355.522] (-361.698) (-354.967) (-358.208) -- 0:00:18
687500 -- (-357.311) (-356.142) (-356.534) [-361.425] * (-355.176) (-364.686) [-357.245] (-356.714) -- 0:00:18
688000 -- (-356.814) (-359.544) (-356.197) [-355.865] * (-355.682) [-359.107] (-357.270) (-356.985) -- 0:00:18
688500 -- [-356.711] (-356.036) (-356.452) (-356.347) * (-356.807) [-357.635] (-359.029) (-356.286) -- 0:00:18
689000 -- (-357.134) (-357.334) (-356.685) [-355.998] * (-359.441) (-361.887) (-355.412) [-357.388] -- 0:00:18
689500 -- (-356.466) (-357.478) (-355.965) [-355.975] * (-359.027) [-355.740] (-357.383) (-360.390) -- 0:00:18
690000 -- (-357.861) (-358.691) [-356.851] (-356.175) * (-362.978) (-357.330) (-356.423) [-357.061] -- 0:00:18
Average standard deviation of split frequencies: 0.009756
690500 -- [-357.321] (-360.321) (-358.578) (-357.491) * (-357.594) (-355.989) [-357.813] (-358.474) -- 0:00:18
691000 -- (-357.046) [-357.256] (-358.966) (-357.641) * (-359.818) (-356.750) (-357.662) [-358.222] -- 0:00:18
691500 -- (-359.093) [-356.330] (-363.151) (-357.478) * (-359.055) [-355.659] (-355.836) (-358.119) -- 0:00:18
692000 -- (-358.495) [-357.161] (-361.266) (-357.495) * (-357.339) (-361.420) [-357.026] (-355.789) -- 0:00:18
692500 -- (-357.785) (-356.786) (-355.100) [-357.407] * [-358.973] (-360.865) (-362.730) (-356.119) -- 0:00:18
693000 -- (-356.568) (-359.934) [-358.544] (-358.205) * (-359.788) [-356.432] (-356.650) (-356.364) -- 0:00:18
693500 -- (-357.221) (-361.384) [-357.347] (-355.446) * (-358.152) (-356.589) [-356.621] (-358.121) -- 0:00:18
694000 -- (-357.763) (-361.676) [-356.150] (-357.407) * (-359.011) [-360.274] (-363.416) (-355.726) -- 0:00:18
694500 -- [-360.171] (-364.871) (-358.096) (-357.949) * (-357.647) [-358.207] (-359.067) (-356.387) -- 0:00:18
695000 -- (-356.040) (-356.146) (-360.409) [-358.038] * (-359.941) (-356.139) (-358.062) [-355.300] -- 0:00:18
Average standard deviation of split frequencies: 0.010000
695500 -- (-357.590) (-359.054) [-361.641] (-361.857) * (-359.066) [-358.471] (-358.853) (-357.519) -- 0:00:18
696000 -- (-358.257) (-361.609) [-357.036] (-361.536) * (-359.097) (-358.235) (-358.010) [-358.707] -- 0:00:18
696500 -- (-357.933) (-363.697) (-359.437) [-358.887] * (-358.896) [-358.780] (-356.629) (-355.225) -- 0:00:18
697000 -- (-357.628) [-356.964] (-359.307) (-356.775) * [-356.851] (-368.880) (-355.763) (-357.141) -- 0:00:18
697500 -- (-356.186) (-355.958) (-357.943) [-356.196] * [-356.339] (-356.877) (-356.111) (-358.195) -- 0:00:18
698000 -- [-357.439] (-358.278) (-355.652) (-357.551) * [-357.504] (-360.520) (-362.343) (-357.329) -- 0:00:18
698500 -- (-358.378) [-355.734] (-355.801) (-357.406) * [-359.598] (-356.991) (-356.072) (-358.779) -- 0:00:18
699000 -- (-355.570) (-356.155) (-356.605) [-356.689] * (-360.445) [-361.676] (-355.802) (-358.677) -- 0:00:18
699500 -- (-357.180) [-356.437] (-356.173) (-356.787) * (-360.718) [-356.944] (-358.153) (-359.630) -- 0:00:18
700000 -- (-356.344) (-356.586) (-356.656) [-356.854] * (-356.978) (-360.658) (-357.159) [-359.506] -- 0:00:18
Average standard deviation of split frequencies: 0.008999
700500 -- (-357.634) [-358.605] (-357.121) (-357.915) * (-356.689) [-355.652] (-357.967) (-356.422) -- 0:00:17
701000 -- (-359.831) (-360.711) [-357.427] (-357.044) * [-360.013] (-357.696) (-359.306) (-360.787) -- 0:00:17
701500 -- (-362.302) (-358.669) (-358.400) [-357.201] * (-357.099) (-357.097) [-357.928] (-355.615) -- 0:00:17
702000 -- (-355.285) [-356.253] (-357.249) (-358.574) * (-362.446) (-358.850) (-357.635) [-356.710] -- 0:00:17
702500 -- (-356.877) [-357.003] (-357.132) (-357.837) * (-360.575) [-358.774] (-358.702) (-356.542) -- 0:00:17
703000 -- (-359.310) (-356.089) (-358.858) [-357.145] * [-357.396] (-356.004) (-358.985) (-357.606) -- 0:00:17
703500 -- [-356.406] (-360.658) (-355.903) (-359.866) * (-358.773) (-355.811) (-356.521) [-357.064] -- 0:00:17
704000 -- (-357.319) (-358.238) (-359.747) [-357.120] * (-359.696) (-355.937) [-360.022] (-358.802) -- 0:00:17
704500 -- (-356.358) (-356.024) (-361.411) [-358.805] * (-356.890) [-356.168] (-363.083) (-358.253) -- 0:00:17
705000 -- (-360.789) (-361.147) (-356.112) [-355.462] * (-356.978) [-357.254] (-358.906) (-356.325) -- 0:00:17
Average standard deviation of split frequencies: 0.009701
705500 -- (-359.718) (-358.280) [-360.064] (-355.747) * (-360.648) (-356.580) [-356.660] (-357.074) -- 0:00:17
706000 -- (-358.576) [-357.762] (-357.282) (-357.376) * (-359.666) (-358.013) [-358.844] (-355.977) -- 0:00:17
706500 -- (-355.412) (-356.030) [-355.627] (-358.206) * (-360.826) [-358.348] (-358.799) (-358.457) -- 0:00:17
707000 -- (-358.043) (-355.180) (-361.004) [-356.979] * [-356.977] (-358.694) (-356.681) (-359.823) -- 0:00:17
707500 -- (-361.475) (-355.134) [-356.848] (-356.531) * (-357.627) [-358.636] (-356.362) (-358.736) -- 0:00:17
708000 -- (-358.975) (-356.578) [-356.526] (-356.817) * (-357.731) (-357.857) [-356.462] (-357.729) -- 0:00:17
708500 -- (-356.062) [-360.505] (-356.934) (-357.414) * [-357.948] (-357.895) (-357.612) (-355.241) -- 0:00:17
709000 -- (-359.793) (-356.005) (-357.248) [-356.692] * [-360.494] (-360.606) (-356.389) (-357.615) -- 0:00:17
709500 -- (-355.719) (-355.255) (-356.178) [-358.092] * (-356.194) [-355.706] (-357.134) (-358.380) -- 0:00:17
710000 -- (-357.600) (-355.336) (-356.253) [-357.580] * (-356.814) (-358.186) (-356.055) [-357.254] -- 0:00:17
Average standard deviation of split frequencies: 0.009204
710500 -- (-361.937) [-357.050] (-356.433) (-356.473) * (-356.001) [-357.830] (-355.204) (-358.764) -- 0:00:17
711000 -- (-357.360) (-356.585) (-356.534) [-355.828] * (-360.491) [-356.544] (-356.036) (-356.110) -- 0:00:17
711500 -- (-357.185) [-355.902] (-356.292) (-358.942) * (-357.230) (-356.904) (-358.566) [-355.897] -- 0:00:17
712000 -- (-356.635) (-355.426) [-359.074] (-361.500) * [-357.185] (-358.439) (-359.173) (-358.900) -- 0:00:17
712500 -- (-356.006) (-358.760) (-356.370) [-360.783] * (-357.732) (-356.743) [-357.402] (-360.539) -- 0:00:17
713000 -- [-357.094] (-356.984) (-357.337) (-359.371) * (-357.824) (-360.091) (-359.633) [-357.826] -- 0:00:17
713500 -- [-355.968] (-356.441) (-355.444) (-358.285) * (-355.457) (-361.938) (-358.078) [-356.867] -- 0:00:17
714000 -- (-356.904) (-356.573) [-355.874] (-356.512) * (-357.584) (-358.069) (-358.095) [-358.005] -- 0:00:17
714500 -- [-357.142] (-356.480) (-357.123) (-360.196) * (-356.260) (-360.270) (-357.210) [-358.328] -- 0:00:17
715000 -- (-358.204) (-355.898) (-356.218) [-358.166] * (-355.643) (-357.558) (-357.033) [-358.026] -- 0:00:17
Average standard deviation of split frequencies: 0.009217
715500 -- (-358.711) (-361.109) [-355.328] (-358.971) * [-356.165] (-357.195) (-356.514) (-357.635) -- 0:00:17
716000 -- [-355.859] (-356.570) (-355.297) (-359.805) * (-358.830) (-360.961) (-358.011) [-356.049] -- 0:00:17
716500 -- [-359.014] (-362.179) (-356.250) (-357.967) * (-359.084) [-359.306] (-359.725) (-358.286) -- 0:00:17
717000 -- (-355.171) (-358.118) (-356.396) [-359.404] * (-356.975) (-359.393) (-357.488) [-356.963] -- 0:00:16
717500 -- (-358.222) (-357.291) (-359.602) [-356.226] * (-355.290) (-363.163) (-359.033) [-355.280] -- 0:00:16
718000 -- (-357.289) [-355.621] (-357.028) (-355.504) * (-356.783) [-364.130] (-356.621) (-358.873) -- 0:00:16
718500 -- (-361.717) (-355.325) [-361.048] (-359.146) * [-359.697] (-357.691) (-356.797) (-358.551) -- 0:00:16
719000 -- [-357.164] (-356.183) (-359.768) (-357.495) * (-359.086) (-361.260) [-360.032] (-359.126) -- 0:00:16
719500 -- (-357.198) (-363.724) (-357.478) [-359.028] * (-360.882) (-358.078) (-357.379) [-358.216] -- 0:00:16
720000 -- (-356.253) [-363.020] (-362.824) (-356.964) * [-356.744] (-358.062) (-358.998) (-355.187) -- 0:00:16
Average standard deviation of split frequencies: 0.008872
720500 -- (-358.539) (-358.705) (-360.871) [-357.758] * (-359.824) [-357.242] (-357.127) (-356.626) -- 0:00:16
721000 -- (-365.234) (-358.791) [-359.351] (-356.549) * (-358.787) (-355.428) (-355.817) [-358.588] -- 0:00:16
721500 -- [-357.811] (-355.487) (-355.733) (-355.942) * (-357.941) [-356.246] (-355.268) (-356.306) -- 0:00:16
722000 -- (-357.899) [-357.575] (-356.877) (-361.310) * [-358.092] (-355.385) (-358.156) (-357.744) -- 0:00:16
722500 -- (-356.028) (-356.193) (-359.974) [-357.611] * (-356.861) [-356.956] (-362.532) (-358.698) -- 0:00:16
723000 -- [-357.833] (-355.270) (-356.766) (-360.035) * (-355.462) (-359.112) (-359.145) [-359.334] -- 0:00:16
723500 -- (-358.212) [-355.378] (-358.341) (-358.589) * (-358.720) (-356.183) [-359.506] (-355.472) -- 0:00:16
724000 -- (-358.506) (-357.488) [-359.575] (-356.172) * (-355.234) (-356.802) [-357.784] (-355.798) -- 0:00:16
724500 -- (-356.175) (-360.197) [-358.267] (-355.485) * (-358.108) (-356.096) (-359.382) [-355.873] -- 0:00:16
725000 -- (-356.029) (-363.648) [-359.807] (-364.677) * (-364.680) [-355.879] (-358.398) (-356.893) -- 0:00:16
Average standard deviation of split frequencies: 0.008238
725500 -- (-358.148) [-363.089] (-355.172) (-358.555) * [-356.417] (-355.875) (-358.226) (-357.030) -- 0:00:16
726000 -- [-355.043] (-361.796) (-357.701) (-363.911) * (-355.171) [-358.047] (-355.175) (-357.630) -- 0:00:16
726500 -- (-359.586) (-356.928) [-356.783] (-366.644) * (-354.955) [-355.390] (-362.733) (-358.307) -- 0:00:16
727000 -- [-355.784] (-362.048) (-356.673) (-357.506) * [-355.161] (-355.531) (-359.351) (-359.953) -- 0:00:16
727500 -- (-356.385) [-358.000] (-356.935) (-357.523) * (-356.565) (-358.522) (-358.969) [-358.861] -- 0:00:16
728000 -- (-355.984) (-357.448) (-356.304) [-356.458] * (-357.113) [-356.456] (-358.523) (-358.176) -- 0:00:16
728500 -- (-357.929) [-356.390] (-355.344) (-356.609) * (-355.683) [-358.615] (-359.201) (-358.092) -- 0:00:16
729000 -- (-357.609) (-358.704) (-355.404) [-355.989] * (-357.884) [-358.681] (-356.736) (-355.346) -- 0:00:16
729500 -- [-356.394] (-359.669) (-355.516) (-359.839) * [-357.324] (-357.902) (-356.296) (-357.178) -- 0:00:16
730000 -- (-361.009) (-360.410) (-356.457) [-359.285] * [-356.563] (-357.723) (-357.902) (-355.935) -- 0:00:16
Average standard deviation of split frequencies: 0.007984
730500 -- (-357.756) (-357.262) (-358.392) [-357.120] * (-356.255) (-357.439) (-357.181) [-355.461] -- 0:00:16
731000 -- [-357.554] (-355.252) (-356.473) (-355.507) * (-361.146) (-355.733) [-355.912] (-358.682) -- 0:00:16
731500 -- (-358.562) [-359.012] (-360.455) (-355.351) * (-358.404) [-355.926] (-356.521) (-356.478) -- 0:00:16
732000 -- [-359.708] (-355.865) (-358.229) (-356.731) * (-356.844) (-355.880) [-356.513] (-356.475) -- 0:00:16
732500 -- (-358.346) (-358.480) (-361.785) [-355.662] * (-357.029) (-357.071) (-356.878) [-357.086] -- 0:00:16
733000 -- (-358.470) (-358.647) (-355.629) [-355.437] * (-357.752) (-356.663) [-358.335] (-361.660) -- 0:00:16
733500 -- (-357.062) (-359.188) [-357.062] (-355.764) * [-358.247] (-356.435) (-363.018) (-356.422) -- 0:00:15
734000 -- (-355.436) [-356.143] (-355.859) (-355.676) * (-359.531) [-357.395] (-359.106) (-361.438) -- 0:00:15
734500 -- [-356.526] (-357.709) (-356.030) (-355.585) * (-358.313) (-362.262) [-357.668] (-356.345) -- 0:00:15
735000 -- (-362.130) (-356.520) [-356.320] (-356.466) * (-356.672) (-357.664) [-357.990] (-356.288) -- 0:00:15
Average standard deviation of split frequencies: 0.008366
735500 -- (-357.123) (-357.728) (-355.899) [-358.108] * (-363.587) (-361.482) (-358.429) [-357.834] -- 0:00:15
736000 -- (-356.806) (-355.123) [-355.590] (-358.664) * [-356.012] (-359.036) (-356.617) (-357.817) -- 0:00:15
736500 -- (-356.282) [-355.075] (-360.930) (-357.068) * (-356.867) (-359.412) (-356.117) [-355.220] -- 0:00:15
737000 -- (-356.475) (-356.518) [-360.809] (-356.438) * (-356.467) (-355.347) (-355.701) [-361.046] -- 0:00:15
737500 -- (-357.534) [-357.727] (-361.320) (-355.759) * (-358.059) (-357.278) (-357.067) [-359.068] -- 0:00:15
738000 -- [-358.998] (-357.990) (-359.103) (-355.890) * (-358.258) [-355.352] (-357.163) (-356.352) -- 0:00:15
738500 -- (-358.125) (-357.692) [-360.265] (-357.462) * (-359.620) [-355.215] (-356.629) (-355.437) -- 0:00:15
739000 -- (-355.652) (-360.438) (-355.958) [-356.008] * (-355.988) [-356.707] (-359.117) (-357.766) -- 0:00:15
739500 -- (-359.982) (-357.400) (-366.351) [-357.651] * [-356.164] (-358.285) (-358.062) (-359.872) -- 0:00:15
740000 -- [-356.124] (-357.568) (-357.831) (-363.623) * (-357.615) [-359.144] (-356.030) (-360.078) -- 0:00:15
Average standard deviation of split frequencies: 0.008791
740500 -- (-355.491) (-362.246) [-359.405] (-357.685) * (-356.382) (-356.539) [-356.740] (-362.520) -- 0:00:15
741000 -- (-355.553) [-356.900] (-359.074) (-355.382) * (-356.185) (-363.636) (-356.636) [-360.178] -- 0:00:15
741500 -- (-357.226) (-357.455) [-358.136] (-358.999) * (-357.425) (-356.473) [-356.368] (-355.907) -- 0:00:15
742000 -- [-357.261] (-358.740) (-360.579) (-357.478) * (-362.387) (-358.561) (-360.966) [-356.976] -- 0:00:15
742500 -- (-356.598) (-356.454) (-360.658) [-355.825] * (-357.025) [-356.094] (-356.428) (-358.815) -- 0:00:15
743000 -- (-358.329) (-357.918) [-357.649] (-357.180) * (-356.226) (-357.725) (-356.549) [-356.565] -- 0:00:15
743500 -- [-360.285] (-355.669) (-357.715) (-356.936) * (-354.965) [-358.711] (-358.912) (-355.671) -- 0:00:15
744000 -- (-356.862) [-357.039] (-359.113) (-357.619) * (-355.238) (-357.539) [-356.709] (-357.991) -- 0:00:15
744500 -- (-359.483) (-355.790) [-357.346] (-359.925) * (-355.238) [-358.374] (-358.953) (-358.559) -- 0:00:15
745000 -- (-360.196) (-355.509) [-355.537] (-360.893) * (-360.887) (-360.164) (-355.390) [-358.409] -- 0:00:15
Average standard deviation of split frequencies: 0.008926
745500 -- [-355.325] (-356.116) (-357.765) (-359.976) * (-357.039) [-357.590] (-356.214) (-359.319) -- 0:00:15
746000 -- (-357.173) [-356.129] (-358.586) (-356.515) * (-363.700) (-363.892) [-356.245] (-355.391) -- 0:00:15
746500 -- (-358.554) (-355.757) [-355.034] (-359.969) * (-358.493) (-357.773) [-356.230] (-357.329) -- 0:00:15
747000 -- (-357.125) (-360.736) (-356.925) [-355.582] * (-359.322) (-358.629) (-358.516) [-359.037] -- 0:00:15
747500 -- (-357.648) [-357.430] (-357.643) (-359.000) * (-359.787) (-358.811) [-356.638] (-355.736) -- 0:00:15
748000 -- (-358.415) (-356.605) (-355.333) [-360.631] * (-358.020) (-359.179) [-357.931] (-357.160) -- 0:00:15
748500 -- [-359.032] (-358.047) (-359.205) (-363.059) * (-358.723) [-358.028] (-366.356) (-359.266) -- 0:00:15
749000 -- (-360.209) (-358.517) [-357.304] (-362.580) * (-359.628) (-357.652) [-359.021] (-356.856) -- 0:00:15
749500 -- [-355.184] (-357.424) (-360.044) (-361.743) * (-363.552) [-356.802] (-360.346) (-357.261) -- 0:00:15
750000 -- (-355.331) (-356.084) (-356.781) [-356.542] * (-357.438) (-360.289) [-358.516] (-356.541) -- 0:00:15
Average standard deviation of split frequencies: 0.008282
750500 -- (-355.597) (-357.305) [-356.077] (-356.000) * [-357.623] (-357.307) (-356.449) (-361.134) -- 0:00:14
751000 -- (-355.306) (-356.238) [-357.808] (-358.760) * (-359.741) (-360.781) [-356.443] (-362.887) -- 0:00:14
751500 -- (-356.877) (-355.348) (-356.992) [-358.223] * [-356.482] (-357.478) (-356.441) (-357.314) -- 0:00:14
752000 -- (-357.158) (-356.369) [-358.190] (-357.772) * [-358.848] (-356.840) (-356.357) (-356.140) -- 0:00:14
752500 -- [-355.380] (-358.122) (-360.392) (-357.633) * (-362.464) (-356.464) [-358.841] (-360.133) -- 0:00:14
753000 -- [-355.616] (-355.958) (-362.580) (-357.187) * (-361.275) (-358.570) (-360.831) [-355.119] -- 0:00:14
753500 -- [-355.522] (-359.792) (-358.012) (-361.655) * [-362.153] (-356.077) (-356.892) (-357.068) -- 0:00:14
754000 -- (-362.257) (-355.317) [-357.644] (-360.319) * (-357.533) (-359.002) [-356.445] (-359.044) -- 0:00:14
754500 -- (-358.819) [-355.730] (-356.649) (-361.086) * (-356.494) [-357.281] (-357.659) (-356.397) -- 0:00:14
755000 -- (-361.716) [-357.549] (-358.207) (-357.412) * [-355.399] (-357.585) (-357.249) (-358.805) -- 0:00:14
Average standard deviation of split frequencies: 0.008379
755500 -- (-358.686) (-359.300) (-359.559) [-359.168] * (-355.994) [-355.826] (-355.414) (-357.336) -- 0:00:14
756000 -- (-357.416) [-359.546] (-356.616) (-357.528) * (-355.942) (-355.828) [-358.501] (-359.283) -- 0:00:14
756500 -- (-357.013) (-359.101) (-357.018) [-356.669] * (-355.725) [-355.101] (-360.344) (-363.318) -- 0:00:14
757000 -- (-356.541) (-358.317) (-359.313) [-356.467] * (-364.000) (-355.855) [-356.700] (-360.505) -- 0:00:14
757500 -- (-357.226) (-357.131) [-358.774] (-357.129) * (-357.604) (-355.237) [-356.898] (-361.698) -- 0:00:14
758000 -- (-363.896) (-361.346) [-357.732] (-355.813) * (-360.469) (-356.805) (-357.656) [-357.603] -- 0:00:14
758500 -- (-357.979) (-356.150) [-357.621] (-356.400) * (-357.839) [-355.393] (-355.692) (-359.632) -- 0:00:14
759000 -- (-357.901) (-356.874) [-357.372] (-356.958) * (-357.325) (-356.979) [-355.577] (-357.599) -- 0:00:14
759500 -- (-357.079) [-358.595] (-356.252) (-360.594) * (-360.148) (-356.731) [-358.642] (-357.015) -- 0:00:14
760000 -- (-359.093) (-357.012) [-355.689] (-355.557) * [-356.877] (-358.052) (-357.018) (-357.566) -- 0:00:14
Average standard deviation of split frequencies: 0.008444
760500 -- [-358.283] (-355.477) (-356.060) (-358.310) * (-355.583) (-357.763) [-358.771] (-358.927) -- 0:00:14
761000 -- [-356.319] (-355.152) (-356.044) (-356.753) * (-362.559) (-356.757) (-358.019) [-356.723] -- 0:00:14
761500 -- (-356.248) (-355.593) (-356.244) [-361.168] * (-357.504) (-355.480) (-358.619) [-359.679] -- 0:00:14
762000 -- (-360.417) (-360.069) (-355.941) [-356.908] * (-356.940) [-355.299] (-361.834) (-358.885) -- 0:00:14
762500 -- (-361.497) [-357.394] (-356.764) (-356.356) * (-357.591) [-356.391] (-357.204) (-357.137) -- 0:00:14
763000 -- (-358.178) [-359.013] (-356.699) (-364.327) * (-357.793) (-358.936) (-358.782) [-359.559] -- 0:00:14
763500 -- [-356.977] (-357.733) (-360.640) (-358.472) * [-355.400] (-360.739) (-355.649) (-357.484) -- 0:00:14
764000 -- (-355.016) (-357.974) (-361.576) [-356.886] * (-356.393) (-357.731) (-358.103) [-359.622] -- 0:00:14
764500 -- (-360.131) (-358.584) (-357.979) [-359.531] * [-356.021] (-357.189) (-362.608) (-358.883) -- 0:00:14
765000 -- (-358.050) [-358.641] (-355.347) (-356.956) * (-362.992) [-355.667] (-355.797) (-359.144) -- 0:00:14
Average standard deviation of split frequencies: 0.008308
765500 -- (-360.470) (-362.387) [-355.539] (-357.418) * (-359.046) (-355.801) (-355.398) [-355.371] -- 0:00:14
766000 -- (-358.248) [-358.054] (-356.618) (-357.073) * (-358.956) (-355.488) [-356.801] (-355.259) -- 0:00:14
766500 -- [-356.908] (-357.337) (-358.258) (-357.644) * (-355.890) [-362.528] (-367.889) (-356.895) -- 0:00:14
767000 -- [-357.843] (-360.871) (-358.486) (-358.863) * (-356.457) (-357.063) [-364.162] (-355.951) -- 0:00:13
767500 -- (-358.518) [-355.369] (-357.139) (-357.065) * (-358.277) (-356.518) [-359.560] (-357.572) -- 0:00:13
768000 -- (-358.525) (-357.275) (-358.418) [-356.929] * (-356.686) (-359.773) (-359.531) [-356.479] -- 0:00:13
768500 -- (-360.794) [-356.393] (-358.345) (-357.384) * [-357.893] (-360.418) (-359.037) (-357.819) -- 0:00:13
769000 -- (-356.341) [-355.846] (-357.492) (-357.490) * [-356.821] (-358.698) (-360.580) (-358.326) -- 0:00:13
769500 -- (-356.702) (-356.966) [-356.442] (-357.478) * (-357.591) [-355.800] (-357.412) (-359.412) -- 0:00:13
770000 -- (-356.628) (-356.845) [-356.734] (-357.132) * (-356.321) [-356.821] (-360.973) (-360.527) -- 0:00:13
Average standard deviation of split frequencies: 0.008716
770500 -- (-358.764) (-361.770) [-357.807] (-357.482) * (-355.733) [-355.561] (-356.631) (-358.445) -- 0:00:13
771000 -- (-356.133) (-357.646) [-356.852] (-358.055) * [-355.945] (-355.549) (-360.975) (-357.161) -- 0:00:13
771500 -- (-355.082) (-360.236) (-359.215) [-355.359] * (-357.627) (-357.219) [-356.835] (-359.648) -- 0:00:13
772000 -- (-355.307) (-356.904) (-360.124) [-356.693] * (-356.784) (-357.203) (-357.144) [-355.713] -- 0:00:13
772500 -- (-359.093) (-360.212) [-356.397] (-357.121) * (-356.711) [-357.139] (-357.721) (-356.089) -- 0:00:13
773000 -- (-358.332) (-357.690) [-358.033] (-357.315) * (-356.725) (-358.230) [-356.172] (-359.254) -- 0:00:13
773500 -- (-357.796) [-355.657] (-359.508) (-358.054) * [-358.903] (-358.776) (-356.736) (-355.724) -- 0:00:13
774000 -- (-359.235) (-358.157) (-358.799) [-356.473] * [-355.798] (-357.364) (-358.477) (-357.619) -- 0:00:13
774500 -- [-357.320] (-356.168) (-355.251) (-358.009) * (-355.947) (-357.320) (-357.284) [-356.233] -- 0:00:13
775000 -- (-358.361) (-361.931) (-355.468) [-357.038] * (-359.646) [-359.624] (-361.503) (-357.246) -- 0:00:13
Average standard deviation of split frequencies: 0.008581
775500 -- (-357.510) [-356.282] (-355.730) (-355.808) * [-356.297] (-358.325) (-360.042) (-356.050) -- 0:00:13
776000 -- (-356.278) (-358.895) (-358.293) [-357.772] * [-357.079] (-355.604) (-358.547) (-356.586) -- 0:00:13
776500 -- [-362.975] (-357.746) (-361.116) (-358.481) * (-358.121) [-355.373] (-356.832) (-356.390) -- 0:00:13
777000 -- (-356.822) (-355.952) (-357.636) [-362.050] * (-356.499) (-355.936) [-357.138] (-358.130) -- 0:00:13
777500 -- (-355.262) (-357.629) (-359.768) [-357.643] * [-356.047] (-359.025) (-363.330) (-356.846) -- 0:00:13
778000 -- [-357.513] (-361.993) (-358.705) (-356.148) * (-356.112) (-359.805) [-365.393] (-358.881) -- 0:00:13
778500 -- (-361.403) (-356.921) [-359.254] (-356.208) * (-357.455) (-358.560) (-356.201) [-358.153] -- 0:00:13
779000 -- (-357.655) (-360.983) [-356.962] (-358.850) * (-358.332) (-357.098) [-357.870] (-357.513) -- 0:00:13
779500 -- (-355.787) (-357.113) (-355.992) [-358.129] * (-355.384) (-355.948) [-358.820] (-357.060) -- 0:00:13
780000 -- [-355.357] (-356.946) (-356.037) (-358.036) * (-358.003) (-356.769) [-358.415] (-357.546) -- 0:00:13
Average standard deviation of split frequencies: 0.008831
780500 -- (-355.894) (-358.415) (-357.294) [-357.933] * (-358.948) [-357.532] (-356.372) (-357.706) -- 0:00:13
781000 -- (-355.865) (-357.376) [-357.229] (-360.155) * (-360.608) (-358.108) [-355.625] (-359.342) -- 0:00:13
781500 -- (-357.915) (-361.183) [-356.063] (-356.224) * (-357.125) (-358.441) (-355.900) [-358.295] -- 0:00:13
782000 -- (-356.432) [-360.869] (-358.775) (-356.005) * [-358.174] (-355.328) (-358.198) (-356.984) -- 0:00:13
782500 -- [-357.802] (-360.185) (-360.228) (-357.527) * (-355.738) (-358.542) [-359.075] (-357.358) -- 0:00:13
783000 -- (-361.528) (-357.367) (-358.087) [-356.187] * (-356.103) (-356.507) [-359.000] (-357.593) -- 0:00:13
783500 -- (-356.217) (-355.461) [-358.774] (-357.780) * (-356.110) (-356.743) [-357.441] (-356.219) -- 0:00:12
784000 -- (-359.244) [-355.213] (-355.917) (-360.798) * (-357.752) (-358.479) (-357.469) [-358.991] -- 0:00:12
784500 -- (-359.563) (-356.595) (-360.752) [-361.424] * (-358.272) [-356.172] (-358.762) (-357.481) -- 0:00:12
785000 -- [-356.561] (-358.705) (-359.425) (-358.538) * (-360.510) (-359.773) [-357.433] (-357.721) -- 0:00:12
Average standard deviation of split frequencies: 0.008921
785500 -- [-356.572] (-357.256) (-358.722) (-356.428) * (-358.149) (-356.247) (-361.698) [-358.810] -- 0:00:12
786000 -- (-355.971) [-355.697] (-358.303) (-356.980) * (-356.569) [-357.581] (-357.547) (-361.469) -- 0:00:12
786500 -- (-357.056) (-356.386) [-358.360] (-360.216) * [-361.770] (-357.517) (-357.211) (-358.809) -- 0:00:12
787000 -- [-357.671] (-358.952) (-357.254) (-356.708) * [-357.141] (-355.479) (-356.033) (-357.961) -- 0:00:12
787500 -- (-355.927) (-359.467) (-357.060) [-355.542] * (-356.680) (-356.619) [-357.615] (-355.674) -- 0:00:12
788000 -- (-357.740) [-356.899] (-356.215) (-358.299) * [-361.133] (-356.087) (-357.403) (-356.481) -- 0:00:12
788500 -- (-358.691) [-356.408] (-356.240) (-358.169) * [-358.324] (-356.762) (-359.933) (-359.703) -- 0:00:12
789000 -- (-361.565) (-358.687) (-356.984) [-357.173] * [-358.046] (-358.101) (-360.045) (-357.571) -- 0:00:12
789500 -- (-361.007) [-358.746] (-358.628) (-356.390) * (-356.113) [-356.683] (-356.317) (-359.608) -- 0:00:12
790000 -- [-355.822] (-358.609) (-359.732) (-359.294) * (-356.023) [-357.300] (-357.331) (-355.541) -- 0:00:12
Average standard deviation of split frequencies: 0.009241
790500 -- (-360.520) (-358.390) [-358.165] (-361.757) * (-356.863) [-357.155] (-357.295) (-356.663) -- 0:00:12
791000 -- [-357.120] (-356.105) (-356.578) (-363.352) * [-356.286] (-356.185) (-356.931) (-360.184) -- 0:00:12
791500 -- (-355.838) (-357.925) (-355.784) [-357.902] * (-358.191) [-356.389] (-360.170) (-360.159) -- 0:00:12
792000 -- (-356.011) (-355.857) [-354.950] (-363.120) * (-356.335) (-357.747) [-355.940] (-358.248) -- 0:00:12
792500 -- [-357.607] (-356.679) (-356.957) (-363.865) * (-356.002) (-356.903) (-358.641) [-358.973] -- 0:00:12
793000 -- (-357.665) [-357.485] (-357.550) (-356.806) * (-357.264) [-355.979] (-356.758) (-359.515) -- 0:00:12
793500 -- (-356.737) (-360.602) [-355.754] (-356.383) * [-358.035] (-359.920) (-355.400) (-356.095) -- 0:00:12
794000 -- (-357.244) [-360.092] (-355.806) (-357.573) * (-356.013) (-360.828) [-359.708] (-356.661) -- 0:00:12
794500 -- (-356.543) (-357.753) (-357.120) [-357.358] * (-355.505) (-357.387) [-360.833] (-358.435) -- 0:00:12
795000 -- (-359.678) (-356.275) (-358.944) [-357.943] * (-356.033) (-356.365) (-358.443) [-356.214] -- 0:00:12
Average standard deviation of split frequencies: 0.008920
795500 -- [-359.566] (-357.048) (-357.692) (-357.450) * (-360.341) (-357.649) (-355.844) [-357.100] -- 0:00:12
796000 -- (-356.326) (-359.794) [-355.902] (-357.521) * [-357.922] (-357.483) (-363.707) (-357.750) -- 0:00:12
796500 -- (-356.652) [-357.912] (-355.326) (-358.260) * (-357.270) (-359.147) (-357.261) [-357.391] -- 0:00:12
797000 -- [-358.228] (-357.347) (-357.551) (-356.802) * (-355.362) (-360.224) (-358.841) [-356.141] -- 0:00:12
797500 -- (-357.172) (-356.642) (-356.871) [-357.487] * (-355.640) (-357.833) (-359.690) [-355.840] -- 0:00:12
798000 -- [-357.079] (-359.487) (-358.946) (-357.803) * [-361.190] (-356.749) (-356.362) (-357.851) -- 0:00:12
798500 -- (-358.360) (-357.547) [-356.681] (-356.757) * (-358.424) (-357.700) [-355.882] (-361.274) -- 0:00:12
799000 -- (-355.506) [-357.033] (-355.469) (-362.518) * (-355.540) (-360.383) [-358.531] (-357.957) -- 0:00:12
799500 -- (-358.452) [-356.200] (-355.567) (-358.792) * [-355.452] (-362.584) (-357.553) (-359.730) -- 0:00:12
800000 -- (-358.605) (-358.189) [-358.936] (-356.895) * [-356.205] (-360.209) (-358.951) (-359.845) -- 0:00:12
Average standard deviation of split frequencies: 0.008463
800500 -- (-357.494) [-355.007] (-358.072) (-361.265) * (-357.474) [-356.862] (-360.277) (-356.834) -- 0:00:11
801000 -- (-359.584) (-356.052) [-357.023] (-357.035) * (-358.334) [-357.889] (-356.179) (-357.492) -- 0:00:11
801500 -- [-357.709] (-356.990) (-355.759) (-361.480) * (-357.979) (-356.516) [-356.659] (-355.918) -- 0:00:11
802000 -- (-359.792) (-357.894) [-357.151] (-356.653) * (-357.907) [-356.120] (-356.864) (-355.905) -- 0:00:11
802500 -- (-358.684) [-357.159] (-356.374) (-357.138) * [-356.569] (-362.067) (-357.468) (-357.727) -- 0:00:11
803000 -- (-359.758) (-358.145) [-358.335] (-362.481) * (-358.991) (-356.852) (-357.678) [-358.409] -- 0:00:11
803500 -- (-358.330) [-356.617] (-356.046) (-357.254) * [-356.121] (-359.921) (-359.264) (-356.985) -- 0:00:11
804000 -- (-359.225) [-355.583] (-359.028) (-357.352) * [-359.665] (-357.317) (-361.092) (-356.865) -- 0:00:11
804500 -- (-357.875) (-357.877) [-361.191] (-356.839) * (-357.599) [-358.235] (-359.103) (-358.077) -- 0:00:11
805000 -- (-357.161) (-356.688) [-363.614] (-357.186) * (-358.389) (-358.509) [-356.981] (-359.165) -- 0:00:11
Average standard deviation of split frequencies: 0.008700
805500 -- (-358.868) (-355.734) (-357.701) [-359.521] * (-357.424) [-357.990] (-357.181) (-366.372) -- 0:00:11
806000 -- (-361.270) (-356.016) [-355.852] (-357.834) * (-357.299) (-358.325) [-356.636] (-359.833) -- 0:00:11
806500 -- (-358.674) (-363.182) (-356.307) [-357.255] * (-355.975) (-356.261) (-355.962) [-356.271] -- 0:00:11
807000 -- (-357.826) (-357.233) (-357.745) [-358.174] * (-359.258) (-359.703) (-357.906) [-355.380] -- 0:00:11
807500 -- [-358.089] (-355.688) (-357.891) (-356.335) * (-357.439) (-359.994) [-356.574] (-356.282) -- 0:00:11
808000 -- (-363.042) (-357.832) [-357.050] (-357.096) * (-357.606) [-357.854] (-356.795) (-357.566) -- 0:00:11
808500 -- (-357.221) (-355.899) [-357.240] (-359.061) * (-359.385) (-356.303) [-355.997] (-357.652) -- 0:00:11
809000 -- (-357.271) (-357.224) [-356.557] (-356.875) * (-359.149) [-357.056] (-356.606) (-355.229) -- 0:00:11
809500 -- (-360.876) (-358.552) [-356.879] (-357.276) * (-356.465) (-355.882) (-358.234) [-356.028] -- 0:00:11
810000 -- (-359.424) (-361.315) [-358.709] (-360.334) * (-355.573) [-356.676] (-356.705) (-359.289) -- 0:00:11
Average standard deviation of split frequencies: 0.008904
810500 -- [-356.731] (-357.152) (-358.515) (-357.183) * (-359.443) (-360.452) (-355.925) [-356.683] -- 0:00:11
811000 -- (-357.101) (-356.951) (-360.377) [-355.566] * (-359.056) (-356.861) [-358.520] (-355.792) -- 0:00:11
811500 -- [-361.606] (-358.659) (-357.574) (-356.492) * (-356.494) (-355.328) (-358.764) [-360.007] -- 0:00:11
812000 -- (-358.994) (-355.593) [-356.630] (-356.894) * (-355.017) [-358.561] (-364.327) (-355.951) -- 0:00:11
812500 -- (-355.939) [-356.755] (-355.567) (-356.291) * [-358.364] (-356.678) (-357.481) (-358.692) -- 0:00:11
813000 -- (-361.139) (-355.335) [-355.853] (-360.051) * (-356.953) (-358.809) [-357.516] (-361.870) -- 0:00:11
813500 -- [-359.579] (-355.301) (-357.038) (-356.572) * [-357.113] (-358.007) (-358.780) (-358.835) -- 0:00:11
814000 -- (-357.473) (-356.229) [-355.101] (-358.159) * (-356.784) (-358.566) [-359.312] (-357.740) -- 0:00:11
814500 -- [-360.607] (-356.153) (-356.217) (-357.607) * (-361.100) [-357.076] (-356.409) (-357.293) -- 0:00:11
815000 -- (-357.542) [-357.512] (-359.278) (-356.866) * (-357.416) (-356.187) (-356.773) [-356.711] -- 0:00:11
Average standard deviation of split frequencies: 0.008593
815500 -- [-361.247] (-357.747) (-356.526) (-355.580) * (-358.242) [-358.249] (-356.627) (-358.220) -- 0:00:11
816000 -- (-359.302) [-358.558] (-355.528) (-357.534) * (-359.099) [-357.644] (-355.552) (-357.263) -- 0:00:11
816500 -- (-359.342) (-357.282) (-359.930) [-356.129] * (-357.949) [-358.546] (-357.756) (-359.751) -- 0:00:11
817000 -- (-357.147) (-358.066) (-357.616) [-356.898] * [-358.014] (-356.409) (-355.581) (-359.348) -- 0:00:10
817500 -- (-356.683) [-358.263] (-358.365) (-358.250) * (-356.574) (-360.495) (-360.244) [-359.703] -- 0:00:10
818000 -- (-357.783) [-359.644] (-357.560) (-357.989) * [-355.488] (-355.641) (-357.231) (-359.985) -- 0:00:10
818500 -- (-355.356) (-360.508) (-356.826) [-355.855] * (-358.599) [-355.422] (-356.255) (-359.937) -- 0:00:10
819000 -- (-356.730) (-355.616) [-356.688] (-355.253) * (-357.669) (-355.689) (-358.528) [-361.161] -- 0:00:10
819500 -- [-356.244] (-358.652) (-355.763) (-360.050) * (-357.857) [-355.385] (-356.201) (-358.196) -- 0:00:10
820000 -- [-358.054] (-358.563) (-355.816) (-357.760) * (-356.546) (-356.230) (-356.151) [-358.682] -- 0:00:10
Average standard deviation of split frequencies: 0.008832
820500 -- (-358.758) (-358.940) (-358.038) [-355.409] * (-356.173) (-357.926) [-356.000] (-360.553) -- 0:00:10
821000 -- [-356.248] (-357.206) (-357.356) (-361.163) * (-357.135) [-355.782] (-357.712) (-363.000) -- 0:00:10
821500 -- [-357.068] (-359.084) (-357.076) (-356.177) * [-357.019] (-356.582) (-358.985) (-357.752) -- 0:00:10
822000 -- [-356.961] (-359.484) (-357.959) (-362.087) * (-360.385) (-360.302) [-359.448] (-358.921) -- 0:00:10
822500 -- [-357.802] (-362.124) (-357.630) (-360.852) * (-358.771) [-357.224] (-358.890) (-356.958) -- 0:00:10
823000 -- (-358.354) [-357.120] (-360.982) (-355.989) * (-355.496) (-360.634) [-355.781] (-360.152) -- 0:00:10
823500 -- (-357.663) [-355.357] (-361.654) (-360.947) * [-356.543] (-361.304) (-358.615) (-360.460) -- 0:00:10
824000 -- (-356.031) (-357.441) [-356.657] (-355.666) * [-357.250] (-356.529) (-359.415) (-358.690) -- 0:00:10
824500 -- (-358.041) (-361.866) [-358.080] (-355.370) * (-355.752) (-358.807) (-357.494) [-357.198] -- 0:00:10
825000 -- (-359.536) (-356.829) [-356.669] (-356.305) * (-355.723) [-356.008] (-360.114) (-361.495) -- 0:00:10
Average standard deviation of split frequencies: 0.008846
825500 -- (-360.142) (-362.853) (-357.758) [-355.458] * (-357.014) (-358.103) [-361.500] (-361.724) -- 0:00:10
826000 -- (-357.061) (-356.536) (-355.772) [-356.094] * (-356.404) [-356.690] (-360.581) (-358.719) -- 0:00:10
826500 -- (-357.407) (-356.221) (-358.018) [-357.335] * (-355.507) (-356.667) (-358.999) [-355.428] -- 0:00:10
827000 -- [-358.088] (-356.060) (-356.775) (-358.776) * (-357.443) (-356.232) (-359.591) [-357.590] -- 0:00:10
827500 -- (-362.561) (-358.984) [-357.139] (-358.711) * [-357.310] (-357.901) (-359.904) (-358.728) -- 0:00:10
828000 -- (-357.554) [-359.693] (-357.369) (-356.463) * (-357.835) [-356.923] (-357.935) (-357.555) -- 0:00:10
828500 -- (-357.107) (-356.770) [-358.916] (-357.467) * (-359.247) [-356.221] (-357.860) (-356.261) -- 0:00:10
829000 -- (-359.069) [-356.890] (-359.590) (-356.043) * (-361.362) [-355.704] (-358.627) (-357.614) -- 0:00:10
829500 -- [-359.076] (-356.904) (-359.795) (-361.277) * [-355.935] (-358.589) (-357.060) (-358.155) -- 0:00:10
830000 -- (-362.302) [-357.262] (-359.673) (-359.628) * [-356.418] (-357.940) (-356.576) (-358.077) -- 0:00:10
Average standard deviation of split frequencies: 0.009045
830500 -- (-360.976) (-361.374) (-361.946) [-359.931] * [-356.934] (-359.211) (-356.273) (-356.811) -- 0:00:10
831000 -- [-356.919] (-359.595) (-357.222) (-362.743) * (-357.943) (-355.289) [-357.657] (-356.107) -- 0:00:10
831500 -- (-356.494) (-357.422) (-357.110) [-362.819] * (-360.908) [-355.298] (-359.005) (-355.954) -- 0:00:10
832000 -- [-357.751] (-358.185) (-358.106) (-357.206) * [-360.438] (-355.940) (-362.419) (-357.725) -- 0:00:10
832500 -- (-355.625) (-356.857) (-357.403) [-356.768] * (-357.955) (-357.064) (-355.570) [-356.260] -- 0:00:10
833000 -- [-355.611] (-357.856) (-357.541) (-359.212) * [-357.998] (-358.545) (-355.923) (-357.268) -- 0:00:10
833500 -- (-355.717) [-356.305] (-360.563) (-359.936) * (-360.135) [-358.031] (-355.865) (-359.438) -- 0:00:09
834000 -- (-356.734) (-355.872) (-358.857) [-356.371] * (-360.088) (-355.790) [-355.955] (-358.653) -- 0:00:09
834500 -- (-355.399) [-356.437] (-360.208) (-359.265) * (-355.979) [-357.344] (-356.460) (-356.236) -- 0:00:09
835000 -- (-356.202) (-358.554) [-357.640] (-364.746) * (-356.054) (-355.762) [-355.580] (-356.995) -- 0:00:09
Average standard deviation of split frequencies: 0.008811
835500 -- [-357.102] (-361.016) (-357.577) (-360.120) * (-356.877) (-359.264) [-356.463] (-357.393) -- 0:00:09
836000 -- [-355.945] (-356.778) (-356.100) (-361.165) * (-357.257) (-355.457) [-356.059] (-355.889) -- 0:00:09
836500 -- (-356.754) [-356.788] (-355.202) (-356.627) * [-360.260] (-356.126) (-355.629) (-357.821) -- 0:00:09
837000 -- (-355.517) (-356.845) (-357.851) [-355.385] * (-361.046) (-357.330) [-357.889] (-357.973) -- 0:00:09
837500 -- [-359.416] (-357.021) (-356.386) (-356.275) * [-356.002] (-361.014) (-356.016) (-359.591) -- 0:00:09
838000 -- [-358.943] (-360.641) (-356.752) (-356.808) * [-355.859] (-359.919) (-356.573) (-355.785) -- 0:00:09
838500 -- (-356.238) (-356.867) [-361.167] (-357.664) * (-358.888) (-357.568) [-357.142] (-357.846) -- 0:00:09
839000 -- [-356.638] (-361.088) (-357.133) (-358.656) * [-356.210] (-357.795) (-358.056) (-356.615) -- 0:00:09
839500 -- (-356.626) (-362.043) [-355.258] (-355.703) * (-355.982) (-355.344) [-356.828] (-355.728) -- 0:00:09
840000 -- (-356.327) (-361.942) (-356.380) [-360.742] * [-356.092] (-356.883) (-357.378) (-357.177) -- 0:00:09
Average standard deviation of split frequencies: 0.008341
840500 -- (-356.070) (-355.685) [-355.751] (-358.070) * (-358.111) [-359.744] (-357.677) (-358.451) -- 0:00:09
841000 -- [-357.903] (-355.873) (-357.114) (-359.904) * (-365.860) [-358.615] (-356.750) (-357.353) -- 0:00:09
841500 -- (-359.880) (-356.509) [-355.864] (-360.588) * (-366.800) [-356.446] (-356.953) (-358.671) -- 0:00:09
842000 -- (-361.139) (-356.421) [-358.628] (-357.343) * (-359.358) [-356.767] (-357.701) (-361.704) -- 0:00:09
842500 -- (-361.767) (-359.428) [-355.234] (-360.021) * (-356.093) (-359.664) (-360.810) [-356.824] -- 0:00:09
843000 -- (-355.881) (-359.432) [-356.596] (-360.756) * (-358.075) [-357.811] (-358.294) (-356.759) -- 0:00:09
843500 -- (-356.983) (-358.767) (-355.545) [-355.847] * (-358.058) [-355.252] (-357.889) (-360.665) -- 0:00:09
844000 -- [-356.165] (-356.367) (-358.519) (-357.576) * (-356.048) [-363.468] (-358.225) (-356.433) -- 0:00:09
844500 -- [-357.546] (-355.894) (-357.416) (-357.643) * [-356.173] (-357.736) (-357.616) (-355.690) -- 0:00:09
845000 -- (-358.358) [-356.863] (-356.390) (-358.184) * (-357.178) (-367.644) [-359.183] (-357.767) -- 0:00:09
Average standard deviation of split frequencies: 0.008219
845500 -- [-359.263] (-356.729) (-356.957) (-357.335) * (-355.453) [-356.626] (-357.156) (-356.384) -- 0:00:09
846000 -- (-359.507) (-355.825) (-357.860) [-357.870] * (-357.396) [-359.444] (-360.606) (-356.842) -- 0:00:09
846500 -- [-355.432] (-356.360) (-357.357) (-357.615) * (-357.204) (-358.953) (-358.542) [-359.508] -- 0:00:09
847000 -- (-356.108) (-357.281) [-355.782] (-359.811) * (-355.799) [-359.170] (-357.349) (-359.918) -- 0:00:09
847500 -- (-356.446) [-361.849] (-356.570) (-362.063) * (-358.894) (-357.501) (-357.414) [-356.712] -- 0:00:09
848000 -- [-356.644] (-360.478) (-355.604) (-357.876) * (-358.066) [-357.456] (-366.626) (-356.068) -- 0:00:09
848500 -- [-355.717] (-356.613) (-358.605) (-356.668) * (-357.639) (-355.741) [-356.158] (-359.291) -- 0:00:09
849000 -- [-356.627] (-357.731) (-358.137) (-357.041) * (-355.864) [-356.880] (-358.594) (-359.786) -- 0:00:09
849500 -- (-356.869) (-359.479) [-356.490] (-356.684) * (-355.664) (-358.935) (-359.904) [-358.011] -- 0:00:09
850000 -- (-357.767) (-358.340) [-356.480] (-356.063) * [-355.593] (-360.788) (-358.037) (-356.745) -- 0:00:09
Average standard deviation of split frequencies: 0.008035
850500 -- (-356.908) (-356.959) (-360.476) [-355.782] * (-360.521) (-356.198) [-359.174] (-358.689) -- 0:00:08
851000 -- (-355.295) (-355.448) [-356.357] (-355.830) * (-362.771) (-356.495) [-357.016] (-357.126) -- 0:00:08
851500 -- [-355.776] (-357.739) (-354.968) (-359.045) * (-360.683) (-357.235) (-355.501) [-356.101] -- 0:00:08
852000 -- [-355.807] (-360.722) (-355.959) (-358.558) * [-357.940] (-356.793) (-355.501) (-356.180) -- 0:00:08
852500 -- (-356.823) (-358.092) [-357.008] (-357.572) * (-356.058) (-355.121) [-358.535] (-360.258) -- 0:00:08
853000 -- (-359.440) [-358.922] (-360.040) (-357.268) * (-357.910) [-356.650] (-360.924) (-356.321) -- 0:00:08
853500 -- (-360.666) [-357.365] (-357.205) (-357.229) * (-355.522) (-355.712) [-356.334] (-356.821) -- 0:00:08
854000 -- (-359.598) (-357.672) (-357.321) [-360.045] * [-355.370] (-355.848) (-356.393) (-355.866) -- 0:00:08
854500 -- (-360.433) [-358.968] (-358.333) (-357.693) * (-357.602) (-364.421) (-358.134) [-357.691] -- 0:00:08
855000 -- (-362.104) (-355.879) [-357.740] (-357.830) * (-356.303) [-356.605] (-356.939) (-359.706) -- 0:00:08
Average standard deviation of split frequencies: 0.008123
855500 -- (-364.530) [-358.713] (-356.075) (-356.426) * (-358.701) (-358.790) (-357.608) [-357.861] -- 0:00:08
856000 -- (-361.803) (-357.106) (-355.660) [-357.462] * [-357.517] (-360.075) (-360.192) (-356.438) -- 0:00:08
856500 -- (-357.403) [-356.237] (-360.711) (-359.564) * [-358.730] (-357.903) (-358.477) (-357.182) -- 0:00:08
857000 -- (-357.310) (-356.031) (-359.120) [-356.868] * (-359.807) [-355.660] (-357.130) (-357.772) -- 0:00:08
857500 -- (-355.444) (-358.529) (-359.002) [-357.052] * [-357.928] (-356.912) (-355.198) (-355.933) -- 0:00:08
858000 -- (-356.835) [-357.793] (-356.037) (-356.389) * (-360.989) (-361.918) [-355.893] (-355.413) -- 0:00:08
858500 -- (-358.065) [-355.817] (-359.173) (-356.162) * (-355.822) (-357.017) [-357.460] (-355.300) -- 0:00:08
859000 -- [-357.049] (-356.690) (-356.369) (-355.449) * [-356.592] (-357.408) (-360.111) (-359.877) -- 0:00:08
859500 -- [-356.035] (-357.596) (-356.074) (-358.416) * (-359.017) [-359.049] (-356.045) (-356.580) -- 0:00:08
860000 -- (-359.849) [-357.678] (-358.471) (-358.965) * [-357.158] (-358.215) (-359.001) (-359.856) -- 0:00:08
Average standard deviation of split frequencies: 0.007873
860500 -- (-355.851) (-359.540) (-358.489) [-357.540] * (-356.277) [-357.460] (-358.275) (-366.101) -- 0:00:08
861000 -- (-357.938) (-359.617) (-362.138) [-356.865] * (-358.123) [-357.013] (-356.325) (-359.094) -- 0:00:08
861500 -- [-355.274] (-356.209) (-356.458) (-362.257) * [-358.296] (-355.454) (-356.649) (-360.023) -- 0:00:08
862000 -- (-359.262) [-356.561] (-355.637) (-358.228) * (-357.897) (-356.658) [-356.320] (-361.449) -- 0:00:08
862500 -- (-356.611) [-356.013] (-355.135) (-357.403) * [-357.482] (-361.347) (-357.573) (-357.801) -- 0:00:08
863000 -- (-358.411) (-357.077) [-355.135] (-355.201) * (-356.793) (-358.925) (-357.094) [-355.544] -- 0:00:08
863500 -- (-357.904) (-355.789) (-356.371) [-357.709] * (-355.812) (-358.511) [-356.106] (-355.402) -- 0:00:08
864000 -- (-357.273) (-356.939) [-355.712] (-358.912) * (-355.449) (-355.795) (-358.774) [-357.629] -- 0:00:08
864500 -- (-358.453) [-360.575] (-356.687) (-366.976) * (-356.155) (-356.599) (-357.556) [-357.940] -- 0:00:08
865000 -- [-357.351] (-357.790) (-358.676) (-356.754) * [-357.020] (-356.861) (-357.844) (-358.278) -- 0:00:08
Average standard deviation of split frequencies: 0.007485
865500 -- (-356.368) (-357.554) (-357.175) [-355.951] * (-356.575) (-356.291) [-355.095] (-358.905) -- 0:00:08
866000 -- (-356.509) [-358.413] (-355.042) (-359.692) * (-356.823) [-356.349] (-359.469) (-358.761) -- 0:00:08
866500 -- [-355.990] (-358.434) (-355.126) (-359.401) * (-356.278) (-361.249) [-355.237] (-357.048) -- 0:00:08
867000 -- (-363.198) [-356.740] (-356.169) (-358.468) * (-358.464) (-358.410) (-355.479) [-359.716] -- 0:00:07
867500 -- (-363.201) (-358.324) (-356.780) [-359.719] * (-359.827) (-355.817) [-356.710] (-357.215) -- 0:00:07
868000 -- (-360.033) (-356.978) (-356.314) [-358.275] * (-359.622) [-355.791] (-356.579) (-357.120) -- 0:00:07
868500 -- (-358.383) [-356.837] (-357.206) (-356.557) * (-358.426) (-356.402) (-362.270) [-355.267] -- 0:00:07
869000 -- (-356.433) (-358.033) [-356.071] (-357.169) * [-356.662] (-355.410) (-355.987) (-356.715) -- 0:00:07
869500 -- [-356.653] (-357.322) (-355.857) (-358.612) * (-357.821) (-356.295) [-356.602] (-358.239) -- 0:00:07
870000 -- (-356.400) (-357.636) [-357.702] (-358.062) * (-356.570) (-363.582) (-356.557) [-356.241] -- 0:00:07
Average standard deviation of split frequencies: 0.007106
870500 -- (-355.521) [-357.442] (-358.218) (-359.121) * (-358.070) (-356.520) (-356.249) [-356.155] -- 0:00:07
871000 -- (-360.282) (-357.436) (-355.808) [-356.478] * (-358.225) (-356.240) (-355.942) [-356.714] -- 0:00:07
871500 -- (-357.840) [-361.256] (-357.079) (-359.775) * (-356.145) (-357.209) [-359.209] (-356.049) -- 0:00:07
872000 -- (-357.123) (-356.480) (-357.485) [-357.470] * (-356.876) (-358.748) (-357.201) [-355.938] -- 0:00:07
872500 -- (-357.788) (-362.780) (-356.559) [-357.693] * (-358.365) (-359.435) [-356.434] (-356.556) -- 0:00:07
873000 -- (-356.728) [-358.194] (-355.801) (-359.491) * (-357.939) (-355.988) (-355.397) [-356.533] -- 0:00:07
873500 -- [-356.657] (-357.038) (-358.762) (-358.758) * [-356.274] (-357.834) (-356.396) (-355.088) -- 0:00:07
874000 -- (-359.009) (-355.809) (-356.740) [-358.142] * (-356.834) [-357.096] (-357.821) (-356.864) -- 0:00:07
874500 -- [-358.885] (-358.797) (-359.295) (-358.414) * (-357.986) [-356.420] (-358.860) (-356.172) -- 0:00:07
875000 -- (-362.516) (-361.338) [-357.814] (-355.967) * (-357.755) (-360.752) (-358.507) [-357.055] -- 0:00:07
Average standard deviation of split frequencies: 0.007366
875500 -- (-362.766) (-358.792) [-356.843] (-356.844) * [-355.035] (-360.651) (-359.897) (-360.806) -- 0:00:07
876000 -- [-360.138] (-359.306) (-360.559) (-356.825) * (-355.940) [-355.327] (-355.819) (-358.105) -- 0:00:07
876500 -- (-363.706) (-359.477) [-355.551] (-369.549) * (-357.438) (-359.775) [-357.153] (-356.796) -- 0:00:07
877000 -- [-363.048] (-359.016) (-356.160) (-356.194) * (-355.657) (-356.091) (-356.278) [-355.826] -- 0:00:07
877500 -- [-356.802] (-356.600) (-357.628) (-356.208) * (-357.874) [-356.405] (-358.040) (-357.897) -- 0:00:07
878000 -- (-363.516) (-356.966) (-357.519) [-355.802] * (-356.047) [-356.170] (-358.029) (-356.924) -- 0:00:07
878500 -- (-356.998) (-356.322) [-356.326] (-355.966) * (-358.989) (-357.637) [-359.828] (-359.509) -- 0:00:07
879000 -- [-355.969] (-358.246) (-357.349) (-359.576) * [-358.535] (-358.550) (-355.424) (-359.262) -- 0:00:07
879500 -- (-358.368) (-357.619) (-357.080) [-356.164] * [-357.460] (-358.059) (-357.256) (-359.412) -- 0:00:07
880000 -- (-356.915) [-356.042] (-355.834) (-357.981) * [-357.371] (-360.563) (-356.813) (-357.934) -- 0:00:07
Average standard deviation of split frequencies: 0.007092
880500 -- (-358.653) (-358.648) [-356.338] (-361.924) * [-358.917] (-358.725) (-356.831) (-355.078) -- 0:00:07
881000 -- (-355.923) [-358.136] (-356.871) (-356.542) * [-355.457] (-356.922) (-355.869) (-355.975) -- 0:00:07
881500 -- (-355.280) (-361.157) [-358.214] (-355.981) * [-360.487] (-357.434) (-358.019) (-356.338) -- 0:00:07
882000 -- (-355.923) (-357.716) [-357.844] (-357.596) * (-358.107) [-356.310] (-358.085) (-356.115) -- 0:00:07
882500 -- (-355.330) (-361.651) (-357.187) [-356.153] * (-357.486) [-359.005] (-355.982) (-357.921) -- 0:00:07
883000 -- [-356.904] (-357.373) (-356.925) (-357.056) * [-357.549] (-358.384) (-356.783) (-361.992) -- 0:00:07
883500 -- (-357.722) [-358.011] (-356.619) (-355.579) * (-359.047) [-356.785] (-360.468) (-356.994) -- 0:00:06
884000 -- (-356.091) (-359.446) (-357.814) [-358.813] * (-357.184) (-355.532) [-358.429] (-356.543) -- 0:00:06
884500 -- (-356.908) (-358.352) (-363.440) [-356.900] * (-356.632) (-366.148) [-357.568] (-355.809) -- 0:00:06
885000 -- (-360.539) (-356.863) (-355.893) [-355.431] * [-355.684] (-356.752) (-358.860) (-357.670) -- 0:00:06
Average standard deviation of split frequencies: 0.006917
885500 -- (-356.654) (-357.557) [-355.841] (-357.380) * (-356.510) (-356.145) [-359.769] (-355.891) -- 0:00:06
886000 -- (-355.617) [-356.585] (-356.012) (-361.806) * [-357.809] (-358.048) (-356.957) (-358.442) -- 0:00:06
886500 -- (-359.409) [-356.586] (-361.763) (-362.959) * (-355.687) (-358.192) (-357.548) [-357.535] -- 0:00:06
887000 -- (-356.770) (-358.771) [-356.099] (-357.913) * (-357.012) (-357.096) [-356.891] (-357.132) -- 0:00:06
887500 -- (-357.974) [-355.709] (-356.115) (-359.318) * [-358.444] (-358.402) (-357.292) (-355.960) -- 0:00:06
888000 -- (-356.966) [-355.254] (-356.054) (-359.412) * [-355.656] (-356.373) (-358.277) (-357.176) -- 0:00:06
888500 -- [-358.084] (-355.819) (-356.487) (-358.192) * [-355.725] (-357.395) (-358.718) (-361.693) -- 0:00:06
889000 -- (-358.117) [-356.956] (-355.412) (-356.686) * (-358.168) (-358.947) (-357.708) [-356.211] -- 0:00:06
889500 -- (-357.893) (-358.319) [-355.670] (-355.801) * [-357.569] (-355.602) (-356.640) (-357.542) -- 0:00:06
890000 -- (-357.097) [-356.349] (-356.211) (-358.407) * (-356.407) [-356.028] (-358.839) (-361.824) -- 0:00:06
Average standard deviation of split frequencies: 0.006847
890500 -- (-355.694) (-357.103) [-359.720] (-355.741) * [-355.438] (-361.534) (-358.251) (-356.864) -- 0:00:06
891000 -- (-355.586) (-357.727) [-357.127] (-357.301) * (-356.559) [-356.046] (-361.148) (-356.795) -- 0:00:06
891500 -- (-358.909) [-357.372] (-358.518) (-357.427) * [-356.688] (-357.435) (-356.465) (-362.834) -- 0:00:06
892000 -- (-356.634) [-356.221] (-356.079) (-357.976) * (-359.821) (-357.514) (-357.922) [-356.000] -- 0:00:06
892500 -- (-357.518) [-358.386] (-360.725) (-357.376) * [-358.512] (-357.123) (-358.805) (-358.037) -- 0:00:06
893000 -- (-357.973) (-358.936) (-357.136) [-357.707] * [-357.538] (-356.304) (-358.257) (-359.121) -- 0:00:06
893500 -- (-362.314) [-356.811] (-359.322) (-356.984) * (-356.632) (-356.406) [-356.152] (-356.357) -- 0:00:06
894000 -- (-356.962) (-358.802) [-357.304] (-355.699) * (-359.525) [-358.119] (-356.218) (-356.640) -- 0:00:06
894500 -- [-356.398] (-358.146) (-357.582) (-360.575) * [-356.864] (-358.104) (-359.856) (-361.076) -- 0:00:06
895000 -- (-357.483) [-356.450] (-355.904) (-359.827) * (-356.208) [-357.734] (-355.759) (-359.530) -- 0:00:06
Average standard deviation of split frequencies: 0.006243
895500 -- [-356.697] (-356.892) (-359.437) (-355.804) * [-357.796] (-359.938) (-358.789) (-355.319) -- 0:00:06
896000 -- (-362.027) (-356.566) (-359.498) [-363.874] * (-357.087) (-360.092) [-360.422] (-355.557) -- 0:00:06
896500 -- [-361.814] (-359.312) (-359.785) (-355.923) * [-357.571] (-358.035) (-361.200) (-356.284) -- 0:00:06
897000 -- (-358.075) (-356.710) (-356.075) [-355.874] * (-356.427) (-360.162) (-360.039) [-356.486] -- 0:00:06
897500 -- (-356.172) (-357.245) (-355.621) [-356.490] * (-358.084) [-357.964] (-357.680) (-358.892) -- 0:00:06
898000 -- (-358.030) [-356.935] (-355.490) (-359.737) * [-358.250] (-356.070) (-357.341) (-356.310) -- 0:00:06
898500 -- (-358.149) (-357.841) (-357.308) [-355.099] * (-356.607) [-359.429] (-356.575) (-357.676) -- 0:00:06
899000 -- (-358.211) [-355.649] (-358.099) (-359.408) * [-356.242] (-355.379) (-361.309) (-359.672) -- 0:00:06
899500 -- (-358.638) (-359.934) (-357.817) [-356.583] * (-356.735) [-355.690] (-357.568) (-355.557) -- 0:00:06
900000 -- (-358.352) (-355.305) (-359.055) [-358.765] * (-357.147) (-357.832) [-356.104] (-355.704) -- 0:00:06
Average standard deviation of split frequencies: 0.006106
900500 -- (-357.615) (-360.060) [-357.259] (-359.133) * (-356.416) [-357.154] (-355.566) (-356.779) -- 0:00:05
901000 -- (-357.961) (-358.290) [-359.978] (-359.068) * [-356.404] (-357.613) (-356.108) (-355.585) -- 0:00:05
901500 -- (-358.284) (-355.560) (-361.950) [-356.258] * (-356.653) (-358.960) [-357.473] (-358.662) -- 0:00:05
902000 -- (-357.053) (-355.622) (-358.437) [-356.612] * [-356.622] (-357.415) (-358.625) (-357.609) -- 0:00:05
902500 -- (-358.476) [-356.182] (-356.743) (-360.148) * [-358.726] (-357.973) (-357.730) (-359.221) -- 0:00:05
903000 -- (-356.957) (-357.309) (-359.741) [-356.706] * [-356.830] (-358.377) (-359.150) (-359.307) -- 0:00:05
903500 -- (-359.703) [-356.092] (-361.370) (-355.231) * (-357.718) [-360.493] (-359.010) (-359.678) -- 0:00:05
904000 -- (-359.144) (-362.062) (-365.819) [-360.432] * (-356.453) [-360.577] (-359.859) (-361.619) -- 0:00:05
904500 -- (-356.510) (-363.864) (-357.431) [-357.530] * (-359.518) [-355.973] (-358.318) (-358.938) -- 0:00:05
905000 -- (-357.944) (-358.666) [-356.537] (-356.086) * (-356.539) (-355.381) (-355.744) [-355.757] -- 0:00:05
Average standard deviation of split frequencies: 0.006140
905500 -- (-356.899) (-356.084) [-356.012] (-356.169) * (-360.712) (-355.785) [-357.864] (-357.424) -- 0:00:05
906000 -- (-356.436) (-358.716) [-355.732] (-356.284) * (-357.907) (-356.492) [-356.950] (-360.886) -- 0:00:05
906500 -- (-355.123) (-363.271) [-355.587] (-356.697) * (-361.072) [-357.101] (-355.919) (-357.652) -- 0:00:05
907000 -- [-361.148] (-362.934) (-357.080) (-357.217) * (-357.354) (-357.555) (-359.342) [-356.692] -- 0:00:05
907500 -- (-360.522) (-361.306) [-355.783] (-358.661) * (-360.404) (-356.377) [-357.633] (-358.981) -- 0:00:05
908000 -- (-355.745) (-356.428) (-359.852) [-356.729] * [-356.998] (-355.947) (-355.368) (-363.890) -- 0:00:05
908500 -- (-356.716) (-355.910) [-356.723] (-355.589) * (-355.944) (-356.563) (-356.890) [-357.573] -- 0:00:05
909000 -- [-355.909] (-360.648) (-359.102) (-356.473) * (-356.116) [-357.154] (-357.519) (-362.083) -- 0:00:05
909500 -- (-360.416) [-361.188] (-357.164) (-358.531) * [-358.847] (-359.342) (-356.369) (-358.443) -- 0:00:05
910000 -- [-360.662] (-358.880) (-356.968) (-359.325) * (-360.397) (-358.064) (-356.521) [-356.774] -- 0:00:05
Average standard deviation of split frequencies: 0.006108
910500 -- (-364.134) (-358.587) [-357.382] (-357.157) * [-358.945] (-357.152) (-355.555) (-363.814) -- 0:00:05
911000 -- (-359.406) [-357.258] (-357.585) (-357.630) * (-357.913) (-362.137) [-355.900] (-358.618) -- 0:00:05
911500 -- (-362.097) (-357.091) (-356.454) [-355.677] * (-357.090) (-356.638) (-358.751) [-356.721] -- 0:00:05
912000 -- [-356.659] (-358.162) (-355.880) (-356.103) * (-358.939) (-355.383) (-359.525) [-357.213] -- 0:00:05
912500 -- (-356.944) (-355.638) [-356.773] (-355.064) * (-357.389) (-357.385) (-355.060) [-359.511] -- 0:00:05
913000 -- (-357.726) [-358.219] (-356.621) (-355.637) * (-356.792) (-356.598) [-355.617] (-360.411) -- 0:00:05
913500 -- (-357.041) (-358.531) (-355.785) [-356.172] * [-355.698] (-356.129) (-356.593) (-356.355) -- 0:00:05
914000 -- (-362.339) (-358.269) (-358.746) [-358.048] * (-355.577) [-355.422] (-356.881) (-357.824) -- 0:00:05
914500 -- (-355.197) (-359.218) (-359.629) [-357.356] * [-356.346] (-359.568) (-356.506) (-356.975) -- 0:00:05
915000 -- (-356.707) (-356.405) [-360.765] (-356.067) * (-357.779) [-356.939] (-356.093) (-357.937) -- 0:00:05
Average standard deviation of split frequencies: 0.006347
915500 -- (-356.927) (-359.892) (-361.111) [-358.077] * [-360.124] (-355.841) (-355.983) (-358.185) -- 0:00:05
916000 -- [-356.138] (-361.328) (-361.970) (-357.486) * (-357.102) (-355.189) [-357.470] (-358.705) -- 0:00:05
916500 -- [-355.691] (-358.077) (-361.587) (-359.466) * (-358.504) (-354.971) (-360.388) [-356.187] -- 0:00:05
917000 -- (-358.454) (-355.858) [-358.111] (-359.953) * (-359.136) (-356.661) [-358.287] (-358.031) -- 0:00:04
917500 -- (-357.085) [-355.848] (-359.429) (-355.261) * [-357.153] (-356.806) (-358.079) (-357.239) -- 0:00:04
918000 -- (-355.943) (-356.059) (-357.383) [-356.367] * (-356.385) (-356.286) (-356.815) [-356.867] -- 0:00:04
918500 -- (-356.811) (-358.426) [-356.627] (-359.191) * (-359.942) (-358.200) [-357.018] (-358.599) -- 0:00:04
919000 -- [-355.913] (-358.381) (-360.476) (-357.719) * (-361.055) (-357.366) [-359.396] (-356.881) -- 0:00:04
919500 -- (-356.845) (-363.455) [-357.666] (-358.320) * (-357.174) [-356.573] (-359.387) (-358.294) -- 0:00:04
920000 -- (-356.050) (-358.458) [-358.805] (-358.512) * (-357.944) (-355.781) (-356.381) [-355.827] -- 0:00:04
Average standard deviation of split frequencies: 0.006417
920500 -- (-358.448) [-357.973] (-357.801) (-359.602) * [-355.947] (-355.033) (-357.361) (-356.353) -- 0:00:04
921000 -- (-355.420) (-358.594) [-357.214] (-359.437) * (-357.508) (-357.807) [-359.069] (-355.134) -- 0:00:04
921500 -- [-355.229] (-358.964) (-358.137) (-359.753) * (-359.304) (-358.199) [-358.991] (-355.433) -- 0:00:04
922000 -- [-359.189] (-356.400) (-357.908) (-357.986) * (-356.018) [-359.402] (-366.678) (-357.778) -- 0:00:04
922500 -- (-357.359) (-360.155) [-356.395] (-357.253) * (-357.593) (-357.430) [-356.248] (-360.238) -- 0:00:04
923000 -- [-358.986] (-358.937) (-356.452) (-357.841) * (-357.442) (-360.565) [-356.868] (-357.140) -- 0:00:04
923500 -- (-356.955) (-357.124) (-362.729) [-357.287] * (-357.793) [-356.123] (-360.032) (-362.374) -- 0:00:04
924000 -- (-359.380) (-360.214) (-361.146) [-357.754] * [-357.485] (-356.543) (-358.590) (-359.933) -- 0:00:04
924500 -- (-357.031) (-362.584) [-356.533] (-356.307) * [-356.755] (-356.503) (-357.443) (-360.074) -- 0:00:04
925000 -- [-356.488] (-356.010) (-356.383) (-358.069) * (-360.698) (-356.952) [-359.669] (-357.613) -- 0:00:04
Average standard deviation of split frequencies: 0.006211
925500 -- (-356.914) (-355.858) (-359.873) [-361.446] * (-359.107) [-358.234] (-358.624) (-360.503) -- 0:00:04
926000 -- (-356.982) (-360.182) (-363.091) [-363.110] * (-359.942) (-357.443) [-356.438] (-360.940) -- 0:00:04
926500 -- (-356.707) (-359.466) [-359.436] (-357.330) * (-357.317) (-358.002) (-357.503) [-357.610] -- 0:00:04
927000 -- [-355.644] (-357.786) (-363.518) (-355.295) * (-355.417) [-357.116] (-356.599) (-357.122) -- 0:00:04
927500 -- (-355.558) (-357.034) (-356.541) [-357.011] * (-358.363) (-360.262) [-355.889] (-359.014) -- 0:00:04
928000 -- (-355.026) [-355.731] (-357.481) (-355.380) * (-357.954) (-357.954) [-357.326] (-357.946) -- 0:00:04
928500 -- [-359.140] (-355.509) (-355.485) (-356.978) * (-356.974) (-356.246) [-355.468] (-357.001) -- 0:00:04
929000 -- (-357.418) [-361.339] (-355.553) (-357.000) * (-361.406) (-356.093) [-356.030] (-356.294) -- 0:00:04
929500 -- (-359.263) (-356.078) (-356.464) [-359.730] * [-357.050] (-358.324) (-355.884) (-357.334) -- 0:00:04
930000 -- (-358.337) (-357.807) [-357.882] (-356.732) * [-357.502] (-357.274) (-356.876) (-359.882) -- 0:00:04
Average standard deviation of split frequencies: 0.005876
930500 -- (-355.994) (-357.286) (-358.791) [-356.411] * (-362.030) (-355.848) (-361.410) [-356.187] -- 0:00:04
931000 -- (-356.721) (-359.208) [-358.524] (-357.850) * (-356.982) (-357.635) (-356.149) [-355.686] -- 0:00:04
931500 -- (-359.292) (-365.600) (-357.994) [-355.997] * (-357.790) (-355.288) (-357.982) [-355.401] -- 0:00:04
932000 -- [-359.222] (-358.890) (-357.058) (-355.817) * (-357.279) (-355.559) [-357.643] (-356.334) -- 0:00:04
932500 -- (-355.607) [-357.438] (-355.527) (-358.310) * (-361.272) [-356.196] (-359.009) (-356.022) -- 0:00:04
933000 -- (-357.974) (-357.062) [-359.011] (-360.832) * (-362.843) (-355.085) (-356.382) [-357.246] -- 0:00:04
933500 -- (-355.349) (-358.441) (-356.880) [-358.650] * (-358.963) [-356.177] (-356.237) (-356.886) -- 0:00:03
934000 -- (-357.747) (-358.994) [-357.225] (-357.140) * (-358.036) (-358.015) [-357.678] (-356.517) -- 0:00:03
934500 -- (-358.906) (-357.485) (-362.902) [-358.630] * (-357.250) (-355.337) [-357.399] (-359.892) -- 0:00:03
935000 -- (-361.204) (-357.954) (-361.139) [-359.595] * (-355.283) [-359.562] (-356.807) (-358.162) -- 0:00:03
Average standard deviation of split frequencies: 0.005909
935500 -- (-358.303) (-357.180) [-356.681] (-358.659) * (-355.473) (-356.452) (-358.770) [-359.216] -- 0:00:03
936000 -- (-357.768) (-356.566) (-357.751) [-359.283] * [-355.697] (-358.612) (-358.086) (-357.511) -- 0:00:03
936500 -- (-356.002) [-356.453] (-357.423) (-359.154) * (-356.988) [-355.853] (-357.724) (-355.851) -- 0:00:03
937000 -- (-355.882) (-357.498) (-355.639) [-356.888] * (-356.997) (-358.094) (-357.415) [-356.130] -- 0:00:03
937500 -- [-358.082] (-358.432) (-355.977) (-355.067) * [-358.026] (-359.091) (-359.087) (-356.672) -- 0:00:03
938000 -- (-356.758) [-356.193] (-356.705) (-356.029) * (-357.420) (-357.204) [-361.730] (-358.259) -- 0:00:03
938500 -- (-356.081) (-360.619) (-356.775) [-357.812] * (-357.474) (-356.404) (-356.761) [-356.253] -- 0:00:03
939000 -- (-358.824) (-359.303) (-360.620) [-355.724] * (-356.267) [-356.512] (-358.806) (-357.473) -- 0:00:03
939500 -- [-356.201] (-356.779) (-356.731) (-356.220) * [-358.237] (-358.665) (-355.373) (-359.347) -- 0:00:03
940000 -- (-355.944) (-358.335) (-357.027) [-356.193] * (-358.396) (-357.515) (-355.601) [-359.015] -- 0:00:03
Average standard deviation of split frequencies: 0.005847
940500 -- (-355.458) (-356.442) (-359.681) [-358.067] * [-366.216] (-355.737) (-358.479) (-360.187) -- 0:00:03
941000 -- (-358.342) [-360.584] (-357.103) (-360.960) * (-357.975) [-355.834] (-355.878) (-360.588) -- 0:00:03
941500 -- (-358.729) (-358.784) (-358.953) [-358.663] * (-358.274) (-360.778) [-357.642] (-356.611) -- 0:00:03
942000 -- [-358.461] (-357.044) (-355.913) (-356.173) * [-355.805] (-357.009) (-360.461) (-356.592) -- 0:00:03
942500 -- [-355.414] (-356.549) (-356.966) (-356.065) * (-356.628) [-357.412] (-360.941) (-356.697) -- 0:00:03
943000 -- (-357.645) (-358.235) [-357.066] (-359.269) * [-356.837] (-356.361) (-357.124) (-361.659) -- 0:00:03
943500 -- (-361.603) (-356.295) (-360.813) [-355.972] * [-355.404] (-355.734) (-356.540) (-363.313) -- 0:00:03
944000 -- [-358.631] (-357.117) (-359.111) (-360.517) * (-357.108) (-356.195) [-356.359] (-357.003) -- 0:00:03
944500 -- (-358.482) (-355.961) [-356.032] (-357.093) * (-358.226) (-355.632) (-356.351) [-358.037] -- 0:00:03
945000 -- (-363.773) (-358.777) [-358.241] (-362.106) * [-359.837] (-355.947) (-357.064) (-364.322) -- 0:00:03
Average standard deviation of split frequencies: 0.005648
945500 -- (-357.055) [-355.745] (-357.501) (-359.336) * (-356.376) (-357.699) [-356.573] (-356.202) -- 0:00:03
946000 -- (-357.727) (-357.503) (-357.971) [-357.434] * (-358.448) [-357.749] (-357.584) (-356.741) -- 0:00:03
946500 -- (-357.171) (-360.534) [-356.922] (-359.418) * (-356.160) (-357.155) [-357.049] (-361.336) -- 0:00:03
947000 -- [-358.127] (-357.190) (-356.773) (-357.320) * [-359.821] (-357.757) (-357.464) (-358.447) -- 0:00:03
947500 -- (-356.263) (-359.845) (-356.826) [-356.195] * (-356.922) (-356.994) [-357.490] (-360.196) -- 0:00:03
948000 -- (-357.460) (-361.204) (-357.389) [-356.924] * (-357.570) (-356.399) (-355.516) [-358.696] -- 0:00:03
948500 -- (-359.689) (-360.254) (-358.079) [-356.088] * (-357.279) (-360.112) [-355.921] (-356.794) -- 0:00:03
949000 -- (-356.968) (-357.822) (-357.910) [-357.411] * (-358.462) (-356.121) [-355.467] (-363.537) -- 0:00:03
949500 -- (-357.955) (-356.875) [-357.543] (-360.548) * (-363.793) [-358.904] (-355.903) (-361.060) -- 0:00:03
950000 -- [-355.624] (-356.802) (-357.659) (-355.442) * (-362.599) (-356.523) [-358.312] (-360.836) -- 0:00:03
Average standard deviation of split frequencies: 0.005455
950500 -- (-355.897) (-356.061) [-356.497] (-358.977) * (-356.785) (-355.910) [-358.229] (-355.893) -- 0:00:02
951000 -- (-358.156) [-355.935] (-359.150) (-359.194) * [-356.179] (-358.535) (-356.657) (-356.127) -- 0:00:02
951500 -- (-358.514) (-358.605) (-360.638) [-358.664] * (-357.080) [-356.852] (-357.129) (-357.382) -- 0:00:02
952000 -- (-357.687) (-356.747) (-357.942) [-355.472] * (-356.100) [-356.518] (-360.670) (-362.307) -- 0:00:02
952500 -- (-356.518) (-356.355) (-355.581) [-356.283] * [-357.625] (-356.086) (-361.362) (-360.598) -- 0:00:02
953000 -- [-356.231] (-356.835) (-355.513) (-356.288) * (-358.480) (-356.964) [-355.618] (-359.342) -- 0:00:02
953500 -- [-357.763] (-357.063) (-360.895) (-355.248) * (-356.732) [-359.359] (-358.750) (-357.175) -- 0:00:02
954000 -- (-357.165) [-356.076] (-361.282) (-357.300) * (-355.612) (-357.363) [-355.378] (-355.494) -- 0:00:02
954500 -- (-356.743) (-356.191) (-358.136) [-361.706] * (-361.082) [-357.213] (-355.745) (-357.274) -- 0:00:02
955000 -- (-356.794) (-356.148) [-357.569] (-360.103) * [-358.816] (-358.823) (-355.834) (-356.477) -- 0:00:02
Average standard deviation of split frequencies: 0.005486
955500 -- (-359.738) [-356.845] (-356.854) (-358.894) * (-358.922) (-360.588) [-356.861] (-356.758) -- 0:00:02
956000 -- [-356.436] (-358.916) (-358.954) (-355.171) * (-357.141) [-358.031] (-360.973) (-355.625) -- 0:00:02
956500 -- (-357.987) (-361.378) (-357.592) [-356.189] * [-357.837] (-368.758) (-356.603) (-356.688) -- 0:00:02
957000 -- (-358.356) (-358.503) (-361.029) [-356.924] * [-356.087] (-360.822) (-359.176) (-355.581) -- 0:00:02
957500 -- [-357.649] (-357.094) (-359.801) (-358.972) * (-357.196) (-364.757) (-356.191) [-356.928] -- 0:00:02
958000 -- (-356.296) [-355.574] (-356.880) (-360.976) * (-358.786) (-357.346) (-357.193) [-355.724] -- 0:00:02
958500 -- [-356.350] (-355.424) (-357.249) (-358.983) * [-356.886] (-355.803) (-357.269) (-359.661) -- 0:00:02
959000 -- (-357.416) (-359.792) (-356.521) [-357.287] * (-356.143) [-356.063] (-359.144) (-359.343) -- 0:00:02
959500 -- (-360.563) [-361.039] (-359.472) (-356.090) * [-359.771] (-355.335) (-355.439) (-364.228) -- 0:00:02
960000 -- [-356.222] (-360.496) (-358.010) (-357.945) * (-355.829) [-357.014] (-356.257) (-356.877) -- 0:00:02
Average standard deviation of split frequencies: 0.005398
960500 -- (-357.897) (-355.318) (-358.174) [-358.572] * [-357.407] (-356.675) (-356.744) (-355.758) -- 0:00:02
961000 -- (-357.525) [-356.544] (-357.608) (-356.315) * (-356.742) (-358.077) (-357.325) [-355.559] -- 0:00:02
961500 -- (-361.641) (-357.426) [-357.173] (-356.090) * (-356.671) (-355.443) [-355.107] (-356.017) -- 0:00:02
962000 -- (-359.353) (-356.225) [-356.719] (-356.518) * [-358.707] (-358.576) (-355.840) (-356.975) -- 0:00:02
962500 -- [-357.926] (-358.520) (-356.570) (-356.741) * (-355.980) (-356.546) (-355.731) [-358.285] -- 0:00:02
963000 -- (-358.547) [-356.183] (-358.025) (-359.147) * [-355.641] (-356.641) (-356.992) (-358.085) -- 0:00:02
963500 -- (-363.078) [-355.660] (-355.777) (-357.414) * (-356.577) [-357.650] (-358.036) (-361.360) -- 0:00:02
964000 -- (-356.816) [-356.241] (-357.535) (-358.617) * (-356.183) (-356.343) (-358.211) [-356.869] -- 0:00:02
964500 -- (-356.849) (-356.216) [-356.218] (-356.874) * (-355.504) (-356.917) (-358.265) [-359.932] -- 0:00:02
965000 -- (-356.311) (-359.833) (-357.308) [-357.218] * (-355.233) [-356.338] (-356.859) (-358.003) -- 0:00:02
Average standard deviation of split frequencies: 0.005429
965500 -- [-358.909] (-357.184) (-357.526) (-357.355) * (-356.738) (-358.960) [-356.736] (-358.537) -- 0:00:02
966000 -- [-356.686] (-356.120) (-359.850) (-365.431) * [-358.729] (-357.690) (-355.609) (-357.072) -- 0:00:02
966500 -- [-359.540] (-356.138) (-358.288) (-355.481) * (-362.723) (-357.989) [-360.246] (-357.110) -- 0:00:02
967000 -- (-356.687) (-356.498) [-358.815] (-356.178) * (-358.417) [-355.958] (-358.312) (-356.270) -- 0:00:01
967500 -- (-356.907) (-356.205) (-360.686) [-356.925] * (-355.908) (-360.139) [-357.759] (-357.059) -- 0:00:01
968000 -- (-357.180) [-356.390] (-357.023) (-356.137) * (-356.810) [-357.495] (-356.491) (-359.299) -- 0:00:01
968500 -- (-361.109) [-355.803] (-359.897) (-356.780) * (-356.821) (-358.091) (-357.684) [-356.248] -- 0:00:01
969000 -- (-356.668) (-355.398) [-355.754] (-362.982) * (-356.570) (-357.800) (-357.386) [-356.972] -- 0:00:01
969500 -- (-357.060) (-356.813) [-357.381] (-356.178) * [-357.495] (-357.352) (-355.890) (-356.394) -- 0:00:01
970000 -- (-356.488) (-359.553) (-357.902) [-355.966] * (-358.328) [-356.628] (-355.974) (-355.485) -- 0:00:01
Average standard deviation of split frequencies: 0.005342
970500 -- (-358.638) [-356.425] (-365.602) (-359.912) * (-356.724) (-355.172) [-356.636] (-357.225) -- 0:00:01
971000 -- (-358.066) (-357.688) (-356.126) [-356.298] * [-356.696] (-356.429) (-356.426) (-358.863) -- 0:00:01
971500 -- [-357.302] (-356.904) (-358.064) (-357.242) * (-356.808) (-358.525) [-359.213] (-356.502) -- 0:00:01
972000 -- (-355.712) [-359.091] (-358.794) (-358.718) * (-359.663) [-356.558] (-358.888) (-360.538) -- 0:00:01
972500 -- [-356.914] (-356.024) (-358.885) (-358.279) * (-359.965) (-358.910) [-361.141] (-359.700) -- 0:00:01
973000 -- (-356.742) (-355.402) [-355.780] (-359.332) * (-358.475) (-360.657) [-355.969] (-360.095) -- 0:00:01
973500 -- (-357.468) [-355.843] (-357.940) (-357.516) * (-356.612) (-357.001) [-358.887] (-358.570) -- 0:00:01
974000 -- (-357.810) [-356.884] (-361.489) (-357.752) * (-356.308) (-356.972) (-357.794) [-356.024] -- 0:00:01
974500 -- [-357.093] (-357.727) (-359.768) (-357.317) * [-356.819] (-369.566) (-359.294) (-355.680) -- 0:00:01
975000 -- (-359.258) (-358.704) (-358.667) [-358.404] * (-356.335) (-360.433) (-362.006) [-355.586] -- 0:00:01
Average standard deviation of split frequencies: 0.005373
975500 -- [-363.498] (-357.692) (-356.614) (-357.967) * [-356.309] (-357.688) (-363.879) (-361.429) -- 0:00:01
976000 -- [-358.136] (-360.933) (-359.525) (-357.411) * (-357.154) (-355.974) [-357.397] (-356.774) -- 0:00:01
976500 -- [-360.850] (-360.357) (-355.944) (-355.759) * (-358.365) (-357.114) (-360.101) [-355.848] -- 0:00:01
977000 -- (-357.559) (-364.196) (-359.327) [-359.503] * (-356.284) (-355.619) (-359.397) [-355.745] -- 0:00:01
977500 -- (-357.499) (-362.433) (-364.721) [-356.693] * [-356.268] (-357.027) (-355.356) (-357.947) -- 0:00:01
978000 -- (-358.142) (-355.230) (-358.362) [-357.798] * (-358.502) [-357.707] (-356.622) (-356.604) -- 0:00:01
978500 -- (-356.889) (-361.155) [-356.811] (-358.330) * [-355.289] (-355.920) (-357.048) (-358.150) -- 0:00:01
979000 -- (-358.871) (-358.105) [-356.445] (-358.002) * [-358.201] (-358.221) (-355.503) (-357.172) -- 0:00:01
979500 -- (-357.230) (-359.118) [-361.321] (-356.122) * (-358.363) (-366.288) (-355.148) [-359.480] -- 0:00:01
980000 -- [-361.648] (-358.404) (-355.254) (-360.192) * (-358.220) [-358.485] (-356.194) (-359.929) -- 0:00:01
Average standard deviation of split frequencies: 0.005192
980500 -- (-359.603) [-356.900] (-357.774) (-360.361) * [-356.891] (-358.316) (-356.260) (-355.402) -- 0:00:01
981000 -- (-357.489) (-355.677) (-359.680) [-357.939] * [-357.693] (-359.556) (-357.883) (-357.155) -- 0:00:01
981500 -- (-361.007) (-356.188) [-357.403] (-359.174) * (-359.310) (-357.580) (-356.906) [-355.497] -- 0:00:01
982000 -- (-358.704) (-355.587) [-358.271] (-358.197) * [-359.652] (-358.012) (-358.460) (-360.031) -- 0:00:01
982500 -- (-358.883) (-355.263) [-360.555] (-358.670) * (-357.989) (-356.534) (-358.167) [-357.865] -- 0:00:01
983000 -- (-360.269) (-355.672) (-362.858) [-356.030] * (-359.118) (-357.445) [-359.129] (-357.914) -- 0:00:01
983500 -- [-356.658] (-357.274) (-361.302) (-355.758) * (-358.492) (-358.302) [-357.739] (-355.485) -- 0:00:00
984000 -- [-356.540] (-356.710) (-356.236) (-359.479) * (-355.936) (-360.676) (-355.563) [-356.840] -- 0:00:00
984500 -- (-356.215) (-356.212) [-356.061] (-355.643) * (-358.330) [-361.612] (-357.079) (-359.210) -- 0:00:00
985000 -- (-359.161) [-355.434] (-357.206) (-356.016) * (-362.069) [-358.185] (-361.504) (-356.903) -- 0:00:00
Average standard deviation of split frequencies: 0.005068
985500 -- [-357.864] (-361.677) (-356.800) (-355.749) * [-356.348] (-356.234) (-358.801) (-359.776) -- 0:00:00
986000 -- (-357.585) (-355.996) (-355.310) [-355.814] * (-358.545) (-357.067) [-356.532] (-358.161) -- 0:00:00
986500 -- (-359.925) (-360.709) [-355.432] (-357.501) * (-355.856) (-356.520) [-356.345] (-357.403) -- 0:00:00
987000 -- (-355.278) (-358.438) (-359.335) [-357.110] * [-357.510] (-364.253) (-357.282) (-356.330) -- 0:00:00
987500 -- (-358.299) (-359.372) (-358.143) [-358.063] * (-357.515) (-357.310) (-359.048) [-355.543] -- 0:00:00
988000 -- (-357.471) (-356.417) [-355.529] (-357.577) * (-362.074) (-356.689) [-356.046] (-360.522) -- 0:00:00
988500 -- (-355.510) (-356.889) [-357.276] (-356.930) * (-362.316) (-356.519) (-357.746) [-355.719] -- 0:00:00
989000 -- (-357.267) (-357.046) [-356.001] (-359.382) * [-355.479] (-356.868) (-355.582) (-356.949) -- 0:00:00
989500 -- (-360.473) [-355.992] (-356.229) (-358.430) * (-356.157) (-359.759) [-357.121] (-359.426) -- 0:00:00
990000 -- (-355.507) (-355.858) [-357.014] (-356.737) * (-358.343) [-357.943] (-360.199) (-361.979) -- 0:00:00
Average standard deviation of split frequencies: 0.004790
990500 -- (-359.601) (-358.110) [-358.751] (-357.865) * (-356.515) (-355.850) (-359.554) [-357.928] -- 0:00:00
991000 -- [-356.260] (-355.553) (-357.506) (-356.637) * (-356.953) [-355.554] (-357.851) (-356.265) -- 0:00:00
991500 -- (-358.494) [-357.713] (-359.552) (-356.715) * [-356.709] (-354.912) (-355.626) (-356.213) -- 0:00:00
992000 -- (-355.842) (-357.127) [-355.842] (-356.721) * (-359.343) [-356.148] (-356.132) (-356.024) -- 0:00:00
992500 -- (-359.182) [-355.923] (-356.689) (-355.578) * (-359.600) [-357.596] (-356.329) (-356.015) -- 0:00:00
993000 -- (-355.483) (-358.861) [-358.411] (-356.054) * (-356.763) [-357.028] (-355.558) (-357.144) -- 0:00:00
993500 -- (-356.220) (-357.704) (-357.355) [-358.741] * (-361.305) (-358.190) (-356.996) [-355.893] -- 0:00:00
994000 -- (-357.961) (-358.611) (-357.417) [-356.871] * [-356.054] (-362.641) (-356.476) (-360.547) -- 0:00:00
994500 -- (-361.156) (-357.549) [-357.559] (-361.141) * (-356.520) (-358.818) [-356.796] (-359.760) -- 0:00:00
995000 -- (-357.879) (-357.112) [-359.078] (-356.679) * (-356.272) (-356.512) [-356.218] (-356.114) -- 0:00:00
Average standard deviation of split frequencies: 0.004323
995500 -- (-356.190) (-357.244) (-356.209) [-359.373] * [-355.941] (-355.755) (-361.387) (-358.497) -- 0:00:00
996000 -- [-356.198] (-357.838) (-359.631) (-358.162) * (-359.945) (-357.326) (-359.751) [-358.467] -- 0:00:00
996500 -- (-363.055) [-360.617] (-359.756) (-356.016) * (-356.683) (-359.062) (-358.729) [-357.378] -- 0:00:00
997000 -- [-356.104] (-356.323) (-356.491) (-359.447) * (-357.694) (-357.086) (-356.784) [-358.680] -- 0:00:00
997500 -- (-362.149) (-358.081) (-355.804) [-358.663] * (-368.690) [-356.160] (-355.987) (-358.420) -- 0:00:00
998000 -- (-357.017) (-356.774) [-355.346] (-357.696) * (-358.406) (-357.372) (-361.646) [-357.912] -- 0:00:00
998500 -- (-356.643) (-355.480) (-360.208) [-355.484] * (-360.161) (-356.730) [-358.917] (-358.718) -- 0:00:00
999000 -- (-356.802) [-355.913] (-358.023) (-358.975) * [-359.141] (-358.490) (-356.387) (-357.080) -- 0:00:00
999500 -- (-356.022) (-357.855) (-361.739) [-357.296] * (-356.750) [-360.790] (-356.418) (-357.950) -- 0:00:00
1000000 -- [-358.768] (-355.903) (-356.031) (-356.892) * (-360.283) [-356.672] (-355.385) (-358.885) -- 0:00:00
Average standard deviation of split frequencies: 0.004522
Analysis completed in 60 seconds
Analysis used 59.10 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -354.86
Likelihood of best state for "cold" chain of run 2 was -354.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 80 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
42.2 % ( 30 %) Dirichlet(Pi{all})
41.2 % ( 24 %) Slider(Pi{all})
78.0 % ( 56 %) Multiplier(Alpha{1,2})
77.2 % ( 42 %) Multiplier(Alpha{3})
26.4 % ( 33 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.3 % ( 38 %) Dirichlet(Pi{all})
40.6 % ( 23 %) Slider(Pi{all})
78.8 % ( 51 %) Multiplier(Alpha{1,2})
77.5 % ( 50 %) Multiplier(Alpha{3})
26.3 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.3 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166195 0.82 0.67
3 | 166551 167145 0.84
4 | 167080 166943 166086
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166128 0.82 0.67
3 | 166566 166848 0.83
4 | 166906 166904 166648
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -356.40
| 2 |
| 2 |
| |
| 2 |
|2 * 2 1 2 1 |
| 2 * 22 * * 1 2 2 2 1 12 * 2|
| 1 1 2 2 1* 1 2 12 2 1 2 1 1|
| 2 212 1 1 11 1 1*12 111 2 *1 2 |
| 1 1 12 2 2 1 2 22 2 1 2 1 2 |
| * 2 1 1 1 1 1 21 2 2 2 |
|12 1 1 1 2 2 1 |
| *2 2 1 2 1 1 1 2 |
| 2 * 1 |
| 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -358.28
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -356.62 -361.26
2 -356.57 -360.04
--------------------------------------
TOTAL -356.59 -360.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885228 0.085431 0.385187 1.493255 0.853211 1501.00 1501.00 1.000
r(A<->C){all} 0.158493 0.017841 0.000080 0.429489 0.123165 304.55 354.31 1.001
r(A<->G){all} 0.156002 0.018618 0.000197 0.439065 0.117447 206.07 274.71 1.000
r(A<->T){all} 0.174896 0.020630 0.000057 0.453689 0.138155 257.66 328.14 1.003
r(C<->G){all} 0.163653 0.019526 0.000071 0.444154 0.126869 255.62 276.75 1.000
r(C<->T){all} 0.182090 0.024222 0.000092 0.497435 0.138147 142.35 258.11 1.004
r(G<->T){all} 0.164867 0.020379 0.000017 0.448379 0.126474 172.98 237.65 1.000
pi(A){all} 0.189882 0.000599 0.141059 0.235792 0.188966 1134.43 1317.71 1.000
pi(C){all} 0.270857 0.000782 0.216007 0.323805 0.270466 1204.39 1273.18 1.000
pi(G){all} 0.283241 0.000775 0.227869 0.337128 0.283218 1218.91 1340.88 1.000
pi(T){all} 0.256020 0.000731 0.202441 0.306483 0.255007 1039.08 1230.79 1.000
alpha{1,2} 0.433022 0.243669 0.000231 1.438575 0.263115 1284.70 1365.96 1.002
alpha{3} 0.462530 0.249248 0.000167 1.472590 0.290537 1051.11 1276.06 1.000
pinvar{all} 0.993801 0.000056 0.980018 0.999998 0.996230 1401.35 1437.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*..*.
9 -- .****.
10 -- ...**.
11 -- .**...
12 -- .***.*
13 -- .**.**
14 -- ...*.*
15 -- .*...*
16 -- ..****
17 -- ..**..
18 -- .*.***
19 -- ..*.*.
20 -- ....**
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.004711 0.147235 0.153897 2
8 450 0.149900 0.016017 0.138574 0.161226 2
9 446 0.148568 0.003769 0.145903 0.151233 2
10 445 0.148235 0.002355 0.146569 0.149900 2
11 440 0.146569 0.000942 0.145903 0.147235 2
12 439 0.146236 0.004240 0.143238 0.149234 2
13 436 0.145237 0.001884 0.143904 0.146569 2
14 433 0.144237 0.010835 0.136576 0.151899 2
15 430 0.143238 0.005653 0.139241 0.147235 2
16 429 0.142905 0.000471 0.142572 0.143238 2
17 416 0.138574 0.001884 0.137242 0.139907 2
18 415 0.138241 0.006124 0.133911 0.142572 2
19 411 0.136909 0.002355 0.135243 0.138574 2
20 390 0.129913 0.002827 0.127915 0.131912 2
21 386 0.128581 0.003769 0.125916 0.131246 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098541 0.009246 0.000021 0.292395 0.069457 1.000 2
length{all}[2] 0.098590 0.009913 0.000003 0.300751 0.069487 1.000 2
length{all}[3] 0.101365 0.010281 0.000005 0.304906 0.070303 1.000 2
length{all}[4] 0.099800 0.009811 0.000079 0.297696 0.069389 1.000 2
length{all}[5] 0.098058 0.009743 0.000012 0.291189 0.068071 1.000 2
length{all}[6] 0.099057 0.009216 0.000020 0.302685 0.071464 1.000 2
length{all}[7] 0.104664 0.010571 0.000477 0.276290 0.077829 0.998 2
length{all}[8] 0.091990 0.009680 0.000464 0.299972 0.062711 1.000 2
length{all}[9] 0.096029 0.009310 0.000008 0.277883 0.066451 1.010 2
length{all}[10] 0.096275 0.009018 0.000102 0.295835 0.068951 0.999 2
length{all}[11] 0.091086 0.007457 0.000118 0.263752 0.062386 0.998 2
length{all}[12] 0.103257 0.011831 0.000479 0.288520 0.073146 0.999 2
length{all}[13] 0.090337 0.007636 0.000005 0.257073 0.063769 0.999 2
length{all}[14] 0.093911 0.007932 0.000025 0.264010 0.071849 1.001 2
length{all}[15] 0.094675 0.008168 0.000035 0.278561 0.069525 0.999 2
length{all}[16] 0.096534 0.009185 0.000190 0.300032 0.062849 1.008 2
length{all}[17] 0.096036 0.008657 0.000095 0.276286 0.069099 1.002 2
length{all}[18] 0.096043 0.010205 0.000179 0.308336 0.062742 0.999 2
length{all}[19] 0.096066 0.009008 0.000554 0.308076 0.065529 1.005 2
length{all}[20] 0.093774 0.008625 0.000201 0.279598 0.062679 0.999 2
length{all}[21] 0.095839 0.010076 0.000975 0.294262 0.055963 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004522
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 258
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 86 / 86 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 86 / 86 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042672 0.013574 0.046952 0.056614 0.021614 0.093850 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -368.838222
Iterating by ming2
Initial: fx= 368.838222
x= 0.04267 0.01357 0.04695 0.05661 0.02161 0.09385 0.30000 1.30000
1 h-m-p 0.0000 0.0002 208.6062 ++ 361.933871 m 0.0002 13 | 1/8
2 h-m-p 0.0014 0.0754 21.0254 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 190.6550 ++ 358.513645 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0898 18.0420 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 170.5359 +++ 351.313921 m 0.0002 76 | 3/8
6 h-m-p 0.0024 0.1108 15.0762 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 148.0652 ++ 350.211428 m 0.0001 108 | 4/8
8 h-m-p 0.0005 0.1460 11.9189 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 120.7898 ++ 348.551736 m 0.0001 139 | 5/8
10 h-m-p 0.0012 0.2204 8.1263 -----------.. | 5/8
11 h-m-p 0.0000 0.0004 85.2816 +++ 345.335864 m 0.0004 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 345.335864 m 8.0000 182 | 6/8
13 h-m-p 0.0653 8.0000 0.0005 ++++ 345.335864 m 8.0000 197 | 6/8
14 h-m-p 0.0160 8.0000 3.5102 +++++ 345.335837 m 8.0000 213 | 6/8
15 h-m-p 1.6000 8.0000 2.0618 ++ 345.335835 m 8.0000 224 | 6/8
16 h-m-p 1.3025 8.0000 12.6638 ++ 345.335830 m 8.0000 235 | 6/8
17 h-m-p 1.6000 8.0000 24.3181 ++ 345.335829 m 8.0000 246 | 6/8
18 h-m-p 1.6000 8.0000 6.4863 ++ 345.335829 m 8.0000 257 | 6/8
19 h-m-p 1.6000 8.0000 30.0258 ----------------.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 -------C 345.335829 0 0.0000 300
Out..
lnL = -345.335829
301 lfun, 301 eigenQcodon, 1806 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032134 0.089410 0.045849 0.076124 0.049690 0.090352 386.004022 0.567614 0.123859
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.071586
np = 9
lnL0 = -376.323954
Iterating by ming2
Initial: fx= 376.323954
x= 0.03213 0.08941 0.04585 0.07612 0.04969 0.09035 386.00402 0.56761 0.12386
1 h-m-p 0.0000 0.0004 186.7975 +++ 361.450684 m 0.0004 15 | 1/9
2 h-m-p 0.0003 0.0014 71.4976 ++ 355.556459 m 0.0014 27 | 2/9
3 h-m-p 0.0000 0.0000 27768.3358 ++ 354.176572 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 16554.1216 ++ 354.092924 m 0.0000 51 | 4/9
5 h-m-p 0.0001 0.0182 9.0634 ---------.. | 4/9
6 h-m-p 0.0000 0.0003 140.4876 +++ 347.697290 m 0.0003 83 | 5/9
7 h-m-p 0.0107 0.1217 3.3975 -------------.. | 5/9
8 h-m-p 0.0000 0.0002 119.6051 ++ 345.418193 m 0.0002 118 | 6/9
9 h-m-p 0.0077 0.3751 1.7345 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 86.1341 ++ 345.335874 m 0.0000 153 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 Y 345.335874 0 1.6000 165 | 6/9
12 h-m-p 0.0160 8.0000 0.0882 +++++ 345.335861 m 8.0000 182 | 6/9
13 h-m-p 0.1534 0.7669 0.7264 ++ 345.335855 m 0.7669 197 | 7/9
14 h-m-p 1.6000 8.0000 0.0004 -Y 345.335855 0 0.0134 213 | 7/9
15 h-m-p 0.5643 8.0000 0.0000 ---------C 345.335855 0 0.0000 236
Out..
lnL = -345.335855
237 lfun, 711 eigenQcodon, 2844 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090597 0.095594 0.016787 0.064587 0.107380 0.068893 387.117344 1.330879 0.232470 0.164768 82.753134
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.004769
np = 11
lnL0 = -360.290144
Iterating by ming2
Initial: fx= 360.290144
x= 0.09060 0.09559 0.01679 0.06459 0.10738 0.06889 387.11734 1.33088 0.23247 0.16477 82.75313
1 h-m-p 0.0000 0.0011 32.9675 ++++ 358.896198 m 0.0011 18 | 1/11
2 h-m-p 0.0033 0.0493 10.0949 ++ 354.842105 m 0.0493 32 | 2/11
3 h-m-p 0.0005 0.0023 59.4689 ++ 353.585368 m 0.0023 46 | 3/11
4 h-m-p 0.0011 0.0053 39.2204 ++ 353.195581 m 0.0053 60 | 4/11
5 h-m-p 0.0003 0.0015 18.2409 ++ 352.855860 m 0.0015 74 | 5/11
6 h-m-p 0.0034 0.0698 6.0400 +++ 350.721722 m 0.0698 89 | 6/11
7 h-m-p 0.0033 0.0163 30.1643 ++ 345.335833 m 0.0163 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 --Y 345.335833 0 0.0085 119 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 345.335833 m 8.0000 140 | 7/11
10 h-m-p 0.0160 8.0000 4.3281 ++Y 345.335831 0 0.5006 160 | 7/11
11 h-m-p 1.6000 8.0000 0.1126 Y 345.335831 0 2.7255 174 | 7/11
12 h-m-p 1.6000 8.0000 0.0184 C 345.335831 0 0.6357 192 | 7/11
13 h-m-p 1.6000 8.0000 0.0008 Y 345.335831 0 0.3015 210 | 7/11
14 h-m-p 1.6000 8.0000 0.0002 ---------N 345.335831 0 0.0000 237
Out..
lnL = -345.335831
238 lfun, 952 eigenQcodon, 4284 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -345.334197 S = -345.333875 -0.000123
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:03
did 20 / 44 patterns 0:03
did 30 / 44 patterns 0:03
did 40 / 44 patterns 0:03
did 44 / 44 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082333 0.071901 0.057623 0.075060 0.031293 0.071654 387.116735 0.834276 1.820516
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.088885
np = 9
lnL0 = -377.704711
Iterating by ming2
Initial: fx= 377.704711
x= 0.08233 0.07190 0.05762 0.07506 0.03129 0.07165 387.11674 0.83428 1.82052
1 h-m-p 0.0000 0.0004 195.8614 +++ 362.720309 m 0.0004 15 | 1/9
2 h-m-p 0.0097 0.1344 7.0560 -------------.. | 1/9
3 h-m-p 0.0000 0.0003 184.6782 +++ 351.577311 m 0.0003 51 | 2/9
4 h-m-p 0.0176 0.5613 3.0217 -------------.. | 2/9
5 h-m-p 0.0000 0.0002 169.7419 +++ 346.624087 m 0.0002 87 | 3/9
6 h-m-p 0.0098 1.3194 2.5682 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 149.0550 ++ 346.557636 m 0.0000 122 | 4/9
8 h-m-p 0.0033 1.6669 2.6576 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 121.5626 ++ 345.991477 m 0.0000 156 | 5/9
10 h-m-p 0.0046 2.2861 2.0444 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 85.9917 ++ 345.335880 m 0.0001 190 | 6/9
12 h-m-p 0.6592 8.0000 0.0000 ++ 345.335880 m 8.0000 202 | 6/9
13 h-m-p 0.2729 8.0000 0.0000 +++ 345.335880 m 8.0000 218 | 6/9
14 h-m-p 0.0160 8.0000 0.0549 +++++ 345.335879 m 8.0000 236 | 6/9
15 h-m-p 0.4571 8.0000 0.9605 +++ 345.335878 m 8.0000 252 | 6/9
16 h-m-p 1.6000 8.0000 0.5504 ++ 345.335878 m 8.0000 267 | 6/9
17 h-m-p 1.0376 8.0000 4.2436 ++ 345.335878 m 8.0000 282 | 6/9
18 h-m-p 0.0887 0.4433 109.0196 -------C 345.335878 0 0.0000 301 | 6/9
19 h-m-p 1.6000 8.0000 0.0000 ++ 345.335878 m 8.0000 313 | 6/9
20 h-m-p 1.6000 8.0000 0.0000 -----------N 345.335878 0 0.0000 339
Out..
lnL = -345.335878
340 lfun, 3740 eigenQcodon, 20400 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030927 0.090509 0.091358 0.037032 0.072651 0.083077 387.095009 0.900000 0.952895 1.673037 73.076523
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.008519
np = 11
lnL0 = -356.986077
Iterating by ming2
Initial: fx= 356.986077
x= 0.03093 0.09051 0.09136 0.03703 0.07265 0.08308 387.09501 0.90000 0.95289 1.67304 73.07652
1 h-m-p 0.0000 0.0024 50.7063 +++CYYCCC 354.260929 5 0.0015 28 | 0/11
2 h-m-p 0.0001 0.0003 101.1990 ++ 353.118439 m 0.0003 42 | 1/11
3 h-m-p 0.0065 0.0616 3.7919 YCCC 353.011467 3 0.0152 61 | 1/11
4 h-m-p 0.0051 0.0256 8.3584 ++ 352.454325 m 0.0256 75 | 2/11
5 h-m-p 0.0001 0.0007 397.3181 ++ 350.443982 m 0.0007 89 | 3/11
6 h-m-p 0.0002 0.0011 240.0033 ++ 347.797978 m 0.0011 103 | 4/11
7 h-m-p 0.0007 0.0036 17.7381 ++ 347.154270 m 0.0036 117 | 5/11
8 h-m-p 0.0008 0.0112 66.6772 ++ 346.654970 m 0.0112 131 | 5/11
9 h-m-p 0.0769 0.5156 9.6923 --------------.. | 5/11
10 h-m-p 0.0000 0.0002 157.5955 +++ 345.335845 m 0.0002 172 | 6/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 345.335845 m 8.0000 186 | 6/11
12 h-m-p 0.0160 8.0000 0.0021 +++++ 345.335845 m 8.0000 208 | 6/11
13 h-m-p 0.0432 8.0000 0.3799 ++++ 345.335832 m 8.0000 229 | 6/11
14 h-m-p 1.6000 8.0000 0.1496 ++ 345.335831 m 8.0000 248 | 6/11
15 h-m-p 0.6780 8.0000 1.7649 ++ 345.335829 m 8.0000 267 | 6/11
16 h-m-p 1.6000 8.0000 1.3140 ++ 345.335829 m 8.0000 281 | 6/11
17 h-m-p 0.2226 1.1129 2.1472 ++ 345.335829 m 1.1129 295 | 7/11
18 h-m-p 0.0016 0.0180 1510.0353 +
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
+ 345.335829 m 0.0180 309
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37886, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37884, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
19 h-m-p 0.1964 0.9819 59.5979 ------
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37775, 0.00504) = 1.000000e+00 2000 rounds
C 345.335829 0 0.0000 329
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37815, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
| 7/11
20 h-m-p 1.1467 8.0000 0.0006
QuantileBeta(0.85, 58.37794, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37808, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37811, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
-..
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37899, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37726, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
| 7/11
21 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
C 345.335829 0 0.0040 375
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
Out..
lnL = -345.335829
376 lfun, 4512 eigenQcodon, 24816 P(t)
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -345.333903 S = -345.333819 -0.000037
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:16
did 20 / 44 patterns 0:16
did 30 / 44 patterns 0:16
did 40 / 44 patterns 0:16
did 44 / 44 patterns 0:16
QuantileBeta(0.85, 58.37812, 0.00503) = 1.000000e+00 2000 rounds
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=86
NC_011896_1_WP_010908426_1_1698_MLBR_RS08040 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NC_002677_1_NP_302105_1_977_ML1603 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
**************************************************
NC_011896_1_WP_010908426_1_1698_MLBR_RS08040 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
NC_002677_1_NP_302105_1_977_ML1603 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005 NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
************************************
>NC_011896_1_WP_010908426_1_1698_MLBR_RS08040 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC >NC_002677_1_NP_302105_1_977_ML1603 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC >NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC >NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC >NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC >NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005 GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG CCGATGCC
>NC_011896_1_WP_010908426_1_1698_MLBR_RS08040 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA >NC_002677_1_NP_302105_1_977_ML1603 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA >NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA >NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA >NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA >NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005 VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
#NEXUS
[ID: 5461784637]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908426_1_1698_MLBR_RS08040
NC_002677_1_NP_302105_1_977_ML1603
NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765
NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360
NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795
NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908426_1_1698_MLBR_RS08040,
2 NC_002677_1_NP_302105_1_977_ML1603,
3 NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765,
4 NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360,
5 NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795,
6 NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06945736,2:0.0694866,3:0.07030274,4:0.06938921,5:0.06807091,6:0.07146359);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06945736,2:0.0694866,3:0.07030274,4:0.06938921,5:0.06807091,6:0.07146359);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -356.62 -361.26
2 -356.57 -360.04
--------------------------------------
TOTAL -356.59 -360.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885228 0.085431 0.385187 1.493255 0.853211 1501.00 1501.00 1.000
r(A<->C){all} 0.158493 0.017841 0.000080 0.429489 0.123165 304.55 354.31 1.001
r(A<->G){all} 0.156002 0.018618 0.000197 0.439065 0.117447 206.07 274.71 1.000
r(A<->T){all} 0.174896 0.020630 0.000057 0.453689 0.138155 257.66 328.14 1.003
r(C<->G){all} 0.163653 0.019526 0.000071 0.444154 0.126869 255.62 276.75 1.000
r(C<->T){all} 0.182090 0.024222 0.000092 0.497435 0.138147 142.35 258.11 1.004
r(G<->T){all} 0.164867 0.020379 0.000017 0.448379 0.126474 172.98 237.65 1.000
pi(A){all} 0.189882 0.000599 0.141059 0.235792 0.188966 1134.43 1317.71 1.000
pi(C){all} 0.270857 0.000782 0.216007 0.323805 0.270466 1204.39 1273.18 1.000
pi(G){all} 0.283241 0.000775 0.227869 0.337128 0.283218 1218.91 1340.88 1.000
pi(T){all} 0.256020 0.000731 0.202441 0.306483 0.255007 1039.08 1230.79 1.000
alpha{1,2} 0.433022 0.243669 0.000231 1.438575 0.263115 1284.70 1365.96 1.002
alpha{3} 0.462530 0.249248 0.000167 1.472590 0.290537 1051.11 1276.06 1.000
pinvar{all} 0.993801 0.000056 0.980018 0.999998 0.996230 1401.35 1437.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1603/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 86
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 5 5 5 5 5 5
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 1 1 1 1 1 1 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 4 4 4 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 3 3 3 3 3 3
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908426_1_1698_MLBR_RS08040
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
#2: NC_002677_1_NP_302105_1_977_ML1603
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
#3: NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
#4: NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
#5: NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
#6: NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 12
TTC 18 | TCC 0 | TAC 6 | TGC 30
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 12 | CAC 6 | CGC 0
CTA 0 | CCA 6 | Gln Q CAA 6 | CGA 6
CTG 30 | CCG 6 | CAG 0 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 6
ATC 12 | ACC 6 | AAC 12 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 0
GTC 24 | GCC 24 | GAC 12 | GGC 18
GTA 6 | GCA 6 | Glu E GAA 12 | GGA 0
GTG 18 | GCG 24 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20930 C:0.20930 A:0.22093 G:0.36047
position 2: T:0.32558 C:0.25581 A:0.23256 G:0.18605
position 3: T:0.23256 C:0.34884 A:0.11628 G:0.30233
Average T:0.25581 C:0.27132 A:0.18992 G:0.28295
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -345.335829 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 386.004022 73.076523
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908426_1_1698_MLBR_RS08040: 0.000004, NC_002677_1_NP_302105_1_977_ML1603: 0.000004, NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765: 0.000004, NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360: 0.000004, NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795: 0.000004, NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 386.00402
omega (dN/dS) = 73.07652
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
7..2 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
7..3 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
7..4 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
7..5 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
7..6 0.000 176.3 81.7 73.0765 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -345.335855 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 387.117344 0.000010 0.021467
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908426_1_1698_MLBR_RS08040: 0.000004, NC_002677_1_NP_302105_1_977_ML1603: 0.000004, NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765: 0.000004, NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360: 0.000004, NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795: 0.000004, NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 387.11734
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.02147 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 176.3 81.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -345.335831 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 387.116735 0.264746 0.561244 0.000001 82.552037
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908426_1_1698_MLBR_RS08040: 0.000004, NC_002677_1_NP_302105_1_977_ML1603: 0.000004, NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765: 0.000004, NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360: 0.000004, NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795: 0.000004, NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 387.11674
MLEs of dN/dS (w) for site classes (K=3)
p: 0.26475 0.56124 0.17401
w: 0.00000 1.00000 82.55204
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
7..2 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
7..3 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
7..4 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
7..5 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
7..6 0.000 176.3 81.7 14.9261 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908426_1_1698_MLBR_RS08040)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908426_1_1698_MLBR_RS08040)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -345.335878 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 387.095009 21.584747 43.406446
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908426_1_1698_MLBR_RS08040: 0.000004, NC_002677_1_NP_302105_1_977_ML1603: 0.000004, NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765: 0.000004, NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360: 0.000004, NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795: 0.000004, NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 387.09501
Parameters in M7 (beta):
p = 21.58475 q = 43.40645
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.23971 0.27181 0.29175 0.30810 0.32306 0.33777 0.35320 0.37061 0.39272 0.43045
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
7..2 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
7..3 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
7..4 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
7..5 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
7..6 0.000 176.3 81.7 0.3319 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -345.335829 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 387.116517 0.000010 58.378123 0.005026 76.610014
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908426_1_1698_MLBR_RS08040: 0.000004, NC_002677_1_NP_302105_1_977_ML1603: 0.000004, NZ_LVXE01000006_1_WP_010908426_1_2322_A3216_RS03765: 0.000004, NZ_LYPH01000002_1_WP_010908426_1_291_A8144_RS01360: 0.000004, NZ_CP029543_1_WP_010908426_1_1729_DIJ64_RS08795: 0.000004, NZ_AP014567_1_WP_010908426_1_1771_JK2ML_RS09005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 387.11652
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 58.37812 q = 0.00503
(p1 = 0.99999) w = 76.61001
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 76.61001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
7..2 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
7..3 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
7..4 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
7..5 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
7..6 0.000 176.3 81.7 76.6093 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908426_1_1698_MLBR_RS08040)
Pr(w>1) post mean +- SE for w
1 V 1.000** 76.609
2 P 1.000** 76.609
3 T 1.000** 76.609
4 E 1.000** 76.609
5 K 1.000** 76.609
6 V 1.000** 76.609
7 N 1.000** 76.609
8 P 1.000** 76.609
9 D 1.000** 76.609
10 G 1.000** 76.609
11 V 1.000** 76.609
12 L 1.000** 76.609
13 L 1.000** 76.609
14 V 1.000** 76.609
15 V 1.000** 76.609
16 A 1.000** 76.609
17 D 1.000** 76.609
18 R 1.000** 76.609
19 F 1.000** 76.609
20 T 1.000** 76.609
21 G 1.000** 76.609
22 C 1.000** 76.609
23 E 1.000** 76.609
24 I 1.000** 76.609
25 D 1.000** 76.609
26 L 1.000** 76.609
27 R 1.000** 76.609
28 E 1.000** 76.609
29 F 1.000** 76.609
30 M 1.000** 76.609
31 A 1.000** 76.609
32 D 1.000** 76.609
33 L 1.000** 76.609
34 L 1.000** 76.609
35 L 1.000** 76.609
36 L 1.000** 76.609
37 N 1.000** 76.609
38 G 1.000** 76.609
39 P 1.000** 76.609
40 L 1.000** 76.609
41 Y 1.000** 76.609
42 S 1.000** 76.609
43 G 1.000** 76.609
44 A 1.000** 76.609
45 S 1.000** 76.609
46 Q 1.000** 76.609
47 R 1.000** 76.609
48 L 1.000** 76.609
49 Y 1.000** 76.609
50 C 1.000** 76.609
51 N 1.000** 76.609
52 A 1.000** 76.609
53 L 1.000** 76.609
54 Y 1.000** 76.609
55 C 1.000** 76.609
56 C 1.000** 76.609
57 V 1.000** 76.609
58 H 1.000** 76.609
59 C 1.000** 76.609
60 T 1.000** 76.609
61 C 1.000** 76.609
62 T 1.000** 76.609
63 T 1.000** 76.609
64 A 1.000** 76.609
65 A 1.000** 76.609
66 M 1.000** 76.609
67 P 1.000** 76.609
68 P 1.000** 76.609
69 A 1.000** 76.609
70 A 1.000** 76.609
71 T 1.000** 76.609
72 V 1.000** 76.609
73 C 1.000** 76.609
74 R 1.000** 76.609
75 D 1.000** 76.609
76 K 1.000** 76.609
77 F 1.000** 76.609
78 V 1.000** 76.609
79 M 1.000** 76.609
80 K 1.000** 76.609
81 L 1.000** 76.609
82 I 1.000** 76.609
83 F 1.000** 76.609
84 A 1.000** 76.609
85 D 1.000** 76.609
86 A 1.000** 76.609
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908426_1_1698_MLBR_RS08040)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -345.335855 Model 2: PositiveSelection -345.335831 Model 0: one-ratio -345.335829 Model 7: beta -345.335878 Model 8: beta&w>1 -345.335829 Model 0 vs 1 5.199999998239946E-5 Model 2 vs 1 4.799999999249849E-5 Model 8 vs 7 9.799999997994746E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
