--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:03:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1603/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -356.62          -361.26
2       -356.57          -360.04
--------------------------------------
TOTAL     -356.59          -360.82
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.885228    0.085431    0.385187    1.493255    0.853211   1501.00   1501.00    1.000
r(A<->C){all}   0.158493    0.017841    0.000080    0.429489    0.123165    304.55    354.31    1.001
r(A<->G){all}   0.156002    0.018618    0.000197    0.439065    0.117447    206.07    274.71    1.000
r(A<->T){all}   0.174896    0.020630    0.000057    0.453689    0.138155    257.66    328.14    1.003
r(C<->G){all}   0.163653    0.019526    0.000071    0.444154    0.126869    255.62    276.75    1.000
r(C<->T){all}   0.182090    0.024222    0.000092    0.497435    0.138147    142.35    258.11    1.004
r(G<->T){all}   0.164867    0.020379    0.000017    0.448379    0.126474    172.98    237.65    1.000
pi(A){all}      0.189882    0.000599    0.141059    0.235792    0.188966   1134.43   1317.71    1.000
pi(C){all}      0.270857    0.000782    0.216007    0.323805    0.270466   1204.39   1273.18    1.000
pi(G){all}      0.283241    0.000775    0.227869    0.337128    0.283218   1218.91   1340.88    1.000
pi(T){all}      0.256020    0.000731    0.202441    0.306483    0.255007   1039.08   1230.79    1.000
alpha{1,2}      0.433022    0.243669    0.000231    1.438575    0.263115   1284.70   1365.96    1.002
alpha{3}        0.462530    0.249248    0.000167    1.472590    0.290537   1051.11   1276.06    1.000
pinvar{all}     0.993801    0.000056    0.980018    0.999998    0.996230   1401.35   1437.61    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-345.335855
Model 2: PositiveSelection	-345.335831
Model 0: one-ratio	-345.335829
Model 7: beta	-345.335878
Model 8: beta&w>1	-345.335829


Model 0 vs 1	5.199999998239946E-5

Model 2 vs 1	4.799999999249849E-5

Model 8 vs 7	9.799999997994746E-5
>C1
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C2
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C3
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C4
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C5
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C6
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=86 

C1              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C2              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C3              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C4              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C5              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C6              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
                **************************************************

C1              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C2              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C3              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C4              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C5              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C6              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
                ************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   86 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   86 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2580]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2580]--->[2580]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.608 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C2              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C3              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C4              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C5              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
C6              VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
                **************************************************

C1              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C2              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C3              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C4              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C5              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
C6              NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
                ************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C2              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C3              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C4              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C5              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
C6              GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
                **************************************************

C1              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C2              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C3              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C4              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C5              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
C6              CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
                **************************************************

C1              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C2              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C3              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C4              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C5              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
C6              TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
                **************************************************

C1              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C2              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C3              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C4              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C5              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
C6              AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
                **************************************************

C1              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C2              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C3              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C4              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C5              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
C6              TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
                **************************************************

C1              CCGATGCC
C2              CCGATGCC
C3              CCGATGCC
C4              CCGATGCC
C5              CCGATGCC
C6              CCGATGCC
                ********



>C1
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C2
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C3
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C4
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C5
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C6
GTGCCCACGGAAAAGGTAAACCCCGATGGGGTGCTGTTGGTCGTCGCGGA
CCGATTCACTGGCTGCGAAATCGATCTTCGGGAGTTCATGGCCGATCTGT
TACTGCTGAACGGCCCACTGTATTCTGGCGCCAGTCAAAGGCTTTACTGT
AATGCTCTTTATTGCTGCGTCCACTGTACATGCACTACCGCGGCGATGCC
TCCGGCAGCGACTGTCTGCCGGGACAAGTTTGTGATGAAATTGATCTTCG
CCGATGCC
>C1
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C2
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C3
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C4
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C5
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA
>C6
VPTEKVNPDGVLLVVADRFTGCEIDLREFMADLLLLNGPLYSGASQRLYC
NALYCCVHCTCTTAAMPPAATVCRDKFVMKLIFADA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 258 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856537
      Setting output file names to "/data/7res/ML1603/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 985944143
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5461784637
      Seed = 1978711383
      Swapseed = 1579856537
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -577.416368 -- -24.965149
         Chain 2 -- -577.416334 -- -24.965149
         Chain 3 -- -577.416334 -- -24.965149
         Chain 4 -- -577.416280 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -577.416368 -- -24.965149
         Chain 2 -- -577.416334 -- -24.965149
         Chain 3 -- -577.416334 -- -24.965149
         Chain 4 -- -577.416334 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-577.416] (-577.416) (-577.416) (-577.416) * [-577.416] (-577.416) (-577.416) (-577.416) 
        500 -- (-373.635) (-369.605) (-365.924) [-368.672] * (-368.449) (-363.316) [-360.510] (-363.688) -- 0:00:00
       1000 -- (-369.156) (-362.414) (-372.479) [-363.967] * (-366.555) [-375.028] (-371.240) (-364.928) -- 0:00:00
       1500 -- (-366.206) (-368.312) (-369.152) [-368.760] * [-369.979] (-377.857) (-366.889) (-364.285) -- 0:00:00
       2000 -- (-367.270) [-369.534] (-367.687) (-363.707) * (-369.993) (-376.566) [-363.406] (-362.280) -- 0:00:00
       2500 -- (-364.926) [-373.854] (-370.639) (-363.751) * (-361.419) (-375.879) [-366.596] (-366.142) -- 0:00:00
       3000 -- (-368.192) (-375.389) (-369.524) [-363.430] * (-369.116) (-375.320) [-368.060] (-369.312) -- 0:00:00
       3500 -- (-364.861) (-369.441) (-368.453) [-362.106] * [-371.638] (-365.785) (-363.638) (-378.668) -- 0:00:00
       4000 -- [-365.306] (-365.371) (-372.251) (-369.857) * (-369.400) [-368.351] (-364.961) (-368.993) -- 0:00:00
       4500 -- (-368.325) (-367.690) (-367.126) [-361.730] * (-369.419) [-366.996] (-366.461) (-369.849) -- 0:00:00
       5000 -- (-368.679) [-368.179] (-367.657) (-387.318) * (-358.515) (-367.316) [-363.454] (-373.833) -- 0:03:19

      Average standard deviation of split frequencies: 0.071425

       5500 -- [-360.377] (-388.500) (-362.558) (-371.374) * (-364.068) (-365.265) (-367.335) [-362.694] -- 0:03:00
       6000 -- (-366.085) (-377.974) (-371.919) [-373.214] * (-361.671) [-363.900] (-361.396) (-366.577) -- 0:02:45
       6500 -- (-369.980) (-375.492) [-368.763] (-373.116) * (-372.047) [-362.340] (-362.123) (-366.094) -- 0:02:32
       7000 -- (-368.097) [-367.865] (-375.351) (-361.137) * (-371.900) (-365.870) (-367.475) [-369.998] -- 0:02:21
       7500 -- [-363.747] (-370.321) (-356.958) (-364.918) * (-361.526) (-376.193) (-363.495) [-372.371] -- 0:02:12
       8000 -- (-371.176) (-370.351) (-358.420) [-362.185] * (-363.869) (-368.992) [-364.806] (-363.043) -- 0:02:04
       8500 -- (-365.389) (-367.411) [-356.156] (-364.242) * (-364.918) [-360.761] (-369.582) (-364.533) -- 0:01:56
       9000 -- [-363.501] (-384.601) (-357.303) (-370.658) * (-367.821) [-375.303] (-363.569) (-374.705) -- 0:01:50
       9500 -- (-360.012) (-368.268) (-357.816) [-365.461] * (-374.154) (-364.378) [-365.396] (-363.686) -- 0:01:44
      10000 -- (-367.312) (-371.109) [-359.288] (-365.965) * (-367.277) [-364.087] (-362.964) (-372.272) -- 0:01:39

      Average standard deviation of split frequencies: 0.049393

      10500 -- (-367.319) [-358.175] (-360.635) (-361.205) * (-374.481) (-371.385) [-366.538] (-370.472) -- 0:01:34
      11000 -- (-367.748) [-356.698] (-359.355) (-363.329) * [-363.871] (-377.085) (-377.165) (-371.979) -- 0:01:29
      11500 -- (-368.826) (-358.219) (-355.834) [-371.482] * (-365.093) (-369.817) (-367.585) [-363.477] -- 0:01:25
      12000 -- (-365.694) (-356.834) (-355.098) [-366.913] * [-364.329] (-369.352) (-374.434) (-368.073) -- 0:01:22
      12500 -- (-355.456) (-356.001) [-355.978] (-369.448) * [-364.922] (-378.489) (-371.981) (-371.091) -- 0:01:19
      13000 -- [-356.146] (-357.992) (-357.792) (-366.643) * [-364.070] (-357.537) (-363.502) (-368.758) -- 0:01:15
      13500 -- (-355.365) (-356.497) [-355.906] (-364.984) * [-361.035] (-359.619) (-371.997) (-363.019) -- 0:01:13
      14000 -- (-356.823) (-358.518) (-356.310) [-357.957] * (-365.310) (-358.128) [-366.530] (-378.288) -- 0:01:10
      14500 -- [-358.234] (-361.030) (-357.760) (-358.171) * (-362.974) [-358.627] (-382.257) (-379.302) -- 0:01:07
      15000 -- (-355.932) (-357.418) (-357.225) [-356.034] * (-367.556) [-356.249] (-363.299) (-374.644) -- 0:01:05

      Average standard deviation of split frequencies: 0.044896

      15500 -- [-355.969] (-360.111) (-361.493) (-355.392) * [-364.982] (-356.658) (-357.901) (-363.678) -- 0:01:03
      16000 -- (-355.960) [-359.629] (-357.529) (-356.907) * (-366.190) (-356.670) (-356.569) [-356.919] -- 0:01:01
      16500 -- (-361.591) (-359.273) (-358.850) [-359.765] * (-370.628) (-357.657) (-360.755) [-355.725] -- 0:00:59
      17000 -- (-358.627) (-357.454) (-357.750) [-358.134] * [-367.076] (-360.390) (-355.829) (-356.372) -- 0:00:57
      17500 -- (-359.025) (-361.094) (-360.663) [-357.503] * [-366.098] (-357.389) (-357.056) (-355.427) -- 0:00:56
      18000 -- (-356.796) (-356.579) (-358.097) [-358.991] * [-369.446] (-356.563) (-355.878) (-356.272) -- 0:00:54
      18500 -- (-357.622) (-355.756) [-357.232] (-359.598) * [-361.861] (-356.584) (-360.214) (-361.252) -- 0:00:53
      19000 -- (-359.104) (-359.531) (-359.408) [-357.177] * (-367.518) [-356.151] (-355.992) (-358.184) -- 0:00:51
      19500 -- (-357.202) (-359.355) [-357.985] (-356.525) * [-368.857] (-357.348) (-357.485) (-360.278) -- 0:00:50
      20000 -- (-357.521) [-356.502] (-357.593) (-356.448) * (-366.890) (-358.999) [-359.569] (-355.833) -- 0:00:49

      Average standard deviation of split frequencies: 0.039284

      20500 -- (-359.512) (-356.405) (-359.050) [-357.140] * (-367.806) [-358.252] (-356.984) (-357.241) -- 0:00:47
      21000 -- (-358.239) (-359.217) (-358.008) [-357.773] * (-364.287) (-361.773) [-361.983] (-359.137) -- 0:00:46
      21500 -- [-355.400] (-356.578) (-357.177) (-357.044) * [-368.166] (-359.207) (-356.496) (-359.076) -- 0:00:45
      22000 -- [-357.263] (-359.826) (-359.102) (-356.680) * (-366.821) (-356.692) (-355.732) [-356.900] -- 0:00:44
      22500 -- [-355.602] (-357.071) (-359.425) (-355.985) * (-372.088) [-356.447] (-356.010) (-355.900) -- 0:01:26
      23000 -- (-356.455) (-356.208) (-356.846) [-357.969] * [-368.411] (-358.821) (-358.330) (-357.872) -- 0:01:24
      23500 -- (-358.590) (-356.656) (-360.222) [-356.079] * (-365.616) (-358.228) (-355.622) [-358.822] -- 0:01:23
      24000 -- (-357.494) (-356.593) (-357.457) [-356.263] * (-376.171) [-360.579] (-360.567) (-356.779) -- 0:01:21
      24500 -- (-358.754) [-355.796] (-358.071) (-356.868) * (-374.208) (-360.255) (-360.777) [-355.360] -- 0:01:19
      25000 -- (-356.104) (-359.221) [-357.330] (-355.351) * (-378.294) (-355.828) (-360.009) [-361.606] -- 0:01:18

      Average standard deviation of split frequencies: 0.046510

      25500 -- (-357.393) [-356.043] (-358.530) (-359.144) * (-367.991) [-355.755] (-360.752) (-357.073) -- 0:01:16
      26000 -- [-356.490] (-357.223) (-358.308) (-356.752) * (-376.828) (-355.959) (-362.155) [-355.582] -- 0:01:14
      26500 -- [-356.129] (-356.919) (-360.250) (-355.242) * (-374.090) (-355.691) [-362.395] (-356.645) -- 0:01:13
      27000 -- (-357.838) [-355.866] (-360.617) (-357.426) * (-368.940) (-357.037) [-359.869] (-355.562) -- 0:01:12
      27500 -- [-357.686] (-356.342) (-359.001) (-355.134) * (-371.688) (-357.752) [-357.206] (-356.641) -- 0:01:10
      28000 -- (-357.871) (-356.496) [-358.706] (-357.625) * (-368.584) (-355.027) (-355.718) [-362.313] -- 0:01:09
      28500 -- (-356.922) (-356.829) [-356.222] (-357.003) * [-357.081] (-356.081) (-357.431) (-357.672) -- 0:01:08
      29000 -- (-359.208) [-356.764] (-358.015) (-356.808) * (-359.685) (-355.469) (-359.305) [-356.137] -- 0:01:06
      29500 -- (-360.067) [-356.787] (-360.254) (-358.170) * (-362.569) (-355.299) [-356.485] (-356.883) -- 0:01:05
      30000 -- (-356.487) (-355.281) [-357.844] (-359.168) * (-364.762) (-356.181) [-358.615] (-356.060) -- 0:01:04

      Average standard deviation of split frequencies: 0.043188

      30500 -- [-356.803] (-361.654) (-357.690) (-360.499) * (-361.809) (-356.867) [-357.575] (-358.601) -- 0:01:03
      31000 -- [-360.848] (-357.393) (-359.608) (-360.664) * (-357.456) (-355.396) [-355.714] (-355.172) -- 0:01:02
      31500 -- [-357.086] (-356.373) (-356.294) (-355.966) * (-359.308) (-356.378) (-355.882) [-359.553] -- 0:01:01
      32000 -- [-358.793] (-357.020) (-357.151) (-356.813) * (-359.260) (-359.307) (-357.795) [-355.431] -- 0:01:00
      32500 -- (-357.319) (-358.671) [-356.120] (-365.751) * (-356.909) (-359.419) [-356.473] (-355.480) -- 0:00:59
      33000 -- [-357.419] (-356.067) (-361.591) (-364.219) * (-359.845) (-358.483) (-359.728) [-357.967] -- 0:00:58
      33500 -- (-356.699) (-355.281) (-359.945) [-358.337] * (-358.330) (-357.706) (-363.888) [-355.653] -- 0:00:57
      34000 -- (-356.609) [-356.663] (-360.114) (-359.084) * (-358.888) [-356.132] (-360.951) (-358.232) -- 0:00:56
      34500 -- [-357.723] (-356.608) (-356.272) (-359.190) * (-360.175) [-358.578] (-365.424) (-358.723) -- 0:00:55
      35000 -- [-358.673] (-358.004) (-356.421) (-358.106) * (-361.594) (-356.868) [-355.465] (-358.392) -- 0:00:55

      Average standard deviation of split frequencies: 0.044522

      35500 -- (-362.107) (-359.129) (-357.293) [-356.757] * (-359.578) [-357.460] (-357.607) (-357.039) -- 0:00:54
      36000 -- (-360.373) (-359.669) (-355.533) [-356.767] * (-359.604) (-356.004) [-356.158] (-355.052) -- 0:00:53
      36500 -- (-355.778) (-358.310) [-361.567] (-356.099) * (-359.795) (-357.155) (-357.632) [-356.401] -- 0:00:52
      37000 -- (-358.529) (-355.678) (-360.157) [-358.909] * (-356.741) (-357.844) (-356.281) [-357.080] -- 0:00:52
      37500 -- (-358.528) (-357.604) (-356.294) [-356.430] * [-356.510] (-360.603) (-357.061) (-355.557) -- 0:00:51
      38000 -- (-357.032) (-356.087) [-356.511] (-356.105) * [-358.627] (-359.488) (-360.251) (-357.190) -- 0:00:50
      38500 -- (-357.247) [-357.490] (-360.004) (-358.026) * [-355.135] (-356.235) (-361.618) (-355.424) -- 0:00:49
      39000 -- [-358.173] (-359.005) (-357.819) (-357.491) * (-358.757) (-356.630) (-359.329) [-358.439] -- 0:00:49
      39500 -- (-357.421) (-358.396) (-362.234) [-355.832] * (-361.744) (-358.407) [-357.698] (-357.260) -- 0:01:12
      40000 -- (-357.973) [-356.848] (-360.615) (-355.688) * (-355.727) (-360.519) [-355.385] (-356.425) -- 0:01:12

      Average standard deviation of split frequencies: 0.040877

      40500 -- (-357.305) (-357.635) [-359.601] (-356.348) * (-358.054) [-355.832] (-356.135) (-358.664) -- 0:01:11
      41000 -- (-355.694) (-360.550) [-356.343] (-356.403) * (-355.801) [-356.157] (-356.411) (-356.100) -- 0:01:10
      41500 -- (-357.780) (-357.341) [-356.730] (-355.317) * [-357.033] (-355.675) (-356.848) (-360.369) -- 0:01:09
      42000 -- (-357.436) [-358.098] (-358.150) (-355.957) * (-361.882) [-356.161] (-356.836) (-360.937) -- 0:01:08
      42500 -- (-356.294) [-359.303] (-358.283) (-359.921) * (-358.933) (-356.202) (-358.765) [-359.268] -- 0:01:07
      43000 -- (-356.375) (-356.234) [-358.299] (-359.129) * (-359.736) [-356.057] (-357.737) (-358.511) -- 0:01:06
      43500 -- (-358.096) (-357.805) (-359.477) [-358.523] * (-358.211) [-356.501] (-358.519) (-356.524) -- 0:01:05
      44000 -- (-355.423) (-356.557) (-359.439) [-356.343] * (-359.625) (-359.866) [-359.205] (-356.618) -- 0:01:05
      44500 -- (-356.030) [-356.548] (-356.236) (-356.543) * (-357.290) (-356.745) [-358.179] (-360.731) -- 0:01:04
      45000 -- (-356.628) [-356.994] (-357.755) (-356.429) * (-359.877) [-355.883] (-355.575) (-361.125) -- 0:01:03

      Average standard deviation of split frequencies: 0.044252

      45500 -- [-359.708] (-354.970) (-357.442) (-356.907) * (-357.106) (-356.080) (-360.359) [-356.817] -- 0:01:02
      46000 -- (-358.258) (-358.433) (-358.508) [-355.501] * (-355.702) (-356.351) (-356.779) [-355.344] -- 0:01:02
      46500 -- [-356.432] (-356.970) (-357.173) (-358.663) * (-355.514) (-356.447) [-361.084] (-356.965) -- 0:01:01
      47000 -- [-357.432] (-361.485) (-356.066) (-357.474) * (-356.424) (-361.200) [-355.251] (-357.604) -- 0:01:00
      47500 -- (-357.367) [-358.408] (-358.268) (-357.347) * (-357.923) (-359.866) (-358.469) [-355.853] -- 0:01:00
      48000 -- (-357.523) (-356.686) [-359.711] (-357.155) * (-362.501) (-361.460) (-360.333) [-357.114] -- 0:00:59
      48500 -- (-357.520) (-356.540) [-357.228] (-359.154) * [-357.542] (-355.706) (-360.005) (-359.105) -- 0:00:58
      49000 -- (-356.860) (-356.559) (-357.990) [-357.777] * (-357.126) (-357.212) [-355.855] (-356.052) -- 0:00:58
      49500 -- (-358.435) (-355.347) [-357.584] (-357.124) * (-356.162) (-357.179) (-357.451) [-359.456] -- 0:00:57
      50000 -- (-356.622) (-356.040) [-358.885] (-355.918) * [-356.978] (-360.068) (-358.553) (-358.308) -- 0:00:57

      Average standard deviation of split frequencies: 0.041868

      50500 -- [-356.727] (-358.143) (-357.918) (-356.464) * [-359.034] (-356.352) (-359.284) (-356.463) -- 0:00:56
      51000 -- (-356.882) (-356.281) (-359.071) [-356.250] * [-357.254] (-358.611) (-358.364) (-356.888) -- 0:00:55
      51500 -- (-355.818) (-358.321) [-358.838] (-356.229) * (-355.686) (-357.963) [-360.024] (-355.303) -- 0:00:55
      52000 -- [-358.696] (-356.281) (-359.294) (-355.924) * (-357.485) [-356.661] (-357.793) (-355.356) -- 0:00:54
      52500 -- (-357.680) (-355.783) (-356.238) [-357.061] * (-355.985) (-357.186) [-357.216] (-357.205) -- 0:00:54
      53000 -- (-356.661) (-358.317) (-357.544) [-356.064] * (-359.160) [-355.718] (-356.415) (-357.998) -- 0:00:53
      53500 -- [-356.646] (-355.636) (-357.263) (-355.906) * [-357.880] (-356.135) (-356.183) (-365.320) -- 0:00:53
      54000 -- (-358.150) (-357.704) (-357.336) [-356.538] * (-357.115) (-356.969) [-355.280] (-360.085) -- 0:00:52
      54500 -- (-356.620) (-358.061) (-356.447) [-356.223] * (-357.983) (-357.583) [-356.976] (-355.404) -- 0:00:52
      55000 -- (-355.589) (-359.537) [-355.593] (-357.239) * (-357.523) (-357.051) [-358.043] (-358.370) -- 0:00:51

      Average standard deviation of split frequencies: 0.043620

      55500 -- (-356.510) (-358.907) (-356.400) [-358.163] * (-358.318) (-359.032) (-359.368) [-357.133] -- 0:00:51
      56000 -- (-359.192) (-360.192) (-355.312) [-358.983] * (-357.414) (-355.688) (-357.496) [-358.480] -- 0:00:50
      56500 -- (-358.082) (-357.869) (-356.006) [-360.623] * [-356.262] (-357.860) (-359.268) (-357.173) -- 0:00:50
      57000 -- (-361.022) (-359.149) (-357.390) [-356.103] * (-357.399) [-356.059] (-358.168) (-355.602) -- 0:01:06
      57500 -- (-357.502) (-357.069) (-360.177) [-357.945] * (-356.597) [-356.218] (-358.580) (-358.816) -- 0:01:05
      58000 -- [-359.590] (-357.396) (-359.714) (-356.846) * (-355.925) (-355.532) (-359.626) [-356.572] -- 0:01:04
      58500 -- (-355.793) (-355.530) [-359.257] (-357.113) * (-355.827) (-359.327) [-357.516] (-356.480) -- 0:01:04
      59000 -- (-358.106) [-356.582] (-357.168) (-356.135) * (-356.375) (-357.544) [-355.964] (-357.214) -- 0:01:03
      59500 -- (-357.257) (-358.347) [-355.584] (-356.825) * (-356.399) [-356.789] (-359.742) (-357.379) -- 0:01:03
      60000 -- [-356.743] (-363.174) (-361.652) (-362.716) * [-358.225] (-358.455) (-357.557) (-358.469) -- 0:01:02

      Average standard deviation of split frequencies: 0.046622

      60500 -- (-360.254) (-358.444) (-357.146) [-357.622] * (-355.530) [-357.856] (-357.266) (-357.855) -- 0:01:02
      61000 -- (-355.645) (-359.847) (-357.203) [-359.923] * (-357.329) (-359.945) (-357.211) [-357.426] -- 0:01:01
      61500 -- [-355.990] (-357.956) (-358.789) (-359.182) * (-358.614) (-360.380) [-358.887] (-361.473) -- 0:01:01
      62000 -- (-357.685) [-356.383] (-358.620) (-359.205) * [-357.273] (-356.328) (-362.038) (-357.399) -- 0:01:00
      62500 -- (-358.079) [-360.600] (-355.752) (-360.264) * (-356.323) (-359.089) (-361.474) [-357.859] -- 0:01:00
      63000 -- (-358.257) (-360.798) [-357.923] (-356.343) * [-356.532] (-357.173) (-359.326) (-360.605) -- 0:00:59
      63500 -- [-356.440] (-357.893) (-359.325) (-358.434) * (-363.145) [-357.633] (-358.452) (-355.569) -- 0:00:58
      64000 -- (-357.818) [-359.705] (-356.509) (-358.589) * (-358.264) [-358.995] (-356.995) (-361.258) -- 0:00:58
      64500 -- [-356.942] (-360.468) (-357.940) (-360.826) * (-360.166) (-357.009) [-355.618] (-357.773) -- 0:00:58
      65000 -- [-357.821] (-355.327) (-361.669) (-356.060) * [-357.954] (-357.481) (-355.698) (-357.968) -- 0:00:57

      Average standard deviation of split frequencies: 0.045128

      65500 -- (-358.458) (-357.141) [-358.953] (-358.995) * (-361.865) (-358.235) [-358.247] (-355.838) -- 0:00:57
      66000 -- [-355.690] (-359.863) (-356.626) (-358.287) * (-358.431) [-357.143] (-357.288) (-358.844) -- 0:00:56
      66500 -- (-355.987) (-359.620) (-357.856) [-357.195] * (-357.560) [-356.550] (-356.526) (-356.562) -- 0:00:56
      67000 -- (-358.618) (-360.106) (-357.942) [-356.884] * (-359.205) (-356.854) (-356.247) [-356.872] -- 0:00:55
      67500 -- [-359.962] (-355.619) (-357.491) (-357.850) * [-357.922] (-359.810) (-356.332) (-361.712) -- 0:00:55
      68000 -- [-361.047] (-364.331) (-356.328) (-357.536) * (-357.054) [-356.089] (-357.702) (-361.475) -- 0:00:54
      68500 -- (-357.526) (-360.373) [-356.244] (-359.247) * [-358.576] (-356.987) (-360.527) (-365.324) -- 0:00:54
      69000 -- (-361.777) [-359.133] (-356.737) (-359.323) * (-356.400) (-360.422) (-357.521) [-357.929] -- 0:00:53
      69500 -- (-361.736) [-358.568] (-357.554) (-359.119) * (-356.199) (-356.435) [-358.051] (-355.288) -- 0:00:53
      70000 -- (-356.793) [-357.009] (-356.154) (-356.247) * (-355.928) (-355.635) [-355.917] (-356.307) -- 0:00:53

      Average standard deviation of split frequencies: 0.044573

      70500 -- [-357.154] (-359.034) (-355.588) (-356.966) * (-356.396) (-360.100) (-356.189) [-360.834] -- 0:00:52
      71000 -- [-355.989] (-357.249) (-355.667) (-355.763) * (-359.802) (-357.095) [-356.223] (-362.808) -- 0:00:52
      71500 -- (-357.267) [-356.429] (-355.803) (-356.541) * (-359.096) [-356.622] (-356.161) (-362.672) -- 0:00:51
      72000 -- (-356.503) (-359.326) [-355.847] (-356.960) * (-359.679) [-355.334] (-356.414) (-359.899) -- 0:00:51
      72500 -- (-358.170) (-360.034) (-357.982) [-356.394] * (-356.755) (-355.652) (-358.504) [-355.744] -- 0:00:51
      73000 -- [-356.057] (-358.698) (-355.321) (-358.050) * (-357.645) (-355.764) [-357.205] (-355.565) -- 0:00:50
      73500 -- (-360.894) (-359.378) (-356.116) [-358.633] * (-358.633) (-356.331) [-356.484] (-358.938) -- 0:00:50
      74000 -- [-358.164] (-361.248) (-357.171) (-357.509) * (-357.562) [-362.542] (-357.119) (-355.612) -- 0:01:02
      74500 -- (-357.653) (-356.762) [-355.928] (-357.568) * (-358.932) (-359.161) [-357.109] (-357.017) -- 0:01:02
      75000 -- (-358.420) (-359.185) (-359.721) [-357.300] * [-355.619] (-356.888) (-359.701) (-355.551) -- 0:01:01

      Average standard deviation of split frequencies: 0.043419

      75500 -- (-361.332) [-360.450] (-355.730) (-361.477) * (-355.480) (-355.613) [-357.774] (-366.355) -- 0:01:01
      76000 -- (-357.397) (-357.415) (-359.082) [-356.594] * [-357.370] (-355.388) (-357.237) (-359.384) -- 0:01:00
      76500 -- (-356.413) (-360.383) (-355.901) [-358.411] * (-357.270) (-355.596) (-357.290) [-355.755] -- 0:01:00
      77000 -- (-357.024) (-358.739) (-357.585) [-358.640] * (-357.971) [-357.242] (-355.863) (-355.636) -- 0:00:59
      77500 -- (-357.141) [-357.362] (-356.716) (-358.890) * [-358.089] (-360.477) (-357.942) (-356.031) -- 0:00:59
      78000 -- [-357.950] (-356.175) (-360.925) (-360.188) * (-357.716) [-358.432] (-360.951) (-357.892) -- 0:00:59
      78500 -- [-357.449] (-356.281) (-356.139) (-356.154) * [-357.964] (-357.405) (-362.221) (-356.573) -- 0:00:58
      79000 -- (-355.927) [-358.875] (-359.915) (-356.375) * [-356.584] (-357.176) (-355.794) (-355.991) -- 0:00:58
      79500 -- (-358.544) [-355.314] (-357.530) (-360.112) * (-358.149) (-359.981) [-356.341] (-355.354) -- 0:00:57
      80000 -- (-357.210) (-357.079) [-355.390] (-356.555) * (-358.207) [-359.312] (-357.846) (-356.309) -- 0:00:57

      Average standard deviation of split frequencies: 0.041415

      80500 -- (-357.031) (-355.649) (-360.425) [-355.982] * (-357.791) (-357.377) (-355.313) [-356.984] -- 0:00:57
      81000 -- (-355.669) (-358.173) [-356.801] (-356.095) * [-358.749] (-356.450) (-357.584) (-356.511) -- 0:00:56
      81500 -- (-355.127) (-359.324) [-355.696] (-359.577) * (-358.397) (-355.760) (-361.273) [-358.541] -- 0:00:56
      82000 -- (-355.462) [-358.208] (-355.289) (-357.006) * (-355.767) (-358.085) (-361.848) [-356.226] -- 0:00:55
      82500 -- [-357.012] (-357.869) (-359.485) (-355.144) * (-355.696) (-356.309) [-356.262] (-356.272) -- 0:00:55
      83000 -- (-357.347) (-358.263) (-356.990) [-355.887] * (-357.886) (-355.629) [-356.152] (-356.538) -- 0:00:55
      83500 -- [-356.307] (-356.912) (-355.915) (-356.340) * (-356.005) (-355.593) (-359.977) [-356.233] -- 0:00:54
      84000 -- (-357.328) [-356.000] (-355.807) (-355.703) * (-357.818) [-355.404] (-357.100) (-355.801) -- 0:00:54
      84500 -- (-358.333) [-355.191] (-355.709) (-357.308) * (-356.779) [-355.750] (-357.198) (-356.255) -- 0:00:54
      85000 -- (-359.536) [-355.911] (-357.887) (-358.292) * (-358.861) (-357.014) (-358.708) [-356.541] -- 0:00:53

      Average standard deviation of split frequencies: 0.038608

      85500 -- (-357.361) [-356.559] (-357.652) (-356.526) * [-356.486] (-358.839) (-356.914) (-358.630) -- 0:00:53
      86000 -- (-355.294) (-357.848) [-359.028] (-356.503) * (-356.257) (-357.162) (-356.100) [-356.857] -- 0:00:53
      86500 -- (-358.176) [-355.320] (-356.113) (-358.883) * (-359.497) (-356.032) (-358.729) [-355.384] -- 0:00:52
      87000 -- (-357.754) (-358.190) [-356.480] (-356.757) * (-358.588) (-358.043) (-355.418) [-357.049] -- 0:00:52
      87500 -- [-357.200] (-360.874) (-356.470) (-356.053) * [-357.209] (-358.590) (-357.377) (-356.910) -- 0:00:52
      88000 -- (-360.426) (-357.340) (-358.067) [-360.533] * (-359.023) (-357.045) (-355.883) [-356.762] -- 0:00:51
      88500 -- [-358.015] (-355.367) (-358.858) (-356.520) * (-356.982) (-356.332) [-356.122] (-357.089) -- 0:00:51
      89000 -- [-355.305] (-356.559) (-365.092) (-358.939) * [-364.437] (-367.700) (-357.628) (-355.857) -- 0:00:51
      89500 -- (-358.582) (-362.626) [-358.463] (-359.979) * [-357.885] (-366.420) (-356.824) (-357.942) -- 0:00:50
      90000 -- (-357.389) (-365.509) (-359.730) [-359.399] * (-357.362) (-359.392) [-356.612] (-355.878) -- 0:00:50

      Average standard deviation of split frequencies: 0.038050

      90500 -- (-357.688) [-361.212] (-356.785) (-361.573) * (-359.998) (-358.857) [-357.084] (-356.252) -- 0:00:50
      91000 -- (-358.521) (-362.112) [-356.755] (-357.868) * (-357.767) (-355.666) [-356.929] (-355.832) -- 0:00:59
      91500 -- (-359.047) (-359.496) (-355.380) [-355.587] * (-358.703) (-357.728) (-364.162) [-358.934] -- 0:00:59
      92000 -- (-361.283) (-357.314) (-355.742) [-355.206] * (-356.231) [-357.076] (-357.891) (-362.706) -- 0:00:59
      92500 -- (-356.895) (-356.714) (-355.388) [-355.236] * [-358.784] (-358.202) (-358.154) (-363.161) -- 0:00:58
      93000 -- (-356.619) (-359.533) [-355.506] (-355.300) * [-356.359] (-359.691) (-357.327) (-359.029) -- 0:00:58
      93500 -- [-357.201] (-358.937) (-356.044) (-358.591) * (-355.406) [-360.166] (-356.130) (-357.369) -- 0:00:58
      94000 -- (-356.009) (-358.046) [-355.310] (-356.651) * (-357.900) [-358.260] (-358.910) (-361.118) -- 0:00:57
      94500 -- (-362.048) (-359.924) (-357.612) [-358.656] * (-358.781) [-357.156] (-356.350) (-356.493) -- 0:00:57
      95000 -- (-358.189) [-358.717] (-360.177) (-360.991) * (-359.851) (-356.896) (-356.887) [-357.069] -- 0:00:57

      Average standard deviation of split frequencies: 0.039050

      95500 -- (-356.268) [-359.728] (-355.203) (-357.714) * (-356.724) (-356.954) [-357.260] (-359.222) -- 0:00:56
      96000 -- (-358.042) (-359.395) (-356.863) [-358.336] * [-355.670] (-357.589) (-362.462) (-358.808) -- 0:00:56
      96500 -- (-357.240) (-357.311) (-356.926) [-356.492] * (-355.224) (-357.660) (-361.120) [-356.325] -- 0:00:56
      97000 -- [-360.674] (-356.101) (-355.408) (-357.629) * [-354.875] (-366.527) (-362.829) (-356.128) -- 0:00:55
      97500 -- (-358.545) (-357.386) [-356.223] (-356.900) * [-355.644] (-361.351) (-359.965) (-356.023) -- 0:00:55
      98000 -- [-357.372] (-358.657) (-356.830) (-358.716) * (-355.162) (-358.216) (-357.187) [-358.386] -- 0:00:55
      98500 -- [-356.226] (-358.270) (-359.191) (-357.658) * (-358.192) (-361.345) [-355.719] (-356.986) -- 0:00:54
      99000 -- (-358.526) (-359.307) (-357.681) [-356.075] * (-357.375) (-357.516) [-355.611] (-359.120) -- 0:00:54
      99500 -- (-357.871) [-358.837] (-356.847) (-357.254) * (-357.777) [-355.485] (-357.469) (-358.415) -- 0:00:54
      100000 -- (-357.343) [-357.901] (-356.586) (-355.994) * (-358.692) [-356.633] (-357.246) (-357.487) -- 0:00:54

      Average standard deviation of split frequencies: 0.034752

      100500 -- (-360.065) (-358.885) (-355.160) [-355.405] * [-356.688] (-357.367) (-358.953) (-358.008) -- 0:00:53
      101000 -- (-359.422) [-361.813] (-357.540) (-359.228) * (-358.009) (-358.131) [-358.454] (-359.366) -- 0:00:53
      101500 -- (-357.226) (-357.448) [-355.963] (-358.781) * (-357.415) (-356.810) (-355.201) [-357.169] -- 0:00:53
      102000 -- (-357.450) [-356.430] (-357.804) (-355.761) * (-359.404) (-358.549) (-355.863) [-357.062] -- 0:00:52
      102500 -- (-356.390) [-356.810] (-358.027) (-355.484) * (-358.931) (-358.188) [-357.043] (-357.285) -- 0:00:52
      103000 -- (-362.974) [-360.106] (-357.542) (-357.758) * (-361.894) [-356.734] (-356.129) (-355.737) -- 0:00:52
      103500 -- (-356.042) (-359.003) [-358.856] (-356.974) * (-357.393) [-355.509] (-358.122) (-361.188) -- 0:00:51
      104000 -- (-357.564) (-359.860) [-357.333] (-359.596) * (-359.814) (-357.524) (-358.453) [-356.766] -- 0:00:51
      104500 -- (-358.247) [-357.823] (-357.709) (-361.502) * (-356.575) (-355.942) (-360.049) [-355.837] -- 0:00:51
      105000 -- [-358.656] (-356.485) (-359.685) (-357.120) * (-356.321) (-357.400) (-357.298) [-357.340] -- 0:00:51

      Average standard deviation of split frequencies: 0.035780

      105500 -- (-357.242) (-357.324) (-356.039) [-358.687] * (-355.543) (-356.683) [-357.431] (-359.536) -- 0:00:50
      106000 -- [-356.652] (-358.512) (-355.136) (-356.715) * [-355.729] (-357.276) (-358.380) (-355.783) -- 0:00:59
      106500 -- (-357.463) (-358.746) [-357.383] (-357.154) * (-357.626) (-358.853) [-355.901] (-357.082) -- 0:00:58
      107000 -- (-355.905) (-356.651) (-360.803) [-356.342] * (-364.964) (-357.635) (-357.549) [-360.134] -- 0:00:58
      107500 -- (-355.986) (-358.746) [-356.572] (-357.085) * (-356.332) (-355.599) (-357.467) [-360.581] -- 0:00:58
      108000 -- (-358.736) (-356.004) [-357.265] (-357.596) * (-356.628) [-358.125] (-357.785) (-357.449) -- 0:00:57
      108500 -- [-357.242] (-361.977) (-355.445) (-358.330) * (-360.358) (-357.352) [-358.016] (-359.555) -- 0:00:57
      109000 -- (-360.506) (-356.411) [-355.815] (-358.724) * (-356.280) (-357.775) (-361.614) [-356.469] -- 0:00:57
      109500 -- (-357.867) [-355.534] (-356.149) (-360.175) * (-356.325) [-356.373] (-357.815) (-360.052) -- 0:00:56
      110000 -- (-360.797) [-356.256] (-355.710) (-359.982) * (-359.080) (-356.565) [-356.484] (-356.948) -- 0:00:56

      Average standard deviation of split frequencies: 0.034889

      110500 -- [-357.897] (-360.443) (-356.153) (-357.730) * (-356.934) (-357.455) [-356.663] (-358.147) -- 0:00:56
      111000 -- (-358.667) (-358.843) (-355.947) [-356.215] * (-356.904) (-357.401) (-357.790) [-355.878] -- 0:00:56
      111500 -- [-356.635] (-359.576) (-357.316) (-356.706) * [-356.073] (-358.321) (-357.066) (-356.455) -- 0:00:55
      112000 -- (-356.984) [-357.669] (-356.485) (-355.803) * (-355.539) (-355.925) [-359.955] (-358.946) -- 0:00:55
      112500 -- (-358.780) [-358.547] (-359.038) (-355.948) * (-355.422) [-357.941] (-360.901) (-356.126) -- 0:00:55
      113000 -- (-359.499) (-359.936) [-356.290] (-355.861) * (-358.201) [-358.088] (-358.637) (-357.055) -- 0:00:54
      113500 -- (-359.608) (-358.477) [-355.199] (-356.804) * [-356.951] (-358.918) (-361.446) (-356.703) -- 0:00:54
      114000 -- (-358.284) (-355.629) (-359.732) [-356.434] * (-359.125) (-358.492) (-365.514) [-355.321] -- 0:00:54
      114500 -- (-356.617) (-358.340) (-363.113) [-356.921] * (-358.966) (-359.019) [-357.622] (-356.287) -- 0:00:54
      115000 -- (-356.856) (-356.803) [-355.735] (-364.224) * (-356.655) (-359.394) (-363.202) [-355.414] -- 0:00:53

      Average standard deviation of split frequencies: 0.033478

      115500 -- [-355.273] (-364.001) (-356.592) (-359.288) * (-356.224) [-359.059] (-357.886) (-355.279) -- 0:00:53
      116000 -- (-356.845) (-359.470) (-359.402) [-357.245] * (-362.124) (-358.933) (-355.336) [-357.139] -- 0:00:53
      116500 -- (-356.828) (-359.235) [-360.409] (-358.831) * (-356.602) [-359.104] (-355.326) (-358.785) -- 0:00:53
      117000 -- (-360.620) [-359.691] (-356.208) (-356.432) * (-360.156) (-358.229) [-355.630] (-356.397) -- 0:00:52
      117500 -- (-360.638) (-359.885) (-355.400) [-355.358] * (-356.536) [-359.485] (-356.401) (-358.014) -- 0:00:52
      118000 -- [-355.964] (-361.597) (-357.502) (-356.203) * [-357.470] (-356.113) (-357.106) (-356.656) -- 0:00:52
      118500 -- (-357.720) (-356.423) [-357.080] (-359.247) * (-358.554) [-356.187] (-359.091) (-356.567) -- 0:00:52
      119000 -- (-356.908) (-359.392) [-355.114] (-358.577) * (-357.338) [-359.036] (-355.907) (-358.449) -- 0:00:51
      119500 -- [-357.404] (-356.883) (-356.544) (-361.155) * (-358.874) (-358.373) (-358.270) [-358.651] -- 0:00:51
      120000 -- (-356.067) (-359.421) [-356.331] (-357.789) * (-355.389) (-356.566) (-357.500) [-356.915] -- 0:00:51

      Average standard deviation of split frequencies: 0.032487

      120500 -- (-355.971) (-357.472) [-356.899] (-358.364) * (-356.445) [-355.413] (-361.896) (-357.323) -- 0:00:51
      121000 -- (-359.029) [-359.695] (-356.310) (-356.518) * (-355.313) (-355.652) (-359.948) [-356.793] -- 0:00:50
      121500 -- (-355.543) (-355.758) (-356.333) [-357.601] * [-356.906] (-355.270) (-357.419) (-362.049) -- 0:00:50
      122000 -- (-355.146) [-358.805] (-356.527) (-358.601) * (-358.004) (-358.046) [-355.543] (-358.437) -- 0:00:57
      122500 -- (-356.439) (-356.565) [-357.446] (-356.574) * [-357.118] (-355.827) (-357.692) (-357.697) -- 0:00:57
      123000 -- [-356.751] (-355.884) (-360.749) (-359.160) * (-357.671) [-359.374] (-361.239) (-357.171) -- 0:00:57
      123500 -- (-362.694) [-356.889] (-356.096) (-358.833) * (-360.374) (-359.716) (-358.426) [-358.970] -- 0:00:56
      124000 -- (-359.783) [-356.414] (-356.105) (-357.400) * (-358.717) [-357.119] (-357.804) (-358.316) -- 0:00:56
      124500 -- (-356.739) [-356.741] (-356.443) (-359.901) * [-358.039] (-357.507) (-360.043) (-362.724) -- 0:00:56
      125000 -- (-357.003) [-355.949] (-357.831) (-355.361) * (-357.783) [-357.458] (-355.939) (-360.844) -- 0:00:56

      Average standard deviation of split frequencies: 0.030492

      125500 -- (-355.370) [-355.356] (-359.870) (-357.100) * (-355.336) [-357.662] (-357.000) (-358.762) -- 0:00:55
      126000 -- (-356.866) (-356.906) (-357.153) [-359.058] * [-357.138] (-356.328) (-356.221) (-358.053) -- 0:00:55
      126500 -- [-358.434] (-357.509) (-357.298) (-358.763) * (-358.175) (-355.610) (-360.299) [-357.850] -- 0:00:55
      127000 -- (-356.784) (-356.149) [-356.028] (-356.658) * (-357.411) [-357.563] (-356.079) (-357.882) -- 0:00:54
      127500 -- (-356.761) [-356.650] (-359.092) (-358.076) * (-356.365) [-357.250] (-360.976) (-358.097) -- 0:00:54
      128000 -- (-358.167) (-356.985) (-356.179) [-358.083] * (-357.376) (-356.019) [-357.139] (-360.108) -- 0:00:54
      128500 -- (-355.540) [-357.316] (-356.305) (-355.962) * (-356.185) [-356.307] (-356.835) (-363.141) -- 0:00:54
      129000 -- (-357.691) [-358.644] (-355.957) (-358.414) * (-363.194) [-355.771] (-356.752) (-361.941) -- 0:00:54
      129500 -- [-355.662] (-356.090) (-356.891) (-357.420) * (-358.404) (-355.607) (-362.309) [-359.826] -- 0:00:53
      130000 -- (-355.950) (-357.631) [-356.343] (-357.639) * (-357.165) (-355.458) [-355.530] (-358.120) -- 0:00:53

      Average standard deviation of split frequencies: 0.031206

      130500 -- (-355.078) (-355.981) (-361.523) [-356.091] * (-357.405) (-356.336) [-357.823] (-358.063) -- 0:00:53
      131000 -- (-355.720) (-356.723) [-360.989] (-356.348) * (-355.479) (-357.903) (-355.765) [-355.061] -- 0:00:53
      131500 -- [-356.305] (-355.536) (-356.284) (-355.905) * (-357.273) [-356.403] (-355.800) (-355.303) -- 0:00:52
      132000 -- (-357.197) (-355.652) (-357.795) [-356.636] * (-357.615) (-360.048) (-355.517) [-355.903] -- 0:00:52
      132500 -- [-359.706] (-356.249) (-356.687) (-355.816) * (-360.620) (-361.541) [-356.127] (-357.103) -- 0:00:52
      133000 -- [-358.268] (-358.515) (-356.613) (-358.895) * (-358.498) [-355.536] (-355.533) (-355.818) -- 0:00:52
      133500 -- [-358.093] (-356.157) (-356.897) (-356.392) * (-358.324) (-357.791) [-356.064] (-355.404) -- 0:00:51
      134000 -- (-359.373) (-355.530) [-357.576] (-357.402) * (-356.554) (-356.754) [-355.492] (-358.109) -- 0:00:51
      134500 -- [-357.376] (-355.997) (-356.837) (-358.733) * (-355.378) (-358.695) [-355.645] (-355.630) -- 0:00:51
      135000 -- [-356.811] (-356.522) (-358.928) (-358.522) * (-356.211) [-361.783] (-357.169) (-355.551) -- 0:00:51

      Average standard deviation of split frequencies: 0.028423

      135500 -- (-358.158) (-355.978) (-356.410) [-355.439] * [-356.074] (-355.713) (-355.981) (-357.652) -- 0:00:51
      136000 -- (-357.020) (-355.686) [-355.798] (-355.927) * (-357.332) (-359.233) (-356.688) [-355.466] -- 0:00:50
      136500 -- (-361.323) (-355.221) [-356.143] (-359.285) * (-357.982) (-357.124) [-358.290] (-357.620) -- 0:00:50
      137000 -- (-359.459) (-355.679) [-356.259] (-357.002) * (-357.405) [-355.968] (-356.750) (-355.579) -- 0:00:50
      137500 -- (-356.358) (-356.095) (-357.247) [-357.486] * (-358.016) (-357.252) [-356.266] (-357.022) -- 0:00:56
      138000 -- (-355.005) (-357.916) (-359.808) [-356.454] * (-358.432) (-356.699) [-355.874] (-365.172) -- 0:00:56
      138500 -- (-355.908) [-363.789] (-358.695) (-362.487) * (-358.505) (-359.960) (-355.581) [-361.627] -- 0:00:55
      139000 -- (-356.093) (-359.144) (-359.027) [-355.941] * (-356.015) (-358.079) [-356.761] (-356.678) -- 0:00:55
      139500 -- (-355.793) [-357.702] (-356.685) (-357.629) * (-356.747) (-362.483) [-359.808] (-355.703) -- 0:00:55
      140000 -- [-356.348] (-356.996) (-358.203) (-364.003) * (-355.900) (-356.664) [-355.727] (-357.691) -- 0:00:55

      Average standard deviation of split frequencies: 0.028318

      140500 -- (-356.655) (-360.297) [-356.108] (-356.466) * (-357.181) (-358.399) [-356.885] (-358.703) -- 0:00:55
      141000 -- (-360.357) (-361.230) (-358.125) [-357.278] * (-357.636) (-355.796) [-358.115] (-357.986) -- 0:00:54
      141500 -- (-357.401) (-359.070) (-355.521) [-357.629] * [-356.981] (-355.313) (-355.993) (-357.647) -- 0:00:54
      142000 -- (-357.271) [-356.675] (-356.896) (-356.389) * (-357.298) [-356.462] (-356.111) (-356.893) -- 0:00:54
      142500 -- (-357.916) (-355.825) (-356.405) [-356.370] * (-356.814) [-356.906] (-356.355) (-356.297) -- 0:00:54
      143000 -- (-358.340) (-359.359) (-357.016) [-358.313] * (-355.565) [-355.725] (-357.607) (-356.767) -- 0:00:53
      143500 -- (-359.809) (-357.309) [-357.279] (-355.340) * (-355.768) (-357.800) (-361.383) [-357.048] -- 0:00:53
      144000 -- [-359.278] (-356.953) (-357.818) (-358.516) * (-358.685) (-360.360) (-356.215) [-357.129] -- 0:00:53
      144500 -- [-358.117] (-357.750) (-356.342) (-363.589) * [-355.245] (-360.007) (-357.252) (-356.903) -- 0:00:53
      145000 -- (-357.799) (-360.364) (-358.501) [-357.336] * (-356.606) [-355.171] (-357.469) (-359.902) -- 0:00:53

      Average standard deviation of split frequencies: 0.028898

      145500 -- (-356.711) (-357.480) (-357.972) [-356.988] * (-355.580) (-356.450) (-356.164) [-357.257] -- 0:00:52
      146000 -- (-357.342) (-356.731) [-357.150] (-357.623) * (-358.649) (-357.349) (-359.558) [-356.787] -- 0:00:52
      146500 -- [-358.689] (-356.673) (-358.625) (-357.552) * [-357.038] (-357.324) (-357.058) (-358.023) -- 0:00:52
      147000 -- (-357.953) (-359.651) (-356.634) [-355.898] * (-356.515) [-356.717] (-356.489) (-362.964) -- 0:00:52
      147500 -- (-357.027) (-356.311) [-356.830] (-357.482) * [-356.941] (-357.035) (-356.995) (-361.733) -- 0:00:52
      148000 -- [-357.614] (-356.284) (-358.081) (-359.614) * (-356.461) (-357.929) (-355.528) [-363.941] -- 0:00:51
      148500 -- (-356.250) (-361.046) [-356.076] (-355.677) * (-357.637) (-357.910) [-355.505] (-362.006) -- 0:00:51
      149000 -- [-357.378] (-357.130) (-358.962) (-355.671) * (-357.728) [-357.424] (-357.530) (-357.809) -- 0:00:51
      149500 -- (-356.994) (-356.798) [-361.273] (-355.791) * [-356.724] (-356.451) (-358.009) (-356.556) -- 0:00:51
      150000 -- (-356.506) (-360.925) (-357.732) [-355.508] * [-356.245] (-360.900) (-356.533) (-363.895) -- 0:00:51

      Average standard deviation of split frequencies: 0.029098

      150500 -- (-359.502) (-357.004) [-357.731] (-355.771) * [-357.600] (-357.770) (-356.656) (-361.684) -- 0:00:50
      151000 -- [-358.554] (-359.093) (-359.977) (-364.615) * (-355.517) (-357.986) [-355.712] (-364.409) -- 0:00:50
      151500 -- (-355.770) (-365.371) (-357.067) [-356.412] * [-357.356] (-355.728) (-357.419) (-356.908) -- 0:00:50
      152000 -- (-358.770) (-360.519) (-357.143) [-355.496] * [-355.763] (-361.123) (-356.426) (-358.123) -- 0:00:50
      152500 -- (-355.540) [-356.254] (-363.137) (-358.979) * (-357.007) [-357.279] (-362.318) (-357.041) -- 0:00:50
      153000 -- (-356.308) (-357.875) [-359.311] (-359.161) * (-357.625) (-357.845) (-357.308) [-359.411] -- 0:00:49
      153500 -- (-355.126) (-361.037) [-355.005] (-355.890) * (-356.995) (-355.910) (-357.019) [-360.218] -- 0:00:55
      154000 -- (-357.670) (-356.448) (-359.085) [-355.739] * (-361.697) (-356.944) [-359.314] (-357.245) -- 0:00:54
      154500 -- (-356.788) (-360.178) [-357.199] (-359.073) * [-358.530] (-357.847) (-358.548) (-358.158) -- 0:00:54
      155000 -- (-355.853) (-357.522) (-357.430) [-360.319] * [-358.077] (-356.688) (-357.241) (-356.042) -- 0:00:54

      Average standard deviation of split frequencies: 0.027499

      155500 -- (-357.494) (-357.435) [-357.392] (-357.919) * (-358.898) (-357.065) [-358.279] (-355.586) -- 0:00:54
      156000 -- (-359.220) [-356.750] (-359.457) (-357.179) * (-356.121) [-357.105] (-356.074) (-356.862) -- 0:00:54
      156500 -- (-355.488) (-357.879) (-356.499) [-356.945] * (-355.195) (-356.923) [-358.398] (-356.043) -- 0:00:53
      157000 -- (-355.465) (-358.780) (-356.503) [-356.117] * (-358.479) (-357.755) [-360.806] (-356.273) -- 0:00:53
      157500 -- (-359.315) (-357.863) (-357.698) [-358.838] * (-356.655) (-359.478) [-357.084] (-358.329) -- 0:00:53
      158000 -- [-357.397] (-358.914) (-355.317) (-358.331) * [-357.969] (-356.540) (-356.463) (-356.809) -- 0:00:53
      158500 -- [-356.345] (-356.299) (-360.645) (-357.827) * (-357.511) (-355.601) [-357.051] (-360.285) -- 0:00:53
      159000 -- (-358.026) [-356.512] (-356.540) (-356.560) * (-356.015) (-360.668) [-355.274] (-360.089) -- 0:00:52
      159500 -- (-356.226) (-357.442) [-357.006] (-357.865) * (-355.458) (-362.291) (-360.720) [-356.618] -- 0:00:52
      160000 -- [-356.052] (-356.650) (-357.237) (-356.032) * (-355.535) (-356.877) [-358.957] (-357.070) -- 0:00:52

      Average standard deviation of split frequencies: 0.024939

      160500 -- (-356.725) (-355.887) (-359.721) [-356.353] * (-358.614) (-356.954) [-360.026] (-361.353) -- 0:00:52
      161000 -- (-355.930) (-356.738) (-362.345) [-356.013] * (-356.164) (-358.626) [-357.355] (-356.464) -- 0:00:52
      161500 -- (-355.333) (-359.809) (-356.165) [-356.184] * [-359.040] (-357.242) (-357.600) (-362.006) -- 0:00:51
      162000 -- [-358.836] (-359.614) (-356.768) (-355.638) * (-356.141) (-356.461) (-358.144) [-357.062] -- 0:00:51
      162500 -- (-358.023) [-356.489] (-356.936) (-357.788) * (-355.480) [-355.336] (-357.401) (-359.194) -- 0:00:51
      163000 -- (-356.496) [-361.195] (-358.191) (-365.086) * [-356.927] (-357.002) (-356.354) (-356.999) -- 0:00:51
      163500 -- (-355.888) [-356.875] (-356.832) (-362.263) * (-361.368) (-359.046) (-356.788) [-355.358] -- 0:00:51
      164000 -- (-357.510) (-355.530) [-357.267] (-360.035) * (-356.686) (-355.426) [-356.707] (-359.220) -- 0:00:50
      164500 -- (-359.600) (-357.256) [-356.761] (-361.484) * (-357.432) (-356.953) [-356.024] (-356.375) -- 0:00:50
      165000 -- [-357.372] (-359.007) (-355.390) (-357.446) * (-360.196) (-356.552) [-358.344] (-359.236) -- 0:00:50

      Average standard deviation of split frequencies: 0.022313

      165500 -- (-356.270) (-358.806) [-356.223] (-356.698) * (-356.404) (-358.235) (-358.729) [-357.352] -- 0:00:50
      166000 -- [-357.764] (-357.106) (-357.895) (-357.367) * (-356.762) (-360.325) (-358.057) [-358.560] -- 0:00:50
      166500 -- (-360.167) (-357.621) [-356.817] (-356.997) * (-359.570) (-358.286) (-356.387) [-359.501] -- 0:00:50
      167000 -- (-355.775) [-361.684] (-359.029) (-358.291) * (-358.762) (-359.162) (-360.028) [-355.479] -- 0:00:49
      167500 -- [-357.680] (-364.957) (-355.627) (-356.368) * (-363.016) [-361.283] (-361.530) (-356.627) -- 0:00:49
      168000 -- (-356.805) (-355.838) [-356.816] (-356.065) * [-356.562] (-356.760) (-359.015) (-358.567) -- 0:00:49
      168500 -- (-356.270) (-358.511) (-355.739) [-356.334] * (-357.230) (-356.206) [-356.283] (-361.809) -- 0:00:49
      169000 -- (-356.656) (-357.106) (-360.904) [-357.802] * (-357.370) (-358.841) (-356.689) [-356.596] -- 0:00:49
      169500 -- (-356.027) (-356.958) (-360.071) [-356.343] * (-357.134) (-356.769) (-360.568) [-356.773] -- 0:00:48
      170000 -- [-356.643] (-357.181) (-360.278) (-355.714) * (-357.000) (-361.099) (-360.911) [-356.286] -- 0:00:48

      Average standard deviation of split frequencies: 0.023478

      170500 -- (-357.921) [-357.270] (-358.365) (-356.659) * (-365.432) (-359.935) (-357.150) [-357.164] -- 0:00:53
      171000 -- (-356.973) [-356.380] (-357.989) (-356.091) * (-357.737) (-358.822) [-357.720] (-355.972) -- 0:00:53
      171500 -- (-356.538) (-356.048) [-359.469] (-362.357) * (-355.857) [-358.023] (-358.129) (-355.864) -- 0:00:53
      172000 -- (-361.588) (-359.269) (-357.318) [-356.621] * [-357.620] (-356.685) (-356.051) (-360.111) -- 0:00:52
      172500 -- [-357.381] (-358.750) (-358.387) (-361.498) * (-359.222) [-356.057] (-356.687) (-360.615) -- 0:00:52
      173000 -- (-356.008) (-358.583) [-355.973] (-356.239) * (-356.416) [-359.943] (-355.851) (-357.174) -- 0:00:52
      173500 -- (-358.701) [-361.379] (-358.041) (-355.882) * (-357.506) (-356.498) [-357.113] (-356.762) -- 0:00:52
      174000 -- (-357.427) [-359.101] (-359.441) (-355.340) * (-357.204) (-357.801) [-355.323] (-355.974) -- 0:00:52
      174500 -- (-358.611) (-357.428) [-356.439] (-355.269) * (-358.092) [-355.156] (-356.542) (-361.771) -- 0:00:52
      175000 -- (-356.246) (-357.139) [-359.554] (-361.709) * (-356.886) (-358.700) [-360.427] (-359.368) -- 0:00:51

      Average standard deviation of split frequencies: 0.021005

      175500 -- (-355.568) [-356.619] (-357.700) (-357.247) * (-361.698) (-358.034) [-357.716] (-358.146) -- 0:00:51
      176000 -- (-356.493) (-356.993) [-358.844] (-360.760) * (-356.107) (-358.568) [-356.969] (-356.357) -- 0:00:51
      176500 -- [-357.985] (-360.676) (-358.612) (-356.116) * (-362.826) (-360.417) (-357.009) [-359.370] -- 0:00:51
      177000 -- (-356.783) (-360.139) [-357.917] (-356.179) * (-358.129) (-357.205) (-358.253) [-357.557] -- 0:00:51
      177500 -- (-356.500) (-356.119) (-361.590) [-356.603] * (-357.028) [-355.963] (-356.930) (-358.453) -- 0:00:50
      178000 -- (-355.307) [-356.285] (-359.222) (-356.065) * (-360.550) [-360.222] (-357.896) (-355.938) -- 0:00:50
      178500 -- (-355.624) (-356.319) [-360.838] (-357.720) * [-355.781] (-364.684) (-355.537) (-355.833) -- 0:00:50
      179000 -- (-357.924) (-358.202) [-359.912] (-359.006) * (-360.084) [-361.865] (-357.983) (-357.793) -- 0:00:50
      179500 -- (-357.638) (-361.897) [-358.036] (-360.277) * (-357.904) (-356.754) (-355.712) [-360.269] -- 0:00:50
      180000 -- [-357.196] (-357.485) (-363.515) (-357.394) * [-359.228] (-358.984) (-356.971) (-358.983) -- 0:00:50

      Average standard deviation of split frequencies: 0.021004

      180500 -- [-356.574] (-360.383) (-357.412) (-360.762) * (-359.227) [-357.144] (-355.449) (-357.514) -- 0:00:49
      181000 -- (-355.409) (-359.247) [-356.882] (-360.244) * (-356.489) [-357.611] (-357.660) (-357.088) -- 0:00:49
      181500 -- [-356.267] (-355.960) (-360.367) (-360.121) * (-358.055) (-357.348) [-357.926] (-355.883) -- 0:00:49
      182000 -- (-356.851) [-357.075] (-358.322) (-356.903) * [-356.669] (-363.534) (-355.576) (-359.419) -- 0:00:49
      182500 -- (-357.766) [-357.791] (-361.002) (-357.191) * (-358.677) (-365.935) [-359.707] (-358.300) -- 0:00:49
      183000 -- (-356.939) (-357.704) (-358.181) [-356.672] * [-355.716] (-357.365) (-358.457) (-358.218) -- 0:00:49
      183500 -- (-357.291) (-362.488) (-355.343) [-357.143] * (-356.591) (-357.876) (-358.194) [-357.206] -- 0:00:48
      184000 -- (-358.766) [-356.116] (-356.240) (-359.061) * (-360.962) [-359.880] (-357.302) (-357.081) -- 0:00:48
      184500 -- (-360.079) (-358.539) [-358.098] (-359.066) * (-356.827) (-357.130) (-357.741) [-358.691] -- 0:00:48
      185000 -- (-357.686) [-365.093] (-360.988) (-356.975) * (-360.292) [-357.816] (-360.549) (-355.820) -- 0:00:48

      Average standard deviation of split frequencies: 0.020402

      185500 -- (-355.785) [-356.650] (-362.256) (-357.648) * (-357.221) (-356.603) (-357.939) [-355.318] -- 0:00:48
      186000 -- (-361.336) (-357.619) (-357.591) [-358.371] * (-356.153) (-357.166) [-355.486] (-357.725) -- 0:00:48
      186500 -- (-355.706) [-355.634] (-358.190) (-356.621) * [-359.998] (-360.527) (-355.188) (-360.328) -- 0:00:47
      187000 -- (-359.744) [-359.569] (-357.823) (-357.255) * [-357.788] (-360.052) (-357.979) (-355.611) -- 0:00:52
      187500 -- [-356.803] (-356.457) (-358.423) (-354.964) * (-358.773) (-357.019) (-355.808) [-358.936] -- 0:00:52
      188000 -- (-358.137) (-357.469) (-359.359) [-355.972] * (-359.302) (-356.943) [-360.058] (-357.753) -- 0:00:51
      188500 -- (-361.237) [-357.898] (-356.513) (-356.559) * (-359.021) (-357.871) [-357.303] (-355.839) -- 0:00:51
      189000 -- (-357.769) [-356.898] (-358.103) (-361.259) * (-357.136) (-357.588) [-357.876] (-355.879) -- 0:00:51
      189500 -- [-356.652] (-356.304) (-358.794) (-355.955) * (-356.696) [-357.649] (-356.681) (-355.579) -- 0:00:51
      190000 -- (-358.126) [-356.946] (-363.658) (-356.372) * (-356.441) (-356.695) [-356.278] (-356.149) -- 0:00:51

      Average standard deviation of split frequencies: 0.020026

      190500 -- (-356.360) [-356.927] (-358.019) (-357.173) * (-355.988) (-357.616) (-357.668) [-356.702] -- 0:00:50
      191000 -- [-357.755] (-357.735) (-355.667) (-359.775) * (-356.324) [-354.902] (-355.462) (-358.324) -- 0:00:50
      191500 -- [-356.192] (-361.413) (-356.021) (-355.440) * [-357.732] (-356.445) (-359.779) (-359.732) -- 0:00:50
      192000 -- (-357.619) (-357.378) (-361.103) [-363.521] * (-356.479) (-357.493) [-360.116] (-355.732) -- 0:00:50
      192500 -- [-358.850] (-357.420) (-360.426) (-358.625) * [-356.435] (-360.222) (-361.870) (-357.419) -- 0:00:50
      193000 -- [-357.703] (-362.307) (-358.886) (-356.877) * (-356.073) (-359.738) [-357.830] (-358.355) -- 0:00:50
      193500 -- (-355.047) [-356.674] (-360.944) (-355.428) * [-359.060] (-355.270) (-357.780) (-356.736) -- 0:00:50
      194000 -- (-356.779) [-355.804] (-359.395) (-357.027) * [-356.909] (-355.271) (-362.898) (-356.684) -- 0:00:49
      194500 -- (-355.712) [-356.635] (-357.877) (-356.733) * [-355.753] (-361.575) (-359.848) (-357.282) -- 0:00:49
      195000 -- (-359.712) (-357.462) (-355.158) [-355.727] * [-360.170] (-355.989) (-358.002) (-357.410) -- 0:00:49

      Average standard deviation of split frequencies: 0.020203

      195500 -- (-355.644) (-360.027) (-361.062) [-355.010] * (-358.543) (-357.958) [-356.413] (-359.274) -- 0:00:49
      196000 -- (-358.810) [-356.102] (-357.360) (-357.535) * (-358.043) (-357.591) [-357.433] (-361.113) -- 0:00:49
      196500 -- [-356.046] (-355.563) (-358.557) (-357.991) * (-355.397) (-357.831) [-356.334] (-358.506) -- 0:00:49
      197000 -- [-357.343] (-357.122) (-362.722) (-357.026) * [-357.633] (-358.399) (-358.062) (-359.315) -- 0:00:48
      197500 -- [-356.949] (-359.289) (-358.837) (-355.801) * (-356.780) (-358.939) [-356.864] (-362.325) -- 0:00:48
      198000 -- [-357.481] (-359.052) (-362.268) (-359.463) * (-357.078) (-361.250) [-357.806] (-357.551) -- 0:00:48
      198500 -- (-359.026) [-355.851] (-361.286) (-359.368) * (-364.748) [-357.685] (-355.760) (-356.059) -- 0:00:48
      199000 -- (-357.392) (-355.926) (-357.344) [-355.849] * [-358.759] (-361.728) (-358.895) (-356.042) -- 0:00:48
      199500 -- [-356.994] (-357.721) (-356.065) (-355.323) * [-363.254] (-355.236) (-356.519) (-358.329) -- 0:00:48
      200000 -- (-358.045) [-356.277] (-355.457) (-360.755) * [-361.529] (-356.738) (-356.167) (-355.880) -- 0:00:48

      Average standard deviation of split frequencies: 0.019851

      200500 -- (-356.888) (-356.660) [-356.373] (-359.395) * (-356.798) (-356.186) (-358.554) [-355.214] -- 0:00:47
      201000 -- (-357.354) [-356.034] (-358.397) (-363.012) * (-356.981) (-356.485) [-357.017] (-356.657) -- 0:00:47
      201500 -- [-357.491] (-356.636) (-355.376) (-359.353) * [-359.954] (-358.447) (-358.885) (-357.858) -- 0:00:47
      202000 -- (-357.779) (-359.116) (-357.376) [-359.949] * [-355.304] (-355.910) (-357.980) (-361.040) -- 0:00:47
      202500 -- [-356.925] (-356.719) (-357.546) (-356.673) * (-355.246) (-356.554) (-356.259) [-356.602] -- 0:00:47
      203000 -- (-359.707) (-359.872) [-357.282] (-358.544) * (-356.762) (-355.523) [-356.081] (-358.979) -- 0:00:47
      203500 -- [-355.718] (-358.512) (-359.217) (-358.498) * (-359.462) [-361.265] (-359.161) (-357.514) -- 0:00:50
      204000 -- (-357.151) (-357.100) [-355.894] (-360.975) * [-357.822] (-355.850) (-357.147) (-356.989) -- 0:00:50
      204500 -- (-356.429) (-363.994) [-356.762] (-356.712) * (-356.137) (-358.111) [-356.402] (-356.213) -- 0:00:50
      205000 -- (-355.711) (-357.801) [-357.942] (-358.569) * [-357.229] (-357.543) (-355.585) (-357.670) -- 0:00:50

      Average standard deviation of split frequencies: 0.018536

      205500 -- [-357.772] (-356.809) (-359.471) (-359.671) * (-356.672) [-358.774] (-355.823) (-357.017) -- 0:00:50
      206000 -- (-357.869) [-357.781] (-356.326) (-356.929) * (-358.956) [-357.661] (-355.485) (-357.759) -- 0:00:50
      206500 -- (-355.577) (-356.741) [-356.812] (-359.899) * (-361.207) [-355.900] (-355.593) (-357.733) -- 0:00:49
      207000 -- (-356.100) [-356.027] (-358.182) (-358.507) * (-359.462) [-356.852] (-356.415) (-358.835) -- 0:00:49
      207500 -- (-357.793) (-358.191) [-357.882] (-357.559) * (-359.517) [-357.002] (-359.655) (-356.572) -- 0:00:49
      208000 -- (-358.558) (-356.498) (-357.452) [-357.914] * (-357.616) [-355.295] (-357.735) (-356.412) -- 0:00:49
      208500 -- (-360.861) (-355.413) (-355.989) [-356.699] * [-357.766] (-357.516) (-358.488) (-363.360) -- 0:00:49
      209000 -- (-363.339) (-355.757) [-355.047] (-356.281) * (-358.772) (-357.875) [-362.322] (-357.439) -- 0:00:49
      209500 -- (-359.910) [-356.989] (-356.898) (-357.166) * (-360.192) (-361.016) (-358.936) [-357.060] -- 0:00:49
      210000 -- (-359.156) (-355.828) [-356.154] (-360.001) * (-361.899) (-357.376) (-356.815) [-359.203] -- 0:00:48

      Average standard deviation of split frequencies: 0.018274

      210500 -- (-355.532) (-364.080) [-355.595] (-358.227) * [-355.827] (-356.019) (-360.516) (-357.019) -- 0:00:48
      211000 -- [-356.301] (-360.493) (-355.372) (-355.504) * (-355.170) (-356.461) [-356.794] (-357.972) -- 0:00:48
      211500 -- (-359.593) [-362.715] (-356.270) (-356.236) * (-358.146) [-359.496] (-356.106) (-356.831) -- 0:00:48
      212000 -- (-360.133) (-358.749) [-355.040] (-356.494) * (-359.378) (-361.061) (-357.505) [-357.013] -- 0:00:48
      212500 -- (-357.295) (-361.544) [-354.956] (-360.380) * (-356.359) (-358.512) (-360.639) [-356.545] -- 0:00:48
      213000 -- (-357.734) [-357.939] (-357.042) (-357.074) * (-357.343) (-357.416) [-357.935] (-357.145) -- 0:00:48
      213500 -- (-359.143) [-359.212] (-356.797) (-356.340) * [-357.054] (-363.352) (-357.531) (-357.337) -- 0:00:47
      214000 -- (-355.839) [-355.313] (-357.514) (-358.088) * (-355.780) [-356.589] (-358.252) (-356.066) -- 0:00:47
      214500 -- (-357.584) (-358.611) [-358.459] (-357.023) * [-355.915] (-359.646) (-359.466) (-364.135) -- 0:00:47
      215000 -- (-357.158) [-356.369] (-356.594) (-358.947) * (-356.819) [-357.916] (-359.314) (-359.418) -- 0:00:47

      Average standard deviation of split frequencies: 0.017459

      215500 -- (-357.242) [-358.203] (-356.853) (-356.935) * [-356.521] (-355.518) (-361.240) (-358.179) -- 0:00:47
      216000 -- (-356.785) [-356.488] (-356.623) (-356.932) * (-356.986) [-356.161] (-355.129) (-357.149) -- 0:00:47
      216500 -- (-356.027) [-356.115] (-356.981) (-355.449) * [-357.176] (-355.697) (-358.568) (-357.036) -- 0:00:47
      217000 -- (-356.538) [-357.545] (-356.106) (-356.736) * (-356.943) (-358.863) (-355.739) [-358.338] -- 0:00:46
      217500 -- (-360.327) (-358.903) (-357.253) [-355.237] * (-356.585) [-357.991] (-356.363) (-357.658) -- 0:00:46
      218000 -- [-356.713] (-359.788) (-358.246) (-356.527) * (-356.533) (-358.083) [-356.348] (-357.637) -- 0:00:46
      218500 -- (-358.620) (-358.677) [-358.886] (-358.148) * [-356.996] (-356.534) (-356.092) (-356.325) -- 0:00:46
      219000 -- [-359.698] (-358.670) (-359.042) (-358.674) * (-356.481) (-359.788) [-356.750] (-358.163) -- 0:00:46
      219500 -- (-361.054) (-355.789) (-357.566) [-358.484] * (-356.258) (-357.336) [-357.013] (-355.543) -- 0:00:46
      220000 -- (-358.049) (-357.296) (-359.131) [-361.162] * (-358.338) (-356.993) (-356.185) [-356.425] -- 0:00:46

      Average standard deviation of split frequencies: 0.018277

      220500 -- (-360.146) [-356.263] (-359.607) (-362.259) * (-358.604) [-356.177] (-355.862) (-357.486) -- 0:00:49
      221000 -- [-356.268] (-362.079) (-359.628) (-357.249) * (-356.915) (-356.775) (-360.222) [-356.083] -- 0:00:49
      221500 -- [-356.402] (-358.128) (-357.042) (-356.880) * (-356.602) (-358.465) (-357.481) [-355.322] -- 0:00:49
      222000 -- [-355.460] (-355.794) (-355.518) (-358.213) * [-356.603] (-358.093) (-356.568) (-355.606) -- 0:00:49
      222500 -- (-359.055) (-357.970) (-361.466) [-357.044] * (-356.553) [-355.871] (-357.443) (-363.186) -- 0:00:48
      223000 -- (-358.875) (-359.712) [-357.507] (-357.503) * (-355.606) (-357.446) [-358.759] (-360.642) -- 0:00:48
      223500 -- (-356.900) (-356.754) [-355.518] (-357.157) * (-356.294) [-355.963] (-356.029) (-358.878) -- 0:00:48
      224000 -- (-356.019) (-356.626) (-357.627) [-357.656] * [-357.987] (-357.247) (-357.957) (-356.333) -- 0:00:48
      224500 -- (-359.331) (-356.190) (-356.351) [-360.969] * [-357.635] (-358.002) (-356.948) (-356.808) -- 0:00:48
      225000 -- (-358.726) (-357.269) [-356.429] (-356.329) * (-357.686) (-357.603) [-357.159] (-355.806) -- 0:00:48

      Average standard deviation of split frequencies: 0.017126

      225500 -- [-358.763] (-356.611) (-362.061) (-361.488) * (-359.742) [-355.802] (-358.558) (-361.885) -- 0:00:48
      226000 -- (-356.174) (-360.339) [-358.455] (-356.823) * (-355.942) (-356.999) [-355.423] (-361.037) -- 0:00:47
      226500 -- [-355.758] (-356.933) (-357.911) (-358.316) * (-358.498) (-355.735) [-355.659] (-359.483) -- 0:00:47
      227000 -- (-358.190) (-357.571) [-356.568] (-357.611) * (-359.211) (-357.159) [-356.413] (-356.453) -- 0:00:47
      227500 -- (-357.774) (-361.055) [-355.603] (-362.370) * (-360.947) [-356.898] (-356.166) (-355.686) -- 0:00:47
      228000 -- (-358.812) (-359.323) (-355.874) [-356.330] * (-356.561) [-356.654] (-355.956) (-359.559) -- 0:00:47
      228500 -- (-358.354) (-360.346) [-358.461] (-357.273) * (-358.218) [-357.100] (-358.687) (-357.833) -- 0:00:47
      229000 -- [-360.031] (-358.567) (-358.519) (-358.451) * (-358.941) (-359.624) [-355.485] (-358.448) -- 0:00:47
      229500 -- (-355.994) (-357.847) (-361.887) [-357.122] * (-358.402) (-359.273) [-357.639] (-355.522) -- 0:00:47
      230000 -- (-356.490) [-360.223] (-357.193) (-356.476) * [-357.900] (-357.698) (-356.138) (-355.937) -- 0:00:46

      Average standard deviation of split frequencies: 0.016349

      230500 -- [-358.546] (-355.924) (-355.754) (-358.420) * (-355.936) (-360.431) [-360.555] (-362.019) -- 0:00:46
      231000 -- [-356.982] (-356.688) (-355.684) (-362.724) * (-357.074) [-356.291] (-359.312) (-360.499) -- 0:00:46
      231500 -- (-355.417) (-357.392) (-355.672) [-355.999] * [-355.906] (-357.364) (-355.538) (-357.302) -- 0:00:46
      232000 -- (-356.315) (-356.926) (-361.261) [-356.356] * [-359.501] (-355.882) (-358.623) (-360.076) -- 0:00:46
      232500 -- (-357.283) (-356.228) [-358.808] (-358.416) * (-356.643) [-358.559] (-355.635) (-358.706) -- 0:00:46
      233000 -- (-359.360) [-357.588] (-356.436) (-358.110) * (-357.180) (-359.137) [-357.782] (-361.617) -- 0:00:46
      233500 -- (-356.878) (-357.801) (-360.288) [-356.011] * (-355.265) [-358.443] (-363.572) (-359.360) -- 0:00:45
      234000 -- (-355.596) (-357.185) (-360.108) [-355.707] * (-359.613) (-359.711) (-363.447) [-356.740] -- 0:00:45
      234500 -- (-356.132) (-355.460) [-359.944] (-355.626) * (-359.989) (-355.272) [-357.825] (-357.739) -- 0:00:45
      235000 -- (-355.696) (-359.290) (-358.876) [-356.635] * [-359.870] (-356.633) (-368.037) (-357.700) -- 0:00:45

      Average standard deviation of split frequencies: 0.016646

      235500 -- (-356.144) (-358.561) [-357.073] (-357.707) * [-357.332] (-358.328) (-355.287) (-359.880) -- 0:00:45
      236000 -- (-358.239) (-358.084) [-357.580] (-357.031) * [-357.436] (-357.276) (-359.794) (-356.111) -- 0:00:45
      236500 -- [-357.157] (-355.562) (-359.181) (-359.555) * (-357.986) (-356.885) (-358.730) [-357.286] -- 0:00:45
      237000 -- [-355.452] (-355.123) (-356.040) (-357.748) * (-359.090) (-356.080) [-356.017] (-357.035) -- 0:00:45
      237500 -- (-356.091) (-356.823) (-355.669) [-357.016] * (-356.286) (-356.778) [-357.487] (-357.279) -- 0:00:48
      238000 -- [-355.907] (-356.833) (-357.339) (-360.858) * [-358.535] (-356.352) (-355.478) (-359.082) -- 0:00:48
      238500 -- (-354.953) [-356.909] (-357.654) (-361.337) * (-355.265) (-356.345) [-357.486] (-360.518) -- 0:00:47
      239000 -- (-357.429) (-358.793) [-356.253] (-358.368) * (-357.696) (-357.427) (-357.239) [-355.320] -- 0:00:47
      239500 -- [-356.481] (-358.084) (-356.187) (-359.619) * (-358.211) [-356.174] (-356.400) (-357.056) -- 0:00:47
      240000 -- (-359.747) (-356.072) [-357.065] (-357.340) * (-357.756) (-355.404) [-356.519] (-360.338) -- 0:00:47

      Average standard deviation of split frequencies: 0.016185

      240500 -- (-357.993) [-356.904] (-357.573) (-357.641) * (-361.211) (-356.553) (-357.621) [-356.290] -- 0:00:47
      241000 -- (-361.241) (-359.321) (-357.464) [-362.372] * (-357.019) [-354.987] (-358.603) (-360.052) -- 0:00:47
      241500 -- (-355.626) [-356.144] (-355.549) (-359.537) * (-359.544) (-360.075) (-359.774) [-356.075] -- 0:00:47
      242000 -- [-357.824] (-357.768) (-356.577) (-357.200) * (-356.650) (-358.075) (-358.552) [-355.559] -- 0:00:46
      242500 -- (-357.932) (-355.116) [-357.870] (-356.560) * (-356.431) (-356.695) (-359.485) [-357.042] -- 0:00:46
      243000 -- (-358.048) (-361.170) [-359.592] (-356.746) * (-357.783) (-356.142) (-355.377) [-358.153] -- 0:00:46
      243500 -- (-358.349) (-359.359) [-355.707] (-358.556) * [-358.107] (-357.721) (-355.415) (-355.634) -- 0:00:46
      244000 -- [-355.379] (-356.138) (-359.594) (-355.174) * [-359.453] (-361.259) (-356.192) (-356.321) -- 0:00:46
      244500 -- [-355.845] (-356.890) (-358.420) (-356.363) * [-355.776] (-355.770) (-356.868) (-358.496) -- 0:00:46
      245000 -- [-356.460] (-360.523) (-358.814) (-358.155) * [-357.930] (-355.692) (-358.366) (-359.154) -- 0:00:46

      Average standard deviation of split frequencies: 0.016193

      245500 -- [-357.761] (-357.903) (-356.452) (-359.697) * (-358.459) [-357.073] (-356.317) (-362.351) -- 0:00:46
      246000 -- (-360.527) [-360.707] (-356.714) (-360.262) * (-357.077) (-356.671) [-357.346] (-357.727) -- 0:00:45
      246500 -- [-358.576] (-360.794) (-356.396) (-356.847) * (-359.316) [-357.163] (-358.940) (-355.790) -- 0:00:45
      247000 -- (-356.435) [-356.636] (-356.913) (-359.814) * [-357.599] (-357.869) (-356.353) (-356.827) -- 0:00:45
      247500 -- (-358.908) (-356.934) [-356.192] (-355.790) * (-356.102) [-359.311] (-357.159) (-355.056) -- 0:00:45
      248000 -- (-355.960) [-356.000] (-355.827) (-356.795) * (-357.157) (-358.953) (-356.613) [-356.955] -- 0:00:45
      248500 -- (-357.580) (-357.451) (-357.722) [-356.184] * (-361.154) [-358.374] (-356.994) (-360.206) -- 0:00:45
      249000 -- (-358.865) [-357.330] (-356.345) (-357.463) * (-360.490) (-358.383) (-355.047) [-358.373] -- 0:00:45
      249500 -- (-356.975) [-356.273] (-356.370) (-362.217) * [-357.111] (-361.025) (-356.396) (-357.274) -- 0:00:45
      250000 -- (-357.857) (-359.114) (-360.142) [-357.157] * [-357.228] (-356.473) (-360.864) (-361.420) -- 0:00:45

      Average standard deviation of split frequencies: 0.016035

      250500 -- (-355.365) (-355.593) [-358.162] (-360.762) * (-356.378) (-355.642) [-357.542] (-357.491) -- 0:00:44
      251000 -- (-359.116) (-361.560) (-356.772) [-357.738] * (-356.915) [-355.177] (-357.212) (-356.652) -- 0:00:44
      251500 -- (-360.402) [-355.418] (-359.079) (-356.672) * (-356.258) (-357.828) (-357.125) [-356.537] -- 0:00:44
      252000 -- (-360.144) (-358.435) (-358.928) [-358.130] * (-356.794) (-358.405) [-355.378] (-355.922) -- 0:00:44
      252500 -- (-366.580) (-356.964) (-357.500) [-358.253] * [-358.281] (-356.126) (-356.888) (-356.021) -- 0:00:44
      253000 -- [-363.066] (-356.925) (-355.920) (-360.065) * (-359.802) (-358.131) [-355.880] (-356.715) -- 0:00:44
      253500 -- (-359.147) [-355.777] (-359.809) (-360.997) * [-355.858] (-358.111) (-360.764) (-356.957) -- 0:00:44
      254000 -- (-357.780) [-357.609] (-356.172) (-359.607) * [-357.765] (-360.230) (-356.397) (-355.837) -- 0:00:46
      254500 -- (-357.778) [-356.731] (-356.940) (-356.099) * [-356.332] (-357.296) (-355.992) (-359.848) -- 0:00:46
      255000 -- (-357.601) (-358.845) (-356.100) [-360.480] * [-356.957] (-360.576) (-356.714) (-358.904) -- 0:00:46

      Average standard deviation of split frequencies: 0.015836

      255500 -- (-355.968) [-360.879] (-356.959) (-357.739) * (-357.858) (-357.172) [-356.531] (-356.453) -- 0:00:46
      256000 -- (-356.073) (-359.525) (-357.412) [-358.384] * (-357.535) (-356.010) [-358.220] (-355.205) -- 0:00:46
      256500 -- [-357.697] (-356.508) (-360.589) (-362.214) * (-357.427) [-357.442] (-358.119) (-355.497) -- 0:00:46
      257000 -- (-357.060) [-356.262] (-358.684) (-358.070) * (-358.141) [-357.238] (-356.203) (-359.090) -- 0:00:46
      257500 -- (-356.492) [-356.970] (-358.180) (-360.284) * (-361.552) [-355.163] (-355.921) (-362.140) -- 0:00:46
      258000 -- (-356.226) (-357.015) [-358.110] (-359.583) * (-362.797) (-356.527) [-358.638] (-356.471) -- 0:00:46
      258500 -- (-358.979) (-356.829) [-355.899] (-359.273) * (-355.607) (-359.038) (-359.047) [-357.029] -- 0:00:45
      259000 -- (-355.955) (-357.960) [-355.519] (-358.000) * (-358.898) (-360.264) (-357.912) [-355.770] -- 0:00:45
      259500 -- (-355.281) (-358.210) [-359.714] (-357.136) * (-355.629) (-360.086) (-356.329) [-355.626] -- 0:00:45
      260000 -- (-355.725) (-359.120) (-359.132) [-357.795] * (-357.656) (-356.072) [-357.794] (-358.192) -- 0:00:45

      Average standard deviation of split frequencies: 0.016095

      260500 -- [-357.744] (-358.414) (-360.057) (-357.620) * (-357.300) (-357.086) [-357.874] (-359.537) -- 0:00:45
      261000 -- [-356.766] (-358.517) (-358.927) (-358.157) * (-355.814) (-359.009) (-358.246) [-355.346] -- 0:00:45
      261500 -- (-359.211) (-358.461) [-355.473] (-356.302) * (-356.970) [-356.769] (-362.423) (-355.774) -- 0:00:45
      262000 -- (-360.195) (-355.268) [-356.056] (-357.999) * (-356.560) (-358.347) [-360.852] (-357.757) -- 0:00:45
      262500 -- (-361.067) (-358.162) [-355.599] (-357.554) * (-355.185) (-361.737) (-359.233) [-357.250] -- 0:00:44
      263000 -- (-356.969) (-360.494) (-355.599) [-355.659] * (-355.391) (-356.891) [-356.103] (-355.788) -- 0:00:44
      263500 -- (-355.923) (-357.031) (-356.685) [-356.797] * (-356.830) (-356.559) [-357.459] (-359.790) -- 0:00:44
      264000 -- (-356.272) (-356.814) [-358.055] (-356.472) * (-357.934) (-356.376) [-357.937] (-360.773) -- 0:00:44
      264500 -- (-356.686) [-357.192] (-357.871) (-355.881) * (-360.148) [-355.926] (-356.974) (-357.215) -- 0:00:44
      265000 -- (-355.524) (-358.417) (-357.885) [-356.569] * (-358.395) (-355.832) (-357.381) [-361.205] -- 0:00:44

      Average standard deviation of split frequencies: 0.016514

      265500 -- (-356.321) (-358.845) [-356.060] (-357.271) * (-357.535) (-355.703) [-356.434] (-359.961) -- 0:00:44
      266000 -- (-359.499) (-360.780) [-357.542] (-356.208) * (-357.371) (-355.058) (-358.850) [-358.698] -- 0:00:44
      266500 -- (-356.217) [-356.200] (-357.510) (-358.385) * (-357.291) (-357.612) [-359.231] (-360.603) -- 0:00:44
      267000 -- (-365.201) [-356.601] (-356.301) (-359.085) * [-357.244] (-358.248) (-357.394) (-356.596) -- 0:00:43
      267500 -- (-356.187) (-357.588) [-356.478] (-355.845) * (-356.757) (-358.102) (-361.270) [-356.047] -- 0:00:43
      268000 -- (-355.571) [-358.830] (-356.872) (-356.423) * (-357.086) (-356.224) (-356.717) [-356.858] -- 0:00:43
      268500 -- (-357.694) (-358.857) [-360.597] (-358.593) * [-355.281] (-359.080) (-358.669) (-356.169) -- 0:00:43
      269000 -- (-358.123) (-359.464) (-357.921) [-360.195] * (-358.909) (-357.214) (-357.265) [-356.052] -- 0:00:43
      269500 -- (-359.358) (-356.851) (-358.829) [-359.743] * (-355.645) (-357.768) [-356.601] (-356.514) -- 0:00:43
      270000 -- (-358.358) (-356.144) [-357.896] (-355.963) * (-356.790) (-359.714) [-360.529] (-356.974) -- 0:00:43

      Average standard deviation of split frequencies: 0.016150

      270500 -- [-358.340] (-355.652) (-356.557) (-356.767) * [-357.757] (-359.953) (-355.350) (-357.093) -- 0:00:43
      271000 -- (-355.375) (-361.299) (-357.184) [-357.938] * (-358.338) (-357.092) (-357.198) [-356.541] -- 0:00:43
      271500 -- (-358.012) [-356.073] (-362.072) (-360.661) * (-356.392) (-357.095) (-356.439) [-360.697] -- 0:00:45
      272000 -- (-358.314) (-355.462) [-359.517] (-360.196) * (-356.777) [-360.038] (-356.871) (-356.549) -- 0:00:45
      272500 -- (-359.297) (-357.312) [-357.121] (-359.924) * [-359.267] (-357.098) (-356.994) (-361.320) -- 0:00:45
      273000 -- [-357.913] (-356.539) (-356.127) (-359.051) * [-357.316] (-362.166) (-357.268) (-359.845) -- 0:00:45
      273500 -- (-356.242) (-358.369) (-357.496) [-356.296] * (-356.649) [-358.617] (-356.705) (-356.656) -- 0:00:45
      274000 -- (-357.142) (-356.997) [-355.289] (-355.556) * [-356.419] (-357.794) (-357.082) (-358.982) -- 0:00:45
      274500 -- (-359.261) (-356.063) (-358.675) [-357.240] * (-356.959) [-357.205] (-359.808) (-359.559) -- 0:00:44
      275000 -- (-360.391) (-360.373) [-357.158] (-356.574) * (-356.312) (-360.935) [-357.080] (-355.645) -- 0:00:44

      Average standard deviation of split frequencies: 0.015941

      275500 -- (-361.434) (-356.796) (-356.324) [-357.083] * (-355.397) (-357.952) [-355.005] (-356.347) -- 0:00:44
      276000 -- [-356.599] (-358.594) (-358.654) (-356.575) * (-357.272) [-357.070] (-355.751) (-360.484) -- 0:00:44
      276500 -- (-357.086) [-357.037] (-355.966) (-359.507) * (-359.486) (-358.241) (-357.965) [-360.794] -- 0:00:44
      277000 -- [-356.780] (-356.577) (-358.482) (-361.259) * (-356.478) (-357.219) [-356.034] (-358.973) -- 0:00:44
      277500 -- (-355.936) [-359.555] (-360.048) (-356.530) * (-357.587) (-357.692) (-357.176) [-359.523] -- 0:00:44
      278000 -- [-356.571] (-357.660) (-357.149) (-356.324) * (-361.420) (-357.670) (-358.632) [-356.064] -- 0:00:44
      278500 -- (-355.979) (-357.381) [-358.469] (-356.412) * [-356.858] (-357.120) (-357.914) (-357.589) -- 0:00:44
      279000 -- (-357.909) (-356.434) (-357.349) [-355.032] * (-356.754) [-357.127] (-357.917) (-356.815) -- 0:00:43
      279500 -- [-357.379] (-355.691) (-356.340) (-355.409) * (-356.902) [-362.712] (-359.652) (-356.044) -- 0:00:43
      280000 -- (-356.846) (-356.440) [-357.090] (-357.293) * [-358.420] (-357.496) (-357.861) (-357.097) -- 0:00:43

      Average standard deviation of split frequencies: 0.016208

      280500 -- (-356.915) [-358.054] (-357.024) (-357.341) * (-355.885) (-358.773) [-357.836] (-356.978) -- 0:00:43
      281000 -- (-357.659) (-358.322) [-358.309] (-356.386) * (-356.860) [-357.850] (-357.271) (-358.557) -- 0:00:43
      281500 -- (-356.778) (-357.990) (-356.718) [-357.492] * [-358.858] (-360.184) (-356.984) (-357.325) -- 0:00:43
      282000 -- (-356.000) (-357.448) (-357.530) [-358.415] * [-355.861] (-363.708) (-356.607) (-356.295) -- 0:00:43
      282500 -- (-357.341) (-359.559) (-355.266) [-358.451] * [-355.704] (-356.473) (-358.301) (-357.849) -- 0:00:43
      283000 -- (-355.559) [-358.374] (-356.273) (-356.335) * [-357.585] (-356.844) (-355.932) (-362.477) -- 0:00:43
      283500 -- (-355.710) [-361.128] (-356.644) (-360.712) * (-357.590) (-361.129) [-360.264] (-359.011) -- 0:00:42
      284000 -- (-356.760) (-357.220) [-358.613] (-363.728) * (-356.737) (-356.140) (-360.067) [-358.116] -- 0:00:42
      284500 -- (-356.713) (-358.038) [-357.017] (-361.488) * (-357.287) (-355.327) [-355.540] (-358.290) -- 0:00:42
      285000 -- (-355.258) (-359.345) [-356.554] (-355.933) * [-355.960] (-357.236) (-356.354) (-356.078) -- 0:00:42

      Average standard deviation of split frequencies: 0.016071

      285500 -- (-359.785) (-358.837) (-357.028) [-355.186] * (-357.110) [-358.810] (-357.937) (-355.837) -- 0:00:42
      286000 -- [-358.893] (-357.025) (-361.812) (-359.999) * [-358.765] (-358.841) (-357.619) (-358.391) -- 0:00:42
      286500 -- (-356.396) (-360.960) (-355.657) [-356.166] * [-356.732] (-357.350) (-362.517) (-357.051) -- 0:00:42
      287000 -- (-356.820) (-361.336) (-360.977) [-357.187] * (-355.521) [-355.670] (-355.096) (-355.254) -- 0:00:42
      287500 -- (-356.410) (-357.563) [-356.101] (-358.084) * (-355.376) (-355.771) (-356.794) [-355.879] -- 0:00:42
      288000 -- [-358.660] (-359.085) (-356.237) (-359.145) * (-358.767) (-360.045) (-358.870) [-355.103] -- 0:00:42
      288500 -- (-357.527) [-357.437] (-359.199) (-357.244) * [-357.944] (-357.291) (-356.061) (-356.677) -- 0:00:44
      289000 -- (-355.386) [-360.506] (-359.119) (-356.448) * [-356.802] (-356.043) (-356.150) (-362.887) -- 0:00:44
      289500 -- (-359.452) (-357.332) [-359.158] (-358.332) * (-355.348) [-359.205] (-355.559) (-358.000) -- 0:00:44
      290000 -- (-359.291) [-357.390] (-358.216) (-357.362) * [-356.629] (-357.991) (-356.511) (-359.904) -- 0:00:44

      Average standard deviation of split frequencies: 0.015962

      290500 -- (-360.284) (-358.473) (-359.510) [-355.903] * [-355.697] (-355.749) (-357.118) (-356.372) -- 0:00:43
      291000 -- (-356.595) (-356.702) (-356.136) [-356.509] * (-357.175) (-356.137) (-357.194) [-357.747] -- 0:00:43
      291500 -- (-358.550) [-356.642] (-356.381) (-357.905) * [-360.930] (-357.913) (-360.611) (-356.388) -- 0:00:43
      292000 -- (-360.194) [-359.619] (-356.906) (-355.170) * (-358.159) (-356.002) [-359.464] (-356.350) -- 0:00:43
      292500 -- (-360.166) [-356.766] (-356.199) (-356.218) * (-358.085) [-355.901] (-356.865) (-356.750) -- 0:00:43
      293000 -- [-356.301] (-358.976) (-356.668) (-356.261) * (-355.928) (-362.336) [-358.207] (-357.362) -- 0:00:43
      293500 -- (-357.982) [-360.125] (-360.554) (-356.362) * (-357.884) [-356.335] (-358.357) (-356.896) -- 0:00:43
      294000 -- (-358.654) (-361.788) [-358.341] (-357.524) * [-357.415] (-361.975) (-360.215) (-356.600) -- 0:00:43
      294500 -- (-359.941) [-355.609] (-361.513) (-356.718) * [-357.611] (-355.080) (-356.946) (-357.993) -- 0:00:43
      295000 -- (-361.278) [-357.186] (-355.442) (-360.415) * (-356.351) [-361.214] (-357.738) (-358.432) -- 0:00:43

      Average standard deviation of split frequencies: 0.016191

      295500 -- (-355.586) (-358.325) [-357.358] (-355.420) * (-358.392) [-356.141] (-355.884) (-356.652) -- 0:00:42
      296000 -- (-357.627) (-359.331) [-355.991] (-356.727) * (-359.155) (-357.902) (-357.057) [-355.500] -- 0:00:42
      296500 -- (-357.294) (-355.825) [-357.283] (-357.953) * (-358.900) [-358.887] (-359.686) (-358.676) -- 0:00:42
      297000 -- (-356.606) (-361.148) [-356.605] (-356.857) * (-356.778) [-356.626] (-357.129) (-356.303) -- 0:00:42
      297500 -- [-355.598] (-357.597) (-355.320) (-356.343) * (-356.174) (-359.284) [-355.457] (-357.933) -- 0:00:42
      298000 -- [-355.251] (-356.888) (-355.907) (-356.672) * [-355.571] (-358.703) (-358.245) (-356.840) -- 0:00:42
      298500 -- (-356.006) (-355.984) [-356.795] (-356.127) * (-357.678) (-356.366) (-356.468) [-355.876] -- 0:00:42
      299000 -- [-357.792] (-357.756) (-356.055) (-357.248) * [-357.820] (-357.641) (-360.595) (-357.105) -- 0:00:42
      299500 -- (-357.592) (-356.680) (-356.667) [-356.004] * [-359.182] (-355.790) (-355.410) (-358.774) -- 0:00:42
      300000 -- (-357.236) [-356.704] (-357.174) (-357.217) * [-355.304] (-358.441) (-355.313) (-359.524) -- 0:00:42

      Average standard deviation of split frequencies: 0.015844

      300500 -- (-356.066) [-356.368] (-358.242) (-356.151) * (-357.416) (-356.891) [-356.934] (-360.578) -- 0:00:41
      301000 -- [-358.434] (-360.626) (-356.681) (-356.997) * (-356.614) (-358.423) [-355.852] (-357.318) -- 0:00:41
      301500 -- (-356.785) [-355.914] (-357.693) (-360.212) * (-356.401) (-358.533) (-359.605) [-356.250] -- 0:00:41
      302000 -- (-358.980) [-360.171] (-357.593) (-360.463) * [-361.125] (-356.013) (-361.267) (-358.211) -- 0:00:41
      302500 -- (-358.033) (-361.005) [-360.436] (-356.334) * (-355.567) (-362.520) [-357.331] (-358.988) -- 0:00:41
      303000 -- (-359.059) [-356.175] (-356.708) (-356.224) * (-357.125) (-358.042) (-358.336) [-356.511] -- 0:00:41
      303500 -- (-357.314) [-360.782] (-356.559) (-357.865) * [-357.562] (-358.427) (-356.099) (-358.807) -- 0:00:41
      304000 -- (-360.949) (-356.958) (-356.166) [-356.827] * (-356.088) (-358.908) (-361.547) [-356.954] -- 0:00:41
      304500 -- (-359.465) (-358.418) (-356.358) [-357.705] * (-362.081) [-360.380] (-359.517) (-357.077) -- 0:00:41
      305000 -- (-358.375) (-361.189) (-356.448) [-356.426] * (-358.236) (-357.070) (-356.964) [-360.508] -- 0:00:41

      Average standard deviation of split frequencies: 0.015251

      305500 -- (-357.713) (-361.668) [-356.718] (-357.912) * (-357.602) (-359.330) [-356.544] (-357.588) -- 0:00:43
      306000 -- (-362.046) (-357.790) (-357.903) [-357.366] * [-356.708] (-359.942) (-358.110) (-358.047) -- 0:00:43
      306500 -- [-359.983] (-356.221) (-361.091) (-355.955) * (-355.040) (-358.147) [-360.797] (-357.274) -- 0:00:42
      307000 -- (-357.718) (-355.649) (-356.028) [-355.886] * (-358.113) [-357.407] (-358.033) (-361.850) -- 0:00:42
      307500 -- (-357.011) (-358.119) (-357.622) [-357.426] * (-356.186) (-358.205) [-356.587] (-356.030) -- 0:00:42
      308000 -- (-355.694) [-356.388] (-357.249) (-356.131) * (-356.436) (-361.392) (-359.414) [-357.967] -- 0:00:42
      308500 -- (-359.405) (-356.400) (-357.186) [-356.621] * [-357.525] (-357.152) (-356.796) (-359.512) -- 0:00:42
      309000 -- (-355.669) [-357.745] (-355.102) (-359.440) * (-356.273) (-358.654) (-359.202) [-357.763] -- 0:00:42
      309500 -- (-357.418) (-356.986) [-356.690] (-356.496) * (-357.549) [-357.194] (-356.390) (-356.133) -- 0:00:42
      310000 -- (-361.786) (-359.008) [-356.182] (-359.189) * (-356.502) [-356.741] (-356.745) (-358.970) -- 0:00:42

      Average standard deviation of split frequencies: 0.013257

      310500 -- (-360.092) (-360.362) (-356.920) [-358.562] * (-355.108) (-359.534) (-356.412) [-358.171] -- 0:00:42
      311000 -- (-363.258) (-356.908) (-356.610) [-358.077] * (-359.763) (-357.819) [-357.977] (-357.274) -- 0:00:42
      311500 -- (-358.064) [-357.344] (-361.244) (-360.379) * (-357.060) (-357.172) (-356.308) [-356.180] -- 0:00:41
      312000 -- (-356.608) [-357.065] (-357.852) (-357.226) * (-356.888) [-357.032] (-360.906) (-358.162) -- 0:00:41
      312500 -- (-357.807) (-357.232) (-361.795) [-357.031] * (-355.742) [-356.721] (-360.174) (-361.021) -- 0:00:41
      313000 -- (-356.793) (-354.984) (-357.146) [-357.286] * (-356.677) [-355.900] (-356.804) (-358.361) -- 0:00:41
      313500 -- (-356.140) (-367.911) [-359.521] (-355.530) * (-355.484) (-356.519) [-358.265] (-357.992) -- 0:00:41
      314000 -- (-357.252) (-359.716) (-357.892) [-359.110] * [-356.148] (-357.451) (-357.924) (-358.879) -- 0:00:41
      314500 -- (-354.904) (-359.390) [-355.848] (-355.505) * (-358.402) (-356.713) (-357.216) [-357.196] -- 0:00:41
      315000 -- (-357.959) (-358.922) (-359.131) [-355.631] * (-357.786) [-362.386] (-357.243) (-358.349) -- 0:00:41

      Average standard deviation of split frequencies: 0.015084

      315500 -- [-357.375] (-356.097) (-355.530) (-357.213) * [-356.004] (-358.789) (-360.072) (-356.289) -- 0:00:41
      316000 -- (-355.795) (-355.497) [-354.964] (-358.427) * [-356.358] (-359.854) (-356.124) (-357.964) -- 0:00:41
      316500 -- (-356.265) [-357.833] (-361.823) (-362.624) * (-357.397) [-356.472] (-362.775) (-355.682) -- 0:00:41
      317000 -- [-355.497] (-357.393) (-358.175) (-360.666) * (-361.141) (-356.599) [-358.731] (-359.648) -- 0:00:40
      317500 -- (-355.419) (-361.152) (-355.962) [-358.538] * [-357.515] (-356.873) (-357.379) (-360.989) -- 0:00:40
      318000 -- [-357.879] (-358.709) (-356.214) (-359.125) * [-357.752] (-356.717) (-361.575) (-355.462) -- 0:00:40
      318500 -- (-356.630) (-357.552) (-357.465) [-357.079] * (-360.594) (-356.694) (-355.528) [-358.845] -- 0:00:40
      319000 -- [-364.465] (-357.681) (-356.835) (-356.593) * (-356.716) (-357.896) [-360.328] (-360.492) -- 0:00:40
      319500 -- (-358.298) [-357.111] (-355.929) (-357.990) * (-359.072) (-356.503) [-358.276] (-357.243) -- 0:00:40
      320000 -- [-357.526] (-356.112) (-355.130) (-357.056) * (-355.627) (-357.912) (-357.650) [-358.422] -- 0:00:40

      Average standard deviation of split frequencies: 0.013577

      320500 -- [-359.255] (-357.127) (-357.833) (-356.543) * (-358.357) (-358.041) (-357.084) [-357.030] -- 0:00:40
      321000 -- (-356.907) (-357.095) [-359.238] (-356.895) * (-360.836) (-356.692) (-358.002) [-355.755] -- 0:00:40
      321500 -- (-357.067) [-356.427] (-357.266) (-355.691) * (-358.152) [-357.528] (-358.871) (-359.654) -- 0:00:40
      322000 -- (-358.214) (-358.062) (-357.989) [-357.510] * (-355.998) [-357.408] (-355.978) (-359.362) -- 0:00:42
      322500 -- (-357.664) [-359.631] (-359.096) (-356.007) * [-356.526] (-360.061) (-357.653) (-355.290) -- 0:00:42
      323000 -- (-355.929) [-357.218] (-358.156) (-356.087) * (-362.136) [-358.130] (-357.563) (-356.492) -- 0:00:41
      323500 -- (-356.785) [-358.364] (-359.520) (-358.144) * (-359.782) [-361.883] (-356.419) (-359.483) -- 0:00:41
      324000 -- (-357.433) [-358.304] (-363.603) (-357.487) * (-357.379) (-359.149) (-356.464) [-358.581] -- 0:00:41
      324500 -- [-356.935] (-359.764) (-367.316) (-358.101) * (-359.462) (-356.874) (-357.759) [-358.270] -- 0:00:41
      325000 -- (-358.731) (-356.799) [-358.699] (-356.570) * (-361.266) (-363.324) (-356.376) [-359.107] -- 0:00:41

      Average standard deviation of split frequencies: 0.015111

      325500 -- (-357.126) (-356.418) (-362.239) [-358.537] * [-358.250] (-358.210) (-356.137) (-357.317) -- 0:00:41
      326000 -- [-357.108] (-355.241) (-361.672) (-355.286) * (-355.145) [-356.339] (-358.282) (-356.038) -- 0:00:41
      326500 -- [-356.870] (-355.873) (-357.596) (-356.428) * [-358.491] (-356.529) (-355.346) (-356.203) -- 0:00:41
      327000 -- (-356.615) [-356.609] (-356.669) (-357.676) * (-359.455) (-356.057) (-356.248) [-355.712] -- 0:00:41
      327500 -- (-357.772) (-355.289) (-358.999) [-357.196] * (-355.951) (-356.439) (-361.012) [-355.250] -- 0:00:41
      328000 -- (-357.393) (-355.839) [-360.339] (-356.449) * (-359.764) (-357.686) (-357.548) [-361.319] -- 0:00:40
      328500 -- (-362.361) (-356.047) [-356.444] (-356.379) * (-359.620) [-356.102] (-359.316) (-358.060) -- 0:00:40
      329000 -- (-358.421) [-361.276] (-356.866) (-360.933) * [-356.856] (-358.735) (-356.686) (-358.744) -- 0:00:40
      329500 -- [-358.366] (-356.757) (-357.556) (-355.943) * [-358.257] (-357.865) (-357.281) (-361.237) -- 0:00:40
      330000 -- (-357.744) [-359.252] (-357.039) (-356.571) * (-361.558) (-358.122) [-357.154] (-357.791) -- 0:00:40

      Average standard deviation of split frequencies: 0.015907

      330500 -- [-356.502] (-359.277) (-356.161) (-356.841) * (-358.703) (-358.967) [-355.496] (-357.695) -- 0:00:40
      331000 -- (-357.263) (-356.926) (-356.453) [-356.453] * (-358.091) (-360.728) (-360.641) [-357.105] -- 0:00:40
      331500 -- (-358.033) (-356.047) [-358.610] (-357.611) * (-361.515) (-357.931) (-355.407) [-361.943] -- 0:00:40
      332000 -- [-357.107] (-355.829) (-358.486) (-359.070) * (-359.759) [-356.454] (-358.773) (-360.136) -- 0:00:40
      332500 -- [-355.272] (-356.991) (-358.012) (-357.344) * (-358.040) (-360.020) [-358.927] (-357.198) -- 0:00:40
      333000 -- [-355.932] (-355.710) (-363.572) (-357.105) * [-358.474] (-360.154) (-356.217) (-355.468) -- 0:00:40
      333500 -- [-356.148] (-356.255) (-356.991) (-358.868) * (-358.409) (-359.616) (-357.747) [-358.157] -- 0:00:39
      334000 -- (-355.984) (-357.712) (-359.240) [-357.480] * (-359.092) [-359.928] (-354.929) (-357.619) -- 0:00:39
      334500 -- [-356.053] (-357.719) (-358.439) (-355.685) * (-357.076) [-358.207] (-356.240) (-357.504) -- 0:00:39
      335000 -- (-357.622) (-357.461) (-356.458) [-356.499] * (-358.694) [-360.293] (-357.178) (-358.065) -- 0:00:39

      Average standard deviation of split frequencies: 0.015728

      335500 -- (-355.513) (-358.344) [-359.693] (-358.576) * [-356.174] (-360.720) (-356.753) (-358.099) -- 0:00:39
      336000 -- (-356.639) (-359.365) [-357.903] (-355.254) * [-357.526] (-358.119) (-355.611) (-357.731) -- 0:00:39
      336500 -- [-356.036] (-358.865) (-355.695) (-357.552) * (-362.572) (-358.516) [-359.248] (-357.953) -- 0:00:39
      337000 -- (-359.707) (-356.184) [-358.295] (-356.770) * (-359.741) (-355.510) (-359.431) [-355.881] -- 0:00:39
      337500 -- (-358.270) (-357.071) [-355.448] (-359.409) * (-357.949) (-358.571) [-359.733] (-362.594) -- 0:00:39
      338000 -- [-356.590] (-357.001) (-355.366) (-355.598) * (-356.658) (-360.130) [-355.408] (-362.294) -- 0:00:39
      338500 -- (-355.825) [-357.601] (-356.736) (-358.209) * (-356.000) (-356.425) [-356.721] (-358.655) -- 0:00:39
      339000 -- (-358.000) (-355.887) (-356.244) [-355.686] * (-362.454) [-355.862] (-357.425) (-356.604) -- 0:00:40
      339500 -- (-358.456) (-359.758) [-358.366] (-355.043) * (-367.467) (-357.036) [-356.425] (-356.009) -- 0:00:40
      340000 -- (-356.577) [-363.128] (-357.069) (-356.207) * (-357.585) (-357.078) [-356.239] (-357.674) -- 0:00:40

      Average standard deviation of split frequencies: 0.015836

      340500 -- [-357.442] (-359.054) (-359.293) (-361.505) * [-357.398] (-356.126) (-356.127) (-357.461) -- 0:00:40
      341000 -- (-357.485) (-357.379) [-356.653] (-355.480) * [-358.872] (-358.955) (-357.118) (-355.599) -- 0:00:40
      341500 -- (-358.388) [-357.593] (-356.891) (-355.635) * (-361.197) [-355.987] (-358.404) (-356.047) -- 0:00:40
      342000 -- (-359.139) (-355.731) (-357.568) [-357.614] * (-358.502) (-357.683) (-358.872) [-356.423] -- 0:00:40
      342500 -- [-356.176] (-357.707) (-356.352) (-362.814) * [-358.536] (-355.944) (-359.067) (-356.600) -- 0:00:40
      343000 -- (-356.973) [-357.423] (-355.603) (-358.223) * [-356.448] (-357.716) (-358.070) (-357.526) -- 0:00:40
      343500 -- (-359.591) [-356.639] (-356.190) (-357.343) * (-359.129) (-357.131) (-356.902) [-359.320] -- 0:00:40
      344000 -- (-359.862) [-357.158] (-356.697) (-361.770) * (-356.291) [-358.121] (-357.022) (-361.079) -- 0:00:40
      344500 -- (-357.075) (-355.153) [-359.957] (-356.939) * (-361.091) [-357.226] (-358.802) (-358.285) -- 0:00:39
      345000 -- (-359.073) [-357.785] (-359.538) (-356.160) * (-357.796) (-357.431) [-355.549] (-355.715) -- 0:00:39

      Average standard deviation of split frequencies: 0.016206

      345500 -- (-355.569) (-357.003) (-359.797) [-355.690] * (-357.599) (-357.821) (-358.524) [-357.745] -- 0:00:39
      346000 -- (-355.760) [-356.389] (-357.980) (-355.533) * (-356.102) [-357.275] (-361.724) (-356.555) -- 0:00:39
      346500 -- [-358.959] (-356.823) (-357.679) (-357.193) * [-356.752] (-357.063) (-362.649) (-356.966) -- 0:00:39
      347000 -- (-357.242) (-358.165) [-356.659] (-355.651) * (-357.942) (-357.840) [-357.927] (-360.569) -- 0:00:39
      347500 -- (-357.886) [-356.843] (-361.649) (-358.362) * (-358.443) [-357.168] (-355.442) (-358.143) -- 0:00:39
      348000 -- (-356.383) (-361.630) [-358.797] (-357.313) * (-357.434) (-355.499) [-355.343] (-358.620) -- 0:00:39
      348500 -- [-358.057] (-356.032) (-358.041) (-358.093) * (-357.010) (-357.533) (-361.788) [-358.502] -- 0:00:39
      349000 -- (-356.117) (-358.370) [-359.809] (-358.541) * (-359.210) (-356.410) [-358.959] (-362.991) -- 0:00:39
      349500 -- (-356.207) [-355.567] (-356.510) (-357.676) * (-357.302) (-360.012) [-360.291] (-358.937) -- 0:00:39
      350000 -- [-356.329] (-358.300) (-355.790) (-357.386) * (-355.572) (-358.635) (-358.391) [-355.520] -- 0:00:39

      Average standard deviation of split frequencies: 0.016485

      350500 -- [-359.696] (-356.872) (-356.052) (-357.007) * (-355.835) [-355.500] (-356.817) (-357.819) -- 0:00:38
      351000 -- (-357.216) [-357.734] (-358.281) (-357.848) * [-358.789] (-355.532) (-356.274) (-362.783) -- 0:00:38
      351500 -- (-359.824) [-356.582] (-357.123) (-357.022) * (-356.911) (-359.145) [-356.657] (-360.689) -- 0:00:38
      352000 -- (-356.611) (-356.451) [-358.003] (-357.589) * (-357.460) [-359.677] (-356.983) (-358.708) -- 0:00:38
      352500 -- [-355.360] (-356.259) (-361.243) (-355.884) * (-355.816) (-359.796) [-359.938] (-357.061) -- 0:00:38
      353000 -- (-362.018) (-358.685) (-357.573) [-356.822] * [-357.218] (-360.047) (-357.801) (-360.536) -- 0:00:38
      353500 -- (-360.551) (-356.841) (-366.733) [-355.120] * (-358.035) (-358.511) [-357.640] (-357.004) -- 0:00:38
      354000 -- (-356.782) (-358.024) (-361.357) [-358.432] * [-359.075] (-367.508) (-359.334) (-364.802) -- 0:00:38
      354500 -- [-357.420] (-360.392) (-357.472) (-357.790) * (-356.916) (-355.650) [-355.674] (-361.491) -- 0:00:38
      355000 -- (-358.980) [-359.217] (-360.376) (-358.065) * (-360.364) (-356.017) [-355.562] (-357.079) -- 0:00:38

      Average standard deviation of split frequencies: 0.016587

      355500 -- (-356.981) (-358.084) (-356.191) [-356.162] * (-357.271) (-355.683) (-357.275) [-356.220] -- 0:00:38
      356000 -- (-358.147) (-356.961) (-356.577) [-356.560] * (-358.286) [-359.629] (-355.205) (-357.288) -- 0:00:39
      356500 -- (-356.979) (-357.549) [-357.039] (-357.431) * (-356.973) [-358.804] (-356.088) (-355.077) -- 0:00:39
      357000 -- (-356.678) (-359.668) (-356.344) [-357.587] * (-357.212) (-356.803) [-355.515] (-355.548) -- 0:00:39
      357500 -- (-359.306) [-358.916] (-357.127) (-358.798) * (-355.950) (-355.738) (-356.057) [-357.745] -- 0:00:39
      358000 -- (-356.675) (-359.910) [-355.572] (-357.716) * (-356.241) (-355.753) (-359.578) [-355.617] -- 0:00:39
      358500 -- (-356.961) (-359.760) [-356.315] (-356.858) * [-356.262] (-360.913) (-361.381) (-358.922) -- 0:00:39
      359000 -- (-356.626) [-358.130] (-357.336) (-357.697) * (-356.038) (-360.386) [-357.272] (-358.187) -- 0:00:39
      359500 -- (-357.801) (-356.310) (-356.226) [-357.083] * [-358.105] (-363.984) (-356.969) (-355.853) -- 0:00:39
      360000 -- (-357.628) [-357.318] (-357.262) (-360.553) * [-357.617] (-356.968) (-356.985) (-358.498) -- 0:00:39

      Average standard deviation of split frequencies: 0.015612

      360500 -- (-355.663) (-356.744) (-357.213) [-359.880] * (-358.736) [-356.103] (-355.082) (-358.015) -- 0:00:39
      361000 -- [-355.933] (-358.822) (-357.952) (-357.111) * (-356.264) (-357.758) [-355.494] (-357.775) -- 0:00:38
      361500 -- (-356.761) (-357.690) [-358.199] (-357.378) * (-357.014) [-361.644] (-357.327) (-355.405) -- 0:00:38
      362000 -- (-359.826) (-358.450) [-358.807] (-356.220) * (-358.279) (-356.873) [-360.856] (-357.868) -- 0:00:38
      362500 -- (-361.878) (-362.116) (-356.901) [-356.699] * (-359.107) (-357.507) [-360.084] (-360.752) -- 0:00:38
      363000 -- [-357.131] (-357.677) (-360.488) (-357.270) * (-358.302) (-356.193) [-358.041] (-356.003) -- 0:00:38
      363500 -- [-355.650] (-356.250) (-362.600) (-359.410) * [-356.490] (-359.061) (-357.139) (-357.396) -- 0:00:38
      364000 -- [-356.939] (-356.355) (-365.806) (-358.230) * [-359.859] (-357.653) (-356.297) (-359.106) -- 0:00:38
      364500 -- (-359.491) [-355.799] (-356.669) (-357.138) * (-357.739) (-356.001) [-358.694] (-356.228) -- 0:00:38
      365000 -- [-357.053] (-357.615) (-357.914) (-362.401) * (-359.148) (-356.401) [-356.796] (-358.600) -- 0:00:38

      Average standard deviation of split frequencies: 0.015527

      365500 -- [-356.815] (-360.627) (-359.898) (-356.721) * (-358.056) [-355.765] (-358.955) (-357.875) -- 0:00:38
      366000 -- (-358.236) (-356.548) [-357.180] (-356.913) * (-359.190) [-357.503] (-358.606) (-358.164) -- 0:00:38
      366500 -- (-359.851) (-356.928) (-360.864) [-359.912] * (-355.571) (-358.236) [-357.527] (-360.366) -- 0:00:38
      367000 -- (-356.769) (-358.104) [-359.736] (-359.206) * (-355.529) [-357.974] (-357.145) (-357.480) -- 0:00:37
      367500 -- (-358.117) [-363.329] (-356.144) (-356.459) * [-356.041] (-359.564) (-356.189) (-360.836) -- 0:00:37
      368000 -- (-357.847) (-359.905) [-357.232] (-361.802) * [-359.717] (-360.272) (-355.450) (-358.315) -- 0:00:37
      368500 -- (-356.409) (-357.852) (-356.566) [-359.961] * (-361.178) [-358.231] (-356.552) (-359.286) -- 0:00:37
      369000 -- (-356.569) (-356.793) (-359.545) [-356.071] * (-358.697) (-357.143) [-355.556] (-355.456) -- 0:00:37
      369500 -- (-357.185) [-358.901] (-357.306) (-359.476) * [-356.279] (-357.042) (-356.208) (-355.538) -- 0:00:37
      370000 -- (-356.371) [-356.320] (-355.594) (-355.649) * (-357.030) (-357.935) [-356.374] (-356.248) -- 0:00:37

      Average standard deviation of split frequencies: 0.014943

      370500 -- (-357.790) [-357.876] (-358.673) (-357.706) * (-356.180) (-356.071) [-356.553] (-357.231) -- 0:00:37
      371000 -- (-359.568) [-356.067] (-366.884) (-357.205) * (-358.540) (-356.960) (-355.632) [-359.003] -- 0:00:37
      371500 -- (-357.139) [-356.882] (-359.250) (-364.329) * (-357.628) (-357.061) [-356.276] (-357.504) -- 0:00:37
      372000 -- (-357.190) [-356.608] (-356.665) (-357.314) * [-356.154] (-357.595) (-357.877) (-357.539) -- 0:00:37
      372500 -- (-356.745) [-358.818] (-357.699) (-356.028) * (-359.110) [-358.447] (-362.007) (-363.953) -- 0:00:37
      373000 -- [-359.245] (-359.684) (-361.325) (-355.168) * (-362.579) [-355.890] (-355.157) (-363.791) -- 0:00:38
      373500 -- [-357.553] (-364.273) (-356.619) (-357.763) * (-361.264) (-356.385) [-355.316] (-362.769) -- 0:00:38
      374000 -- [-357.106] (-360.789) (-358.923) (-355.644) * (-360.516) [-355.849] (-355.410) (-358.253) -- 0:00:38
      374500 -- (-357.396) [-359.458] (-358.116) (-356.369) * (-357.045) (-355.690) (-359.129) [-358.026] -- 0:00:38
      375000 -- [-360.878] (-357.683) (-355.780) (-359.251) * (-355.606) (-356.287) (-356.843) [-361.915] -- 0:00:38

      Average standard deviation of split frequencies: 0.014653

      375500 -- (-356.855) [-357.132] (-355.958) (-357.090) * [-360.119] (-361.992) (-357.258) (-359.181) -- 0:00:38
      376000 -- (-357.703) (-357.512) [-357.758] (-356.622) * [-357.263] (-359.443) (-355.750) (-357.540) -- 0:00:38
      376500 -- (-359.889) [-358.414] (-356.018) (-359.162) * (-359.641) (-356.953) (-359.391) [-356.489] -- 0:00:38
      377000 -- (-357.536) [-358.118] (-359.791) (-359.457) * (-355.932) (-357.768) (-356.868) [-355.851] -- 0:00:38
      377500 -- [-356.662] (-356.494) (-360.098) (-360.062) * (-361.437) (-360.344) (-359.613) [-356.079] -- 0:00:37
      378000 -- (-359.367) [-356.827] (-362.897) (-358.763) * [-356.645] (-355.750) (-357.516) (-358.225) -- 0:00:37
      378500 -- (-357.349) (-356.920) [-358.763] (-355.872) * (-356.325) [-356.243] (-355.497) (-359.163) -- 0:00:37
      379000 -- (-358.946) [-355.765] (-359.554) (-356.149) * [-355.317] (-356.555) (-356.592) (-357.149) -- 0:00:37
      379500 -- (-358.901) [-356.339] (-356.372) (-356.663) * (-357.289) [-357.878] (-358.726) (-356.085) -- 0:00:37
      380000 -- (-360.698) [-356.257] (-356.309) (-355.153) * [-357.803] (-356.814) (-363.175) (-357.558) -- 0:00:37

      Average standard deviation of split frequencies: 0.015402

      380500 -- [-357.823] (-355.218) (-356.089) (-355.282) * [-357.792] (-355.132) (-356.678) (-357.488) -- 0:00:37
      381000 -- (-357.515) (-355.991) [-355.730] (-355.929) * (-355.543) (-355.462) [-355.609] (-357.736) -- 0:00:37
      381500 -- (-357.534) [-357.600] (-356.483) (-356.790) * (-356.827) (-356.170) [-356.409] (-355.617) -- 0:00:37
      382000 -- (-358.047) (-359.159) [-357.828] (-358.692) * (-356.974) (-355.739) [-356.630] (-356.797) -- 0:00:37
      382500 -- [-357.425] (-356.725) (-359.788) (-356.146) * (-356.649) (-355.514) [-356.447] (-358.724) -- 0:00:37
      383000 -- (-358.901) [-359.957] (-357.253) (-363.162) * [-356.384] (-359.508) (-355.914) (-355.451) -- 0:00:37
      383500 -- (-356.944) [-356.328] (-358.808) (-356.416) * (-355.943) (-359.463) [-356.803] (-357.180) -- 0:00:36
      384000 -- [-355.701] (-359.128) (-357.071) (-357.478) * (-357.536) (-359.047) [-356.987] (-357.815) -- 0:00:36
      384500 -- (-357.154) (-356.480) [-357.085] (-359.114) * [-357.827] (-359.165) (-356.056) (-359.488) -- 0:00:36
      385000 -- (-356.360) (-357.416) [-355.254] (-360.636) * [-359.483] (-358.886) (-355.652) (-355.858) -- 0:00:36

      Average standard deviation of split frequencies: 0.015661

      385500 -- (-356.356) (-359.198) [-356.419] (-356.229) * (-355.848) (-357.883) [-356.176] (-355.640) -- 0:00:36
      386000 -- [-356.210] (-359.099) (-359.695) (-357.880) * (-357.069) (-358.331) (-355.633) [-355.590] -- 0:00:36
      386500 -- [-356.120] (-357.726) (-355.368) (-357.856) * (-362.975) (-356.556) [-356.592] (-361.161) -- 0:00:36
      387000 -- (-357.688) (-356.812) (-359.946) [-357.748] * (-356.231) (-358.001) [-355.789] (-361.775) -- 0:00:36
      387500 -- (-359.358) (-358.719) [-355.328] (-359.134) * [-361.391] (-362.192) (-355.674) (-357.355) -- 0:00:36
      388000 -- (-358.237) [-358.408] (-357.269) (-360.217) * (-358.040) (-357.279) [-355.463] (-358.302) -- 0:00:36
      388500 -- (-355.917) (-355.307) (-355.774) [-355.843] * [-361.154] (-357.769) (-356.518) (-358.019) -- 0:00:36
      389000 -- (-357.717) (-355.781) [-357.812] (-357.923) * (-357.667) [-356.125] (-357.502) (-360.599) -- 0:00:36
      389500 -- (-356.200) [-357.291] (-356.191) (-358.003) * (-356.787) (-363.453) (-358.611) [-355.928] -- 0:00:36
      390000 -- [-356.371] (-359.877) (-359.606) (-357.548) * (-357.428) (-359.625) (-356.425) [-356.308] -- 0:00:37

      Average standard deviation of split frequencies: 0.015261

      390500 -- (-358.953) (-359.562) [-356.349] (-358.104) * (-357.455) [-356.231] (-357.539) (-357.577) -- 0:00:37
      391000 -- [-358.701] (-356.996) (-357.278) (-359.357) * (-357.244) (-355.926) [-358.606] (-356.480) -- 0:00:37
      391500 -- (-358.783) (-355.228) (-357.473) [-356.328] * (-356.737) [-357.132] (-360.288) (-358.901) -- 0:00:37
      392000 -- (-357.146) (-356.508) (-359.155) [-357.276] * (-357.096) (-357.892) [-358.153] (-357.481) -- 0:00:37
      392500 -- [-356.789] (-362.166) (-360.638) (-356.400) * (-358.640) [-355.725] (-356.194) (-361.010) -- 0:00:37
      393000 -- [-357.597] (-358.021) (-356.877) (-362.294) * (-358.260) [-358.648] (-358.777) (-355.355) -- 0:00:37
      393500 -- [-360.538] (-356.563) (-356.661) (-357.457) * (-359.164) [-356.960] (-359.245) (-356.272) -- 0:00:36
      394000 -- (-360.524) (-356.187) (-359.535) [-355.364] * (-356.559) [-359.079] (-355.254) (-358.933) -- 0:00:36
      394500 -- (-355.435) (-357.340) [-360.496] (-358.546) * [-359.387] (-359.705) (-356.456) (-362.175) -- 0:00:36
      395000 -- (-355.668) (-355.002) (-357.897) [-359.112] * (-358.910) (-361.735) (-358.855) [-358.967] -- 0:00:36

      Average standard deviation of split frequencies: 0.014915

      395500 -- (-355.709) (-356.564) (-358.392) [-359.831] * (-355.129) (-357.326) (-356.342) [-357.307] -- 0:00:36
      396000 -- (-356.334) (-356.633) (-358.925) [-356.773] * (-355.106) (-355.591) (-356.823) [-359.273] -- 0:00:36
      396500 -- (-356.044) (-355.722) (-356.896) [-360.790] * [-355.940] (-355.481) (-357.240) (-359.940) -- 0:00:36
      397000 -- [-356.343] (-356.279) (-356.403) (-357.663) * (-358.548) (-358.613) (-356.527) [-359.890] -- 0:00:36
      397500 -- (-355.718) (-356.162) (-358.426) [-355.928] * (-357.783) (-361.228) (-356.917) [-356.548] -- 0:00:36
      398000 -- (-356.989) [-356.171] (-364.532) (-355.849) * (-357.384) (-358.189) (-360.489) [-357.367] -- 0:00:36
      398500 -- (-360.899) [-359.953] (-363.526) (-359.733) * [-358.039] (-355.605) (-358.770) (-355.574) -- 0:00:36
      399000 -- (-356.731) [-359.295] (-358.916) (-357.456) * (-357.984) (-355.238) [-357.594] (-358.493) -- 0:00:36
      399500 -- (-360.554) [-356.374] (-356.065) (-357.749) * (-356.530) (-355.643) [-358.847] (-358.668) -- 0:00:36
      400000 -- (-356.699) (-360.938) [-356.568] (-357.192) * [-357.274] (-356.676) (-358.004) (-356.690) -- 0:00:36

      Average standard deviation of split frequencies: 0.013923

      400500 -- (-357.920) (-360.460) [-357.121] (-358.251) * (-358.690) [-356.563] (-356.998) (-356.503) -- 0:00:35
      401000 -- (-357.707) [-356.543] (-360.475) (-358.934) * (-356.599) (-359.887) (-359.626) [-357.967] -- 0:00:35
      401500 -- [-355.611] (-356.645) (-362.658) (-357.377) * [-357.480] (-360.298) (-357.496) (-356.508) -- 0:00:35
      402000 -- (-357.324) (-361.336) (-358.232) [-355.606] * (-357.508) (-359.208) (-357.581) [-355.386] -- 0:00:35
      402500 -- (-356.534) [-357.357] (-357.547) (-358.019) * (-356.193) (-356.163) (-357.338) [-360.076] -- 0:00:35
      403000 -- (-357.257) (-357.228) [-358.146] (-356.833) * (-355.262) [-355.705] (-356.720) (-357.266) -- 0:00:35
      403500 -- (-358.602) (-358.235) (-357.271) [-356.119] * [-357.043] (-355.962) (-355.901) (-356.397) -- 0:00:35
      404000 -- (-360.576) (-356.762) (-357.117) [-356.918] * (-356.719) (-357.282) (-357.016) [-358.624] -- 0:00:35
      404500 -- (-357.633) (-356.034) [-355.704] (-357.321) * (-357.685) (-359.280) [-355.170] (-358.093) -- 0:00:35
      405000 -- (-356.026) (-356.904) (-358.528) [-355.652] * (-355.433) (-358.168) (-356.679) [-355.713] -- 0:00:35

      Average standard deviation of split frequencies: 0.012901

      405500 -- (-359.621) (-355.420) [-357.187] (-357.340) * (-358.062) (-356.351) [-357.146] (-358.753) -- 0:00:35
      406000 -- (-358.282) (-359.703) [-357.243] (-360.396) * (-357.057) (-357.875) [-355.722] (-355.786) -- 0:00:35
      406500 -- (-357.071) (-357.700) [-357.196] (-355.784) * [-355.212] (-359.036) (-356.654) (-357.054) -- 0:00:36
      407000 -- (-356.663) (-357.644) [-359.499] (-356.102) * [-358.074] (-361.925) (-358.061) (-355.501) -- 0:00:36
      407500 -- (-358.085) (-357.375) (-363.608) [-357.582] * [-362.333] (-357.887) (-357.863) (-357.907) -- 0:00:36
      408000 -- (-357.677) (-360.863) [-358.389] (-359.581) * (-358.889) [-355.490] (-361.878) (-357.598) -- 0:00:36
      408500 -- (-356.718) [-361.316] (-356.598) (-359.836) * (-356.422) (-355.568) [-359.198] (-365.292) -- 0:00:36
      409000 -- [-356.452] (-355.482) (-355.673) (-356.445) * (-358.261) (-356.330) (-360.022) [-359.755] -- 0:00:36
      409500 -- [-357.170] (-357.034) (-356.377) (-356.546) * (-358.221) (-356.838) [-356.465] (-359.620) -- 0:00:36
      410000 -- (-355.371) (-356.788) [-357.175] (-359.182) * [-355.953] (-358.100) (-357.140) (-356.222) -- 0:00:35

      Average standard deviation of split frequencies: 0.013520

      410500 -- (-356.251) (-356.722) [-357.465] (-358.333) * [-355.590] (-359.594) (-357.592) (-355.826) -- 0:00:35
      411000 -- (-357.565) (-355.247) (-359.054) [-355.542] * (-358.360) (-356.650) (-355.990) [-356.319] -- 0:00:35
      411500 -- [-357.116] (-357.654) (-357.293) (-356.080) * (-357.376) (-356.050) (-356.571) [-357.237] -- 0:00:35
      412000 -- [-356.991] (-355.063) (-360.875) (-355.515) * [-355.124] (-357.108) (-355.882) (-360.458) -- 0:00:35
      412500 -- (-355.714) [-355.420] (-358.334) (-355.747) * (-355.342) (-356.132) (-361.386) [-358.684] -- 0:00:35
      413000 -- [-356.297] (-356.358) (-355.875) (-356.166) * (-355.482) [-356.267] (-358.764) (-358.115) -- 0:00:35
      413500 -- (-359.800) (-355.465) [-356.735] (-356.752) * (-355.516) (-355.649) (-360.967) [-359.520] -- 0:00:35
      414000 -- (-357.174) (-357.857) (-357.135) [-357.253] * [-357.554] (-358.386) (-359.516) (-359.856) -- 0:00:35
      414500 -- (-356.354) [-360.958] (-358.222) (-356.953) * [-356.241] (-360.210) (-355.819) (-359.631) -- 0:00:35
      415000 -- [-357.404] (-357.475) (-355.866) (-357.541) * (-357.630) (-357.137) [-355.303] (-357.883) -- 0:00:35

      Average standard deviation of split frequencies: 0.013661

      415500 -- (-358.137) (-356.819) [-357.074] (-356.466) * (-356.775) (-358.277) (-358.242) [-361.221] -- 0:00:35
      416000 -- [-363.520] (-355.798) (-358.302) (-358.670) * (-356.486) (-355.792) [-357.889] (-362.275) -- 0:00:35
      416500 -- (-355.816) (-357.500) (-359.693) [-359.855] * (-356.943) (-357.778) [-355.842] (-360.388) -- 0:00:35
      417000 -- (-357.289) (-357.953) (-356.565) [-355.524] * [-358.700] (-355.368) (-357.090) (-357.831) -- 0:00:34
      417500 -- (-357.888) (-355.257) (-359.141) [-355.598] * (-356.985) [-357.267] (-358.476) (-357.534) -- 0:00:34
      418000 -- [-356.149] (-357.279) (-355.122) (-355.762) * (-357.410) (-357.438) (-357.365) [-355.921] -- 0:00:34
      418500 -- (-356.500) (-356.415) (-357.282) [-355.966] * (-358.054) (-355.732) [-359.485] (-355.432) -- 0:00:34
      419000 -- (-358.906) [-357.830] (-359.435) (-357.148) * (-357.574) (-355.421) (-362.675) [-357.206] -- 0:00:34
      419500 -- (-359.973) [-357.689] (-360.351) (-355.892) * (-357.086) [-357.662] (-357.478) (-361.820) -- 0:00:34
      420000 -- (-359.694) (-357.124) (-356.415) [-356.077] * (-356.547) (-359.501) [-361.182] (-357.929) -- 0:00:34

      Average standard deviation of split frequencies: 0.012825

      420500 -- (-360.016) (-356.803) (-357.187) [-355.298] * (-357.257) (-358.407) (-355.367) [-355.606] -- 0:00:34
      421000 -- (-359.503) [-357.143] (-357.504) (-359.123) * (-355.836) (-357.498) [-355.554] (-358.386) -- 0:00:34
      421500 -- [-358.386] (-357.000) (-356.948) (-359.510) * (-359.282) (-355.623) [-355.802] (-358.289) -- 0:00:34
      422000 -- (-358.080) (-355.280) [-358.066] (-359.498) * (-355.434) (-360.958) (-358.189) [-358.364] -- 0:00:34
      422500 -- [-359.175] (-360.667) (-356.547) (-356.549) * [-357.288] (-358.529) (-357.708) (-356.500) -- 0:00:34
      423000 -- (-356.901) (-360.264) [-358.561] (-360.252) * (-358.215) [-356.740] (-357.282) (-357.112) -- 0:00:34
      423500 -- (-355.427) [-361.398] (-357.298) (-357.796) * [-358.253] (-361.076) (-355.364) (-357.952) -- 0:00:35
      424000 -- (-358.149) [-356.229] (-358.364) (-363.092) * (-355.458) (-360.661) [-356.813] (-361.972) -- 0:00:35
      424500 -- (-356.366) [-359.579] (-355.675) (-357.372) * [-356.223] (-357.453) (-356.502) (-357.561) -- 0:00:35
      425000 -- (-356.583) (-356.591) [-357.539] (-358.318) * [-361.179] (-355.471) (-356.785) (-356.942) -- 0:00:35

      Average standard deviation of split frequencies: 0.012603

      425500 -- (-356.677) [-357.334] (-360.003) (-359.213) * [-361.574] (-356.982) (-358.041) (-357.438) -- 0:00:35
      426000 -- [-357.217] (-356.610) (-358.939) (-360.404) * (-366.323) (-357.609) (-357.313) [-361.499] -- 0:00:35
      426500 -- (-357.513) (-356.986) (-359.170) [-357.820] * (-367.614) (-355.881) (-359.626) [-355.936] -- 0:00:34
      427000 -- [-357.731] (-357.696) (-359.621) (-358.399) * (-355.989) (-356.894) [-356.716] (-357.178) -- 0:00:34
      427500 -- (-358.475) (-356.940) (-358.203) [-355.805] * [-359.559] (-358.097) (-357.053) (-357.509) -- 0:00:34
      428000 -- (-356.685) (-358.642) (-360.864) [-357.058] * (-356.486) (-358.482) (-361.235) [-364.116] -- 0:00:34
      428500 -- (-357.295) (-359.958) [-359.475] (-355.225) * [-357.190] (-361.908) (-356.119) (-359.874) -- 0:00:34
      429000 -- [-361.336] (-356.648) (-356.261) (-356.225) * (-355.520) (-362.032) [-357.779] (-357.727) -- 0:00:34
      429500 -- (-358.718) (-356.068) [-356.013] (-358.631) * (-357.245) (-357.046) [-356.796] (-358.838) -- 0:00:34
      430000 -- (-361.302) [-356.336] (-358.742) (-356.715) * [-357.598] (-355.867) (-357.128) (-355.452) -- 0:00:34

      Average standard deviation of split frequencies: 0.012101

      430500 -- (-360.688) (-355.821) (-358.272) [-356.162] * [-357.058] (-355.719) (-357.138) (-356.819) -- 0:00:34
      431000 -- (-356.159) [-359.001] (-358.856) (-356.351) * (-357.237) (-355.768) (-355.386) [-356.570] -- 0:00:34
      431500 -- (-355.136) (-357.558) [-357.876] (-355.764) * (-356.388) (-356.216) (-356.928) [-357.698] -- 0:00:34
      432000 -- (-359.101) [-356.648] (-356.136) (-356.795) * (-356.490) (-356.878) (-359.427) [-358.015] -- 0:00:34
      432500 -- (-356.726) [-357.391] (-356.618) (-356.387) * (-358.237) (-358.122) (-355.378) [-360.451] -- 0:00:34
      433000 -- (-356.976) (-356.364) [-356.922] (-359.942) * (-357.837) (-356.134) (-360.260) [-356.314] -- 0:00:34
      433500 -- [-356.859] (-359.731) (-356.401) (-355.799) * [-355.388] (-357.623) (-359.224) (-356.130) -- 0:00:33
      434000 -- (-355.596) (-360.103) (-356.708) [-358.248] * [-356.969] (-357.035) (-359.116) (-357.186) -- 0:00:33
      434500 -- [-357.259] (-361.498) (-355.854) (-355.971) * [-355.396] (-357.862) (-360.310) (-357.302) -- 0:00:33
      435000 -- (-359.325) (-360.559) [-356.915] (-355.975) * [-355.960] (-359.404) (-356.612) (-356.636) -- 0:00:33

      Average standard deviation of split frequencies: 0.011830

      435500 -- [-357.088] (-358.074) (-359.346) (-357.309) * (-355.886) (-359.198) (-356.995) [-355.528] -- 0:00:33
      436000 -- (-355.108) (-359.846) (-357.099) [-357.145] * (-357.442) (-355.781) [-356.342] (-356.217) -- 0:00:33
      436500 -- [-355.646] (-361.336) (-356.019) (-357.588) * (-359.554) [-360.257] (-356.596) (-361.762) -- 0:00:33
      437000 -- (-357.715) (-357.235) [-355.327] (-358.124) * (-360.976) (-358.077) [-358.762] (-357.094) -- 0:00:33
      437500 -- [-358.265] (-358.197) (-357.209) (-358.055) * [-359.626] (-358.248) (-357.483) (-358.265) -- 0:00:33
      438000 -- [-357.586] (-360.006) (-357.298) (-358.735) * (-359.383) [-358.421] (-356.698) (-358.232) -- 0:00:33
      438500 -- (-355.988) [-361.828] (-357.145) (-357.572) * (-356.980) [-355.241] (-357.770) (-359.046) -- 0:00:33
      439000 -- [-359.423] (-357.987) (-359.421) (-357.589) * [-358.509] (-355.851) (-355.587) (-358.041) -- 0:00:33
      439500 -- [-359.745] (-356.104) (-358.507) (-355.816) * (-358.524) [-356.567] (-356.980) (-356.468) -- 0:00:33
      440000 -- [-357.751] (-357.559) (-360.395) (-358.881) * (-355.520) (-360.263) [-355.381] (-357.985) -- 0:00:33

      Average standard deviation of split frequencies: 0.012436

      440500 -- (-355.343) [-356.452] (-358.402) (-355.206) * [-359.627] (-359.087) (-357.828) (-360.544) -- 0:00:34
      441000 -- (-359.955) (-357.240) [-361.117] (-356.069) * (-357.139) (-357.760) (-357.767) [-355.975] -- 0:00:34
      441500 -- (-359.682) [-356.004] (-361.040) (-357.751) * (-356.161) (-361.937) (-356.100) [-358.823] -- 0:00:34
      442000 -- (-356.032) [-357.803] (-356.225) (-360.827) * (-357.018) (-359.358) (-360.625) [-359.263] -- 0:00:34
      442500 -- (-356.316) [-356.332] (-359.030) (-356.841) * [-357.741] (-357.534) (-356.735) (-358.974) -- 0:00:34
      443000 -- [-358.659] (-355.151) (-359.069) (-356.667) * (-356.939) (-356.036) (-358.872) [-358.432] -- 0:00:33
      443500 -- (-358.374) (-357.260) (-357.811) [-355.638] * (-356.619) (-356.959) [-355.817] (-358.830) -- 0:00:33
      444000 -- [-359.379] (-355.732) (-357.896) (-355.443) * (-356.091) (-358.231) (-357.038) [-356.732] -- 0:00:33
      444500 -- (-358.451) (-355.165) [-356.096] (-358.499) * (-357.223) (-355.631) (-358.043) [-355.974] -- 0:00:33
      445000 -- [-357.879] (-357.777) (-357.608) (-357.297) * [-355.671] (-357.477) (-356.213) (-360.464) -- 0:00:33

      Average standard deviation of split frequencies: 0.012214

      445500 -- (-359.615) [-357.457] (-361.103) (-357.786) * (-359.810) (-359.912) [-357.327] (-355.545) -- 0:00:33
      446000 -- (-359.391) (-356.005) [-357.441] (-355.341) * (-355.816) (-362.956) (-358.231) [-358.278] -- 0:00:33
      446500 -- (-355.746) [-356.238] (-358.188) (-357.386) * (-356.901) (-357.639) (-359.015) [-356.104] -- 0:00:33
      447000 -- (-357.032) [-358.695] (-358.240) (-355.386) * (-359.580) (-356.019) [-355.896] (-359.740) -- 0:00:33
      447500 -- [-357.496] (-357.392) (-358.138) (-355.749) * (-356.020) [-355.954] (-357.834) (-358.226) -- 0:00:33
      448000 -- (-356.380) (-357.168) (-357.215) [-357.129] * (-355.933) (-355.601) [-357.676] (-360.430) -- 0:00:33
      448500 -- (-358.430) [-355.833] (-359.461) (-357.769) * (-356.964) [-355.645] (-357.865) (-360.639) -- 0:00:33
      449000 -- (-359.021) [-360.226] (-357.554) (-358.412) * (-359.085) [-355.053] (-359.133) (-357.806) -- 0:00:33
      449500 -- (-356.804) (-355.493) (-357.910) [-356.729] * (-356.808) (-357.005) (-356.650) [-356.539] -- 0:00:33
      450000 -- (-356.703) [-356.769] (-357.643) (-357.078) * (-356.029) (-356.873) [-357.935] (-356.783) -- 0:00:33

      Average standard deviation of split frequencies: 0.011768

      450500 -- (-358.404) [-356.811] (-360.803) (-358.394) * (-357.564) [-361.548] (-361.449) (-356.373) -- 0:00:32
      451000 -- (-358.335) (-361.111) (-357.122) [-359.270] * (-358.569) [-357.712] (-357.722) (-355.909) -- 0:00:32
      451500 -- [-356.137] (-356.560) (-357.609) (-355.510) * (-357.081) (-357.989) [-358.024] (-357.281) -- 0:00:32
      452000 -- [-355.921] (-355.996) (-357.235) (-355.275) * (-357.308) [-356.992] (-357.763) (-357.116) -- 0:00:32
      452500 -- (-357.068) [-358.764] (-356.157) (-356.277) * [-356.533] (-356.518) (-357.276) (-355.579) -- 0:00:32
      453000 -- (-359.407) (-364.040) [-357.130] (-356.554) * (-356.115) [-355.519] (-356.771) (-357.992) -- 0:00:32
      453500 -- (-357.976) (-358.421) [-358.393] (-357.417) * (-357.037) (-356.743) [-355.699] (-357.277) -- 0:00:32
      454000 -- (-358.834) (-357.205) [-355.784] (-359.218) * (-357.428) (-357.791) [-356.283] (-357.041) -- 0:00:32
      454500 -- (-359.311) [-356.742] (-356.839) (-356.879) * (-356.106) (-356.349) [-356.915] (-358.475) -- 0:00:32
      455000 -- (-357.054) (-355.368) [-357.012] (-359.837) * (-357.616) (-356.077) [-355.387] (-355.772) -- 0:00:32

      Average standard deviation of split frequencies: 0.011311

      455500 -- [-357.503] (-358.498) (-358.233) (-355.452) * [-358.884] (-359.553) (-356.944) (-356.145) -- 0:00:32
      456000 -- [-360.006] (-356.327) (-362.383) (-354.982) * (-357.943) (-357.017) (-358.100) [-358.098] -- 0:00:32
      456500 -- (-361.576) [-359.823] (-361.577) (-356.382) * [-356.214] (-359.206) (-360.173) (-358.871) -- 0:00:32
      457000 -- (-355.988) [-359.401] (-357.204) (-356.825) * (-358.486) [-357.212] (-358.355) (-357.816) -- 0:00:33
      457500 -- [-356.506] (-356.286) (-356.216) (-355.703) * (-360.395) [-355.703] (-360.529) (-357.544) -- 0:00:33
      458000 -- (-358.182) [-361.566] (-358.897) (-356.280) * (-358.340) [-356.328] (-357.428) (-360.149) -- 0:00:33
      458500 -- (-359.756) [-359.384] (-358.534) (-356.870) * (-357.061) (-356.339) (-360.197) [-356.584] -- 0:00:33
      459000 -- (-356.943) [-364.685] (-358.328) (-355.139) * (-358.095) (-355.471) [-358.375] (-356.877) -- 0:00:33
      459500 -- (-357.748) (-360.684) [-360.596] (-357.875) * (-357.832) (-356.852) [-358.514] (-358.993) -- 0:00:32
      460000 -- (-358.817) (-355.718) (-357.234) [-355.501] * (-359.172) [-355.984] (-358.351) (-357.283) -- 0:00:32

      Average standard deviation of split frequencies: 0.010835

      460500 -- (-359.152) [-360.325] (-357.643) (-357.322) * (-357.884) [-356.323] (-358.344) (-356.023) -- 0:00:32
      461000 -- (-361.486) (-357.505) (-361.170) [-359.600] * (-356.025) [-356.065] (-357.311) (-356.395) -- 0:00:32
      461500 -- (-359.375) [-356.264] (-359.823) (-356.961) * (-356.341) (-359.549) [-358.500] (-357.393) -- 0:00:32
      462000 -- (-359.223) (-357.085) (-359.680) [-356.612] * (-359.651) (-358.178) (-357.765) [-355.946] -- 0:00:32
      462500 -- (-356.233) [-357.827] (-356.378) (-355.672) * (-357.365) (-357.120) [-356.901] (-363.296) -- 0:00:32
      463000 -- [-355.500] (-359.639) (-359.549) (-356.594) * (-358.181) [-358.031] (-359.596) (-359.419) -- 0:00:32
      463500 -- [-358.916] (-356.589) (-356.765) (-356.703) * (-360.009) [-357.325] (-356.117) (-356.626) -- 0:00:32
      464000 -- (-360.015) (-356.787) [-359.398] (-358.337) * (-358.601) (-359.766) (-359.097) [-355.426] -- 0:00:32
      464500 -- (-357.553) (-356.509) (-357.467) [-357.941] * (-358.806) (-362.896) (-358.899) [-356.008] -- 0:00:32
      465000 -- (-359.148) [-355.721] (-356.259) (-359.998) * (-357.070) [-357.621] (-356.013) (-355.566) -- 0:00:32

      Average standard deviation of split frequencies: 0.011071

      465500 -- (-358.348) [-355.495] (-355.369) (-357.521) * [-358.379] (-359.252) (-360.365) (-355.574) -- 0:00:32
      466000 -- [-357.570] (-356.041) (-357.755) (-355.876) * (-358.599) [-356.095] (-355.983) (-358.329) -- 0:00:32
      466500 -- (-360.955) (-358.926) [-358.730] (-356.987) * [-360.315] (-358.388) (-355.476) (-355.266) -- 0:00:32
      467000 -- (-356.803) (-356.831) (-357.295) [-359.394] * (-355.489) (-355.688) (-356.634) [-356.257] -- 0:00:31
      467500 -- (-356.796) (-361.807) (-359.570) [-360.343] * [-359.002] (-361.061) (-356.591) (-357.293) -- 0:00:31
      468000 -- [-359.704] (-356.366) (-356.907) (-357.539) * [-356.665] (-357.290) (-358.202) (-355.453) -- 0:00:31
      468500 -- [-356.036] (-355.310) (-357.129) (-357.036) * [-357.190] (-357.439) (-360.109) (-355.773) -- 0:00:31
      469000 -- (-358.576) [-358.717] (-357.170) (-359.096) * [-356.568] (-357.454) (-358.832) (-356.872) -- 0:00:31
      469500 -- (-358.476) [-359.136] (-357.121) (-356.583) * [-356.944] (-355.810) (-356.145) (-357.026) -- 0:00:31
      470000 -- (-357.156) (-359.960) (-356.260) [-356.412] * (-356.205) (-356.820) [-357.959] (-359.504) -- 0:00:31

      Average standard deviation of split frequencies: 0.010134

      470500 -- (-356.924) [-356.484] (-357.645) (-357.106) * (-359.761) (-360.159) [-356.490] (-357.427) -- 0:00:31
      471000 -- [-357.072] (-356.179) (-357.873) (-360.327) * (-364.074) (-362.161) [-355.790] (-358.733) -- 0:00:31
      471500 -- (-355.789) [-359.855] (-359.125) (-356.779) * [-360.322] (-359.868) (-357.002) (-357.118) -- 0:00:31
      472000 -- [-355.678] (-359.299) (-356.571) (-356.065) * (-357.013) [-360.712] (-355.337) (-355.625) -- 0:00:31
      472500 -- (-355.574) (-357.545) [-357.968] (-355.669) * [-356.947] (-362.365) (-356.266) (-355.289) -- 0:00:31
      473000 -- (-361.404) (-358.893) [-355.498] (-361.598) * (-358.791) (-356.478) [-355.848] (-355.339) -- 0:00:31
      473500 -- (-356.894) (-359.424) [-358.322] (-356.284) * [-356.725] (-357.750) (-357.161) (-355.453) -- 0:00:32
      474000 -- (-356.985) (-355.452) (-359.393) [-356.775] * (-357.585) (-356.449) [-359.688] (-358.993) -- 0:00:32
      474500 -- (-358.630) (-362.178) [-358.822] (-358.078) * [-356.639] (-355.568) (-356.750) (-361.221) -- 0:00:32
      475000 -- (-356.867) [-356.432] (-359.800) (-359.947) * (-361.644) [-355.543] (-356.578) (-359.503) -- 0:00:32

      Average standard deviation of split frequencies: 0.010289

      475500 -- (-356.752) [-356.994] (-359.882) (-356.909) * (-358.025) (-356.010) [-357.244] (-356.532) -- 0:00:31
      476000 -- (-358.034) [-357.701] (-356.790) (-357.734) * (-357.701) (-358.609) [-358.204] (-355.687) -- 0:00:31
      476500 -- (-357.720) (-359.315) [-356.741] (-358.197) * (-356.000) [-356.398] (-357.769) (-360.845) -- 0:00:31
      477000 -- (-355.419) (-362.043) (-356.379) [-359.099] * (-356.436) (-356.409) [-359.462] (-356.638) -- 0:00:31
      477500 -- (-355.960) (-358.358) (-356.568) [-357.369] * (-356.316) (-357.830) (-356.666) [-356.996] -- 0:00:31
      478000 -- (-358.140) (-357.408) [-357.873] (-359.381) * (-355.649) [-355.853] (-356.517) (-358.568) -- 0:00:31
      478500 -- [-359.037] (-357.323) (-359.022) (-358.188) * [-355.523] (-355.990) (-357.071) (-356.400) -- 0:00:31
      479000 -- [-355.527] (-357.550) (-357.890) (-357.044) * [-355.837] (-359.539) (-356.465) (-359.002) -- 0:00:31
      479500 -- [-355.894] (-358.077) (-360.053) (-356.229) * (-356.358) (-359.043) (-356.261) [-355.499] -- 0:00:31
      480000 -- (-355.894) (-357.571) [-358.105] (-357.599) * (-361.899) (-357.460) [-357.449] (-358.658) -- 0:00:31

      Average standard deviation of split frequencies: 0.009971

      480500 -- [-359.148] (-357.572) (-355.121) (-357.632) * (-359.927) [-355.185] (-358.773) (-355.827) -- 0:00:31
      481000 -- (-356.051) [-356.112] (-355.393) (-356.462) * [-356.284] (-358.787) (-359.446) (-356.006) -- 0:00:31
      481500 -- [-359.539] (-356.682) (-356.322) (-357.378) * (-357.224) [-356.134] (-357.192) (-357.962) -- 0:00:31
      482000 -- (-357.949) (-357.129) [-355.616] (-356.007) * (-357.289) [-357.808] (-357.367) (-356.652) -- 0:00:31
      482500 -- [-357.240] (-358.749) (-357.496) (-356.208) * (-355.497) (-358.638) [-355.401] (-355.730) -- 0:00:31
      483000 -- (-356.323) [-361.450] (-356.613) (-357.136) * (-363.104) (-355.230) [-355.727] (-359.516) -- 0:00:31
      483500 -- (-356.167) [-358.806] (-356.300) (-355.247) * (-359.691) [-355.678] (-355.399) (-358.682) -- 0:00:30
      484000 -- (-355.708) (-356.254) (-357.846) [-356.132] * (-356.024) (-359.174) [-358.366] (-355.982) -- 0:00:30
      484500 -- (-357.239) [-355.354] (-356.352) (-356.729) * (-356.762) (-356.049) [-355.757] (-356.286) -- 0:00:30
      485000 -- (-358.619) (-357.743) [-356.306] (-356.240) * (-355.307) (-357.631) (-358.958) [-356.051] -- 0:00:30

      Average standard deviation of split frequencies: 0.010767

      485500 -- [-357.195] (-357.932) (-357.057) (-357.976) * [-355.668] (-357.415) (-357.045) (-357.393) -- 0:00:30
      486000 -- (-356.910) (-361.820) [-358.721] (-355.739) * [-356.327] (-359.263) (-358.411) (-356.028) -- 0:00:30
      486500 -- [-358.614] (-357.705) (-355.623) (-360.617) * (-355.919) (-358.539) (-356.331) [-356.059] -- 0:00:30
      487000 -- (-357.357) [-358.862] (-355.564) (-356.410) * (-356.728) [-355.634] (-355.173) (-355.314) -- 0:00:30
      487500 -- (-360.211) (-358.273) [-355.810] (-358.423) * (-357.775) [-355.635] (-358.457) (-357.780) -- 0:00:30
      488000 -- [-357.402] (-361.121) (-356.361) (-360.156) * (-357.289) (-355.578) [-356.904] (-356.772) -- 0:00:30
      488500 -- [-357.540] (-358.450) (-358.359) (-355.734) * [-356.843] (-356.233) (-359.330) (-356.629) -- 0:00:30
      489000 -- (-356.162) (-361.310) [-355.437] (-357.447) * (-358.868) (-356.696) (-356.279) [-355.988] -- 0:00:31
      489500 -- (-358.750) [-357.465] (-356.692) (-359.251) * (-362.633) [-356.363] (-356.394) (-357.501) -- 0:00:31
      490000 -- (-356.460) [-359.094] (-356.536) (-359.312) * (-358.528) (-356.803) (-357.625) [-356.396] -- 0:00:31

      Average standard deviation of split frequencies: 0.010195

      490500 -- [-355.602] (-357.114) (-358.117) (-357.356) * (-356.390) (-355.327) [-360.100] (-356.905) -- 0:00:31
      491000 -- (-356.433) [-358.673] (-359.200) (-358.159) * (-355.952) [-356.508] (-358.630) (-358.540) -- 0:00:31
      491500 -- (-356.622) (-358.174) [-361.482] (-359.136) * (-356.458) (-355.501) (-355.674) [-356.974] -- 0:00:31
      492000 -- (-357.090) (-358.600) (-361.532) [-358.746] * (-356.106) (-359.068) (-356.860) [-356.244] -- 0:00:30
      492500 -- (-359.553) [-356.550] (-359.892) (-356.834) * (-356.206) [-358.015] (-356.020) (-356.758) -- 0:00:30
      493000 -- (-360.498) (-356.669) (-361.170) [-356.746] * (-357.447) (-359.312) (-358.375) [-358.331] -- 0:00:30
      493500 -- (-358.561) (-356.099) (-360.080) [-355.937] * (-359.880) (-359.200) (-356.749) [-355.565] -- 0:00:30
      494000 -- [-357.364] (-355.899) (-360.405) (-358.388) * [-357.455] (-356.779) (-356.559) (-357.190) -- 0:00:30
      494500 -- (-356.059) (-355.899) (-356.338) [-357.882] * (-355.728) (-360.818) [-357.920] (-358.773) -- 0:00:30
      495000 -- [-355.908] (-356.664) (-359.353) (-358.828) * (-356.926) (-357.277) [-355.933] (-356.090) -- 0:00:30

      Average standard deviation of split frequencies: 0.010402

      495500 -- [-357.413] (-356.249) (-358.944) (-356.646) * (-358.529) (-357.455) [-356.716] (-357.015) -- 0:00:30
      496000 -- [-356.458] (-357.205) (-355.921) (-356.294) * (-358.021) [-357.773] (-356.947) (-358.009) -- 0:00:30
      496500 -- [-355.640] (-357.218) (-357.087) (-359.874) * (-362.550) (-359.150) [-356.824] (-358.594) -- 0:00:30
      497000 -- (-355.980) (-356.633) (-357.866) [-357.169] * (-357.420) [-356.659] (-357.622) (-356.186) -- 0:00:30
      497500 -- (-356.011) (-360.146) (-357.892) [-356.392] * (-356.886) (-357.336) (-357.047) [-358.530] -- 0:00:30
      498000 -- [-356.735] (-359.662) (-358.425) (-356.609) * (-360.134) [-355.973] (-359.039) (-358.907) -- 0:00:30
      498500 -- (-357.076) [-356.544] (-355.354) (-362.310) * (-364.007) (-364.024) (-357.772) [-356.038] -- 0:00:30
      499000 -- (-358.649) (-359.766) [-355.582] (-361.926) * (-358.820) [-360.609] (-358.712) (-357.300) -- 0:00:30
      499500 -- [-357.416] (-363.040) (-356.850) (-359.466) * (-355.983) (-357.622) (-356.202) [-358.268] -- 0:00:30
      500000 -- [-355.564] (-360.846) (-358.811) (-357.906) * [-356.057] (-358.827) (-355.856) (-357.757) -- 0:00:30

      Average standard deviation of split frequencies: 0.010800

      500500 -- [-361.980] (-362.456) (-357.427) (-359.352) * (-357.228) (-358.835) (-356.867) [-356.253] -- 0:00:29
      501000 -- [-356.561] (-359.412) (-358.302) (-362.528) * [-358.386] (-358.549) (-356.480) (-356.503) -- 0:00:29
      501500 -- (-356.445) (-357.893) (-356.366) [-360.439] * (-357.160) (-360.244) [-356.777] (-358.588) -- 0:00:29
      502000 -- [-357.024] (-359.932) (-357.682) (-358.865) * (-356.386) (-360.108) [-360.236] (-362.335) -- 0:00:29
      502500 -- (-360.091) (-359.667) [-357.630] (-356.724) * (-356.610) (-359.591) (-355.953) [-355.312] -- 0:00:29
      503000 -- (-356.080) (-357.573) (-359.047) [-356.154] * (-357.827) [-360.341] (-355.748) (-364.922) -- 0:00:29
      503500 -- [-356.718] (-357.856) (-358.572) (-357.036) * [-355.682] (-356.969) (-356.212) (-355.977) -- 0:00:29
      504000 -- (-357.720) (-357.260) (-356.994) [-356.684] * (-357.910) (-358.807) [-356.831] (-356.672) -- 0:00:29
      504500 -- [-355.445] (-359.967) (-356.894) (-356.521) * (-355.746) (-358.781) (-358.069) [-357.274] -- 0:00:29
      505000 -- (-359.865) (-356.844) [-357.815] (-358.157) * (-355.685) (-355.572) [-359.776] (-356.025) -- 0:00:29

      Average standard deviation of split frequencies: 0.010851

      505500 -- [-360.530] (-357.615) (-362.166) (-360.182) * (-357.052) [-356.588] (-358.120) (-356.732) -- 0:00:30
      506000 -- (-356.423) (-358.072) (-359.449) [-356.899] * (-356.734) [-357.794] (-359.571) (-358.064) -- 0:00:30
      506500 -- (-359.379) (-360.839) [-357.486] (-356.096) * (-358.571) [-356.978] (-357.549) (-356.365) -- 0:00:30
      507000 -- (-357.363) (-356.299) [-356.804] (-356.084) * [-358.887] (-355.872) (-358.038) (-356.777) -- 0:00:30
      507500 -- [-357.177] (-357.522) (-355.938) (-355.536) * (-356.642) [-356.693] (-358.436) (-357.938) -- 0:00:30
      508000 -- [-360.660] (-356.590) (-355.676) (-356.582) * [-355.389] (-360.191) (-356.764) (-359.105) -- 0:00:30
      508500 -- [-362.237] (-360.217) (-356.003) (-355.770) * (-358.826) [-355.514] (-358.115) (-360.161) -- 0:00:29
      509000 -- [-359.354] (-356.428) (-357.786) (-357.359) * (-357.367) [-357.569] (-356.572) (-356.608) -- 0:00:29
      509500 -- (-356.275) (-356.170) (-360.980) [-357.619] * (-358.419) [-355.888] (-357.280) (-356.882) -- 0:00:29
      510000 -- [-357.228] (-356.442) (-359.530) (-356.979) * (-361.019) [-357.540] (-355.655) (-355.221) -- 0:00:29

      Average standard deviation of split frequencies: 0.010914

      510500 -- (-359.460) [-355.907] (-357.283) (-356.760) * (-364.505) (-359.376) (-356.862) [-356.970] -- 0:00:29
      511000 -- (-356.257) (-356.909) [-355.058] (-357.378) * [-357.996] (-359.495) (-357.058) (-357.052) -- 0:00:29
      511500 -- [-355.069] (-355.885) (-357.538) (-358.588) * (-358.059) (-357.300) (-357.936) [-356.293] -- 0:00:29
      512000 -- [-355.825] (-357.455) (-359.347) (-359.471) * (-356.219) (-357.783) (-355.889) [-357.957] -- 0:00:29
      512500 -- (-357.627) (-357.739) (-359.479) [-361.481] * (-357.606) [-356.605] (-356.935) (-361.158) -- 0:00:29
      513000 -- (-358.058) [-357.136] (-358.297) (-356.902) * (-356.911) (-361.092) (-359.046) [-355.885] -- 0:00:29
      513500 -- (-355.753) (-358.389) [-358.492] (-364.546) * [-356.561] (-357.591) (-356.496) (-356.998) -- 0:00:29
      514000 -- (-358.365) (-358.042) [-357.648] (-355.473) * (-358.996) [-357.024] (-358.584) (-363.150) -- 0:00:29
      514500 -- [-358.656] (-360.044) (-359.669) (-359.843) * (-357.358) (-356.526) (-355.399) [-357.646] -- 0:00:29
      515000 -- [-359.459] (-356.892) (-355.936) (-359.286) * (-356.990) [-358.237] (-359.398) (-358.724) -- 0:00:29

      Average standard deviation of split frequencies: 0.011248

      515500 -- (-357.345) (-359.333) [-356.497] (-357.007) * (-359.598) (-356.693) (-357.428) [-358.937] -- 0:00:29
      516000 -- [-355.508] (-359.981) (-363.386) (-356.857) * (-361.611) [-356.244] (-362.844) (-359.583) -- 0:00:29
      516500 -- (-355.161) (-357.096) [-355.710] (-355.930) * (-358.421) (-356.244) [-361.584] (-356.302) -- 0:00:29
      517000 -- (-361.161) (-356.965) (-355.234) [-356.180] * [-356.451] (-356.720) (-362.172) (-359.766) -- 0:00:28
      517500 -- (-359.482) [-356.314] (-355.278) (-358.165) * [-355.779] (-357.918) (-359.997) (-356.925) -- 0:00:28
      518000 -- (-356.551) (-358.669) [-356.371] (-358.274) * [-363.973] (-356.424) (-357.607) (-360.294) -- 0:00:28
      518500 -- (-355.712) [-356.121] (-356.796) (-357.254) * (-359.196) [-357.888] (-356.279) (-360.744) -- 0:00:28
      519000 -- [-356.112] (-355.580) (-355.521) (-358.331) * (-356.264) (-358.738) [-360.406] (-357.051) -- 0:00:28
      519500 -- (-360.524) (-357.166) [-357.013] (-356.142) * (-356.639) [-355.493] (-355.442) (-359.207) -- 0:00:28
      520000 -- (-360.686) [-355.569] (-357.893) (-356.566) * (-355.783) [-355.765] (-359.673) (-359.509) -- 0:00:28

      Average standard deviation of split frequencies: 0.011317

      520500 -- (-356.671) (-357.231) (-357.444) [-361.790] * [-358.893] (-356.890) (-357.160) (-358.049) -- 0:00:28
      521000 -- [-355.776] (-359.465) (-361.001) (-356.321) * (-356.402) (-355.548) [-360.133] (-356.944) -- 0:00:28
      521500 -- (-356.968) (-359.163) (-360.891) [-355.417] * (-359.200) [-355.662] (-360.267) (-356.642) -- 0:00:28
      522000 -- (-356.130) (-358.237) [-357.196] (-357.710) * (-359.033) (-355.571) [-361.791] (-358.853) -- 0:00:29
      522500 -- (-358.096) (-361.721) (-359.079) [-355.929] * (-357.393) (-355.769) (-357.950) [-360.287] -- 0:00:29
      523000 -- (-357.689) [-361.364] (-359.614) (-355.740) * (-360.218) (-361.746) [-355.982] (-355.996) -- 0:00:29
      523500 -- (-359.424) (-357.277) [-360.682] (-356.897) * (-355.644) [-356.717] (-357.547) (-360.531) -- 0:00:29
      524000 -- [-356.938] (-355.725) (-358.055) (-357.991) * (-361.073) [-356.858] (-356.515) (-355.177) -- 0:00:29
      524500 -- (-358.301) (-356.458) (-358.035) [-356.003] * [-356.116] (-358.364) (-356.957) (-359.935) -- 0:00:29
      525000 -- [-355.289] (-357.613) (-358.645) (-360.069) * (-355.788) (-358.617) [-359.601] (-361.711) -- 0:00:28

      Average standard deviation of split frequencies: 0.010923

      525500 -- [-355.473] (-360.562) (-356.941) (-357.533) * (-355.827) (-357.635) (-358.426) [-356.667] -- 0:00:28
      526000 -- [-360.650] (-356.898) (-356.813) (-359.805) * (-356.397) (-356.688) [-357.314] (-357.129) -- 0:00:28
      526500 -- (-356.249) [-357.311] (-357.640) (-357.707) * (-363.192) (-357.715) [-355.408] (-358.526) -- 0:00:28
      527000 -- (-358.159) [-357.878] (-358.539) (-360.074) * (-356.209) (-357.171) [-357.589] (-360.547) -- 0:00:28
      527500 -- (-357.281) (-359.092) [-355.736] (-357.164) * [-355.854] (-359.601) (-357.250) (-358.011) -- 0:00:28
      528000 -- (-357.064) (-357.560) [-357.365] (-356.058) * (-356.051) (-357.675) [-356.271] (-356.055) -- 0:00:28
      528500 -- (-355.962) (-359.396) [-357.014] (-355.771) * [-356.104] (-358.685) (-357.864) (-357.359) -- 0:00:28
      529000 -- (-356.279) (-356.224) [-357.393] (-357.590) * (-356.900) [-356.646] (-357.170) (-357.149) -- 0:00:28
      529500 -- (-359.439) (-356.813) [-356.084] (-360.113) * (-357.075) (-355.801) [-356.554] (-358.612) -- 0:00:28
      530000 -- (-359.876) (-359.274) (-358.966) [-358.185] * (-357.750) [-360.117] (-356.208) (-359.723) -- 0:00:28

      Average standard deviation of split frequencies: 0.010549

      530500 -- (-358.106) [-357.067] (-356.282) (-359.642) * (-358.074) (-356.857) (-360.791) [-358.200] -- 0:00:28
      531000 -- (-356.621) (-358.204) [-358.661] (-356.202) * (-356.886) (-356.256) [-357.527] (-358.663) -- 0:00:28
      531500 -- (-356.483) (-358.891) (-364.669) [-355.465] * [-355.620] (-358.559) (-357.035) (-356.953) -- 0:00:28
      532000 -- (-357.598) (-359.903) (-362.198) [-360.249] * (-358.720) (-362.069) [-358.441] (-355.883) -- 0:00:28
      532500 -- (-357.611) (-361.593) (-357.079) [-356.736] * (-358.597) [-359.154] (-356.562) (-355.450) -- 0:00:28
      533000 -- (-357.685) [-357.418] (-357.043) (-359.836) * (-357.369) [-357.256] (-357.127) (-358.000) -- 0:00:28
      533500 -- (-357.661) (-358.612) [-357.712] (-356.963) * (-355.722) (-357.615) [-358.633] (-360.017) -- 0:00:27
      534000 -- (-356.033) [-355.907] (-357.257) (-358.091) * (-358.504) (-357.871) [-356.052] (-358.015) -- 0:00:27
      534500 -- [-357.912] (-358.483) (-356.368) (-356.131) * [-356.793] (-357.580) (-355.896) (-357.668) -- 0:00:27
      535000 -- (-356.970) [-356.736] (-358.110) (-356.052) * (-355.734) (-357.047) (-357.113) [-357.238] -- 0:00:27

      Average standard deviation of split frequencies: 0.010444

      535500 -- (-358.875) (-356.211) [-355.144] (-359.538) * [-355.750] (-355.890) (-358.316) (-355.486) -- 0:00:27
      536000 -- (-357.436) (-358.163) [-355.585] (-359.630) * [-355.415] (-355.580) (-356.908) (-357.034) -- 0:00:27
      536500 -- (-357.432) (-359.868) [-356.197] (-359.604) * [-357.067] (-357.905) (-356.148) (-359.516) -- 0:00:27
      537000 -- [-358.477] (-358.663) (-360.255) (-357.038) * (-356.892) [-355.656] (-357.289) (-357.504) -- 0:00:27
      537500 -- (-365.251) (-356.375) [-358.509] (-356.142) * [-356.576] (-357.784) (-357.368) (-356.727) -- 0:00:27
      538000 -- (-358.189) (-359.171) (-361.560) [-357.274] * [-358.014] (-360.480) (-358.435) (-356.048) -- 0:00:27
      538500 -- [-358.848] (-362.566) (-358.827) (-357.864) * [-355.659] (-361.559) (-356.506) (-356.791) -- 0:00:27
      539000 -- (-356.445) [-359.354] (-356.137) (-355.820) * [-356.919] (-356.824) (-356.933) (-359.378) -- 0:00:28
      539500 -- [-356.054] (-357.015) (-357.763) (-355.748) * [-356.379] (-357.873) (-357.806) (-355.614) -- 0:00:28
      540000 -- (-360.136) (-361.206) [-355.939] (-356.946) * [-355.605] (-357.170) (-357.791) (-356.392) -- 0:00:28

      Average standard deviation of split frequencies: 0.009754

      540500 -- (-359.591) (-357.270) [-355.230] (-356.828) * (-355.828) [-356.060] (-356.438) (-359.337) -- 0:00:28
      541000 -- [-356.640] (-357.318) (-355.282) (-356.116) * (-356.120) (-358.725) (-360.080) [-359.493] -- 0:00:27
      541500 -- (-355.383) [-355.981] (-356.915) (-355.850) * (-355.888) (-357.925) (-357.490) [-361.294] -- 0:00:27
      542000 -- (-356.203) (-356.579) [-358.628] (-357.252) * (-358.119) (-356.042) (-357.241) [-359.526] -- 0:00:27
      542500 -- (-356.548) (-357.501) [-360.363] (-357.383) * (-361.394) (-361.495) (-356.862) [-358.796] -- 0:00:27
      543000 -- (-355.528) [-356.523] (-356.336) (-358.426) * (-357.397) (-361.707) (-360.911) [-358.360] -- 0:00:27
      543500 -- (-356.228) [-355.677] (-355.499) (-357.704) * (-358.065) (-357.438) (-356.612) [-357.693] -- 0:00:27
      544000 -- (-358.898) (-356.375) [-358.394] (-357.628) * (-357.034) (-358.763) [-356.109] (-356.814) -- 0:00:27
      544500 -- (-359.790) [-357.746] (-356.610) (-356.617) * (-358.418) (-356.076) [-356.697] (-358.660) -- 0:00:27
      545000 -- [-358.599] (-355.301) (-356.475) (-355.976) * (-362.489) (-362.792) (-356.546) [-356.546] -- 0:00:27

      Average standard deviation of split frequencies: 0.009497

      545500 -- [-359.425] (-357.064) (-355.402) (-360.479) * (-357.330) (-359.638) [-357.455] (-359.436) -- 0:00:27
      546000 -- (-356.294) [-357.680] (-362.760) (-359.860) * [-356.153] (-357.424) (-355.773) (-359.623) -- 0:00:27
      546500 -- (-356.448) (-358.423) [-356.891] (-359.196) * (-356.205) (-355.838) [-359.943] (-356.228) -- 0:00:27
      547000 -- (-355.066) (-358.999) [-356.069] (-356.082) * (-356.768) (-356.148) [-355.829] (-357.591) -- 0:00:27
      547500 -- (-356.270) [-357.725] (-357.558) (-356.321) * [-355.242] (-357.348) (-357.093) (-356.765) -- 0:00:27
      548000 -- (-358.246) (-356.813) [-356.907] (-356.243) * (-356.071) (-358.244) (-357.765) [-356.488] -- 0:00:27
      548500 -- [-356.232] (-358.020) (-358.967) (-358.729) * (-356.332) (-355.651) (-358.157) [-359.845] -- 0:00:27
      549000 -- (-357.861) (-361.291) [-364.870] (-357.611) * [-357.213] (-357.465) (-355.473) (-359.002) -- 0:00:27
      549500 -- (-359.260) (-360.535) (-358.960) [-359.776] * [-358.813] (-356.998) (-357.348) (-356.288) -- 0:00:27
      550000 -- [-355.567] (-355.796) (-357.461) (-355.605) * (-357.723) (-356.977) (-356.632) [-357.364] -- 0:00:27

      Average standard deviation of split frequencies: 0.009577

      550500 -- (-355.674) (-357.661) [-357.378] (-355.585) * (-358.796) (-356.797) [-355.445] (-355.952) -- 0:00:26
      551000 -- [-356.569] (-357.286) (-358.166) (-355.516) * (-357.724) [-355.421] (-356.464) (-356.516) -- 0:00:26
      551500 -- (-356.066) (-356.178) [-355.552] (-360.297) * [-358.918] (-357.398) (-357.416) (-356.347) -- 0:00:26
      552000 -- (-359.150) [-356.796] (-357.813) (-361.672) * (-359.059) (-358.889) [-356.701] (-356.992) -- 0:00:26
      552500 -- (-358.368) (-357.832) (-360.952) [-355.445] * (-357.679) [-358.430] (-359.010) (-358.528) -- 0:00:26
      553000 -- (-357.393) [-358.626] (-359.578) (-359.954) * [-356.267] (-363.420) (-357.702) (-356.013) -- 0:00:26
      553500 -- [-358.392] (-361.096) (-362.109) (-356.771) * (-359.490) [-359.441] (-355.561) (-357.730) -- 0:00:26
      554000 -- (-355.935) [-355.513] (-358.991) (-356.552) * (-359.012) (-360.445) [-357.269] (-357.652) -- 0:00:26
      554500 -- (-359.039) (-355.697) (-358.826) [-361.105] * (-355.620) (-359.553) [-356.139] (-357.946) -- 0:00:26
      555000 -- [-356.213] (-356.988) (-356.989) (-358.680) * (-355.246) (-355.811) (-361.106) [-357.029] -- 0:00:26

      Average standard deviation of split frequencies: 0.009114

      555500 -- [-359.748] (-355.303) (-356.792) (-357.223) * (-357.938) (-356.545) (-357.661) [-355.538] -- 0:00:26
      556000 -- (-358.444) [-355.816] (-359.436) (-359.544) * (-356.342) [-355.550] (-357.222) (-359.393) -- 0:00:27
      556500 -- (-359.774) (-355.984) (-359.186) [-356.746] * (-359.292) (-358.388) [-358.987] (-357.674) -- 0:00:27
      557000 -- (-362.000) (-355.676) [-356.019] (-355.838) * (-356.069) (-355.848) [-356.875] (-356.318) -- 0:00:27
      557500 -- (-357.718) [-355.976] (-355.875) (-358.469) * (-361.187) (-356.981) (-355.557) [-356.247] -- 0:00:26
      558000 -- [-356.250] (-355.239) (-357.554) (-358.252) * (-358.406) (-357.089) (-355.554) [-355.319] -- 0:00:26
      558500 -- (-360.966) (-356.426) [-356.346] (-360.421) * (-357.372) (-361.798) [-355.434] (-355.190) -- 0:00:26
      559000 -- (-358.833) [-355.572] (-357.051) (-358.864) * (-363.152) (-358.179) (-359.450) [-358.935] -- 0:00:26
      559500 -- (-355.458) (-356.343) [-357.810] (-357.457) * (-356.168) (-356.918) (-358.413) [-358.119] -- 0:00:26
      560000 -- (-358.162) (-357.531) (-357.448) [-360.106] * (-358.685) (-356.395) [-357.833] (-357.974) -- 0:00:26

      Average standard deviation of split frequencies: 0.009249

      560500 -- [-358.878] (-355.620) (-357.363) (-359.170) * (-355.893) (-359.173) [-357.766] (-359.074) -- 0:00:26
      561000 -- (-358.409) (-355.885) (-359.056) [-355.963] * [-356.302] (-357.361) (-358.297) (-358.294) -- 0:00:26
      561500 -- (-359.568) (-354.986) (-355.806) [-357.291] * (-356.335) (-356.568) (-356.724) [-356.199] -- 0:00:26
      562000 -- (-358.972) [-355.709] (-357.034) (-358.336) * (-357.968) (-358.029) (-358.231) [-355.594] -- 0:00:26
      562500 -- (-358.940) (-356.121) [-358.233] (-358.505) * (-360.920) [-355.520] (-356.979) (-361.084) -- 0:00:26
      563000 -- (-356.907) (-355.869) [-356.839] (-356.613) * (-362.584) [-355.161] (-358.634) (-356.409) -- 0:00:26
      563500 -- (-361.442) (-359.677) (-355.752) [-357.311] * [-360.104] (-355.178) (-360.225) (-358.785) -- 0:00:26
      564000 -- (-357.791) [-358.781] (-356.985) (-357.030) * [-357.017] (-357.425) (-357.995) (-361.224) -- 0:00:26
      564500 -- (-357.642) (-356.061) [-357.013] (-358.481) * (-357.247) (-355.460) [-355.346] (-357.393) -- 0:00:26
      565000 -- (-357.677) [-358.522] (-357.175) (-356.338) * (-358.182) [-356.927] (-356.750) (-357.378) -- 0:00:26

      Average standard deviation of split frequencies: 0.008849

      565500 -- [-358.533] (-356.684) (-355.020) (-355.083) * (-359.325) (-356.640) [-361.554] (-357.980) -- 0:00:26
      566000 -- (-358.030) (-358.518) [-358.200] (-355.048) * [-356.933] (-355.701) (-357.640) (-355.983) -- 0:00:26
      566500 -- (-356.509) [-358.922] (-357.094) (-360.900) * [-355.052] (-355.814) (-360.305) (-357.687) -- 0:00:26
      567000 -- (-356.778) (-357.525) [-358.867] (-357.296) * (-356.973) (-357.608) (-360.318) [-359.223] -- 0:00:25
      567500 -- (-355.980) (-358.503) (-358.477) [-358.717] * (-356.580) [-357.430] (-359.128) (-360.690) -- 0:00:25
      568000 -- [-357.388] (-356.352) (-357.041) (-359.698) * (-358.783) [-356.643] (-356.072) (-358.667) -- 0:00:25
      568500 -- (-355.864) (-358.670) [-361.123] (-359.781) * (-362.486) (-359.811) [-360.455] (-357.605) -- 0:00:25
      569000 -- (-355.574) (-355.400) [-359.406] (-358.618) * (-358.885) (-362.339) [-355.402] (-356.557) -- 0:00:25
      569500 -- (-355.505) (-358.696) [-358.191] (-355.796) * (-359.853) (-361.786) (-355.289) [-355.474] -- 0:00:25
      570000 -- (-357.765) [-357.696] (-357.666) (-356.928) * (-356.198) [-356.540] (-358.354) (-356.404) -- 0:00:25

      Average standard deviation of split frequencies: 0.008622

      570500 -- (-358.570) [-358.360] (-362.049) (-356.975) * (-358.171) (-356.776) (-358.190) [-356.662] -- 0:00:25
      571000 -- (-356.874) (-357.958) (-358.145) [-356.322] * (-359.020) (-360.151) (-356.261) [-356.919] -- 0:00:25
      571500 -- (-355.198) (-359.203) [-359.990] (-356.788) * (-356.583) (-361.354) (-355.235) [-355.639] -- 0:00:25
      572000 -- [-357.636] (-357.817) (-358.090) (-356.354) * (-355.412) (-366.702) [-355.493] (-356.347) -- 0:00:25
      572500 -- [-356.209] (-358.066) (-358.408) (-356.648) * (-355.564) [-358.268] (-357.390) (-359.601) -- 0:00:25
      573000 -- [-355.005] (-360.404) (-359.525) (-360.973) * (-356.118) (-356.762) (-355.704) [-358.311] -- 0:00:26
      573500 -- (-355.130) (-356.380) (-357.135) [-358.120] * [-355.764] (-356.675) (-360.980) (-361.441) -- 0:00:26
      574000 -- (-358.016) (-358.234) (-357.324) [-356.655] * (-356.254) (-356.648) (-363.029) [-362.474] -- 0:00:25
      574500 -- (-356.912) (-358.207) [-355.065] (-355.699) * (-358.946) (-355.160) (-359.980) [-355.631] -- 0:00:25
      575000 -- (-357.217) (-355.752) (-356.344) [-358.770] * (-358.316) (-357.215) [-355.903] (-357.096) -- 0:00:25

      Average standard deviation of split frequencies: 0.008644

      575500 -- (-360.132) [-356.062] (-355.661) (-356.119) * [-358.048] (-355.275) (-357.765) (-357.156) -- 0:00:25
      576000 -- (-357.380) (-355.712) (-355.490) [-357.600] * (-355.814) (-357.202) (-357.152) [-356.039] -- 0:00:25
      576500 -- (-358.747) [-358.897] (-357.644) (-357.601) * (-360.549) [-355.907] (-359.093) (-357.242) -- 0:00:25
      577000 -- (-362.899) (-357.587) [-360.763] (-357.471) * (-356.059) (-359.444) [-355.356] (-357.010) -- 0:00:25
      577500 -- [-359.386] (-357.777) (-360.528) (-359.656) * (-356.029) (-358.121) [-355.096] (-357.025) -- 0:00:25
      578000 -- (-356.007) (-357.145) [-356.685] (-355.764) * (-355.986) (-358.019) [-357.356] (-357.271) -- 0:00:25
      578500 -- (-356.141) [-355.342] (-363.296) (-355.776) * (-357.809) (-356.067) (-355.070) [-357.522] -- 0:00:25
      579000 -- [-356.624] (-356.075) (-357.919) (-359.891) * (-361.862) (-355.212) [-355.885] (-358.234) -- 0:00:25
      579500 -- [-355.662] (-357.524) (-355.129) (-356.281) * (-357.243) (-355.855) [-356.837] (-356.437) -- 0:00:25
      580000 -- [-356.414] (-355.327) (-359.870) (-355.807) * (-356.999) (-356.945) (-358.054) [-356.090] -- 0:00:25

      Average standard deviation of split frequencies: 0.008474

      580500 -- (-359.597) (-358.776) (-362.116) [-355.656] * (-357.027) (-356.869) [-355.390] (-357.617) -- 0:00:25
      581000 -- (-356.274) (-355.766) [-356.526] (-356.061) * (-360.486) (-358.204) (-357.664) [-356.900] -- 0:00:25
      581500 -- [-358.951] (-355.203) (-357.099) (-357.933) * (-360.835) (-361.640) [-358.075] (-355.963) -- 0:00:25
      582000 -- [-356.719] (-355.605) (-359.043) (-360.040) * (-358.449) (-359.059) [-355.212] (-358.923) -- 0:00:25
      582500 -- [-356.339] (-356.658) (-357.302) (-359.698) * (-356.271) (-356.306) (-357.246) [-356.790] -- 0:00:25
      583000 -- (-359.290) (-356.019) (-359.773) [-355.572] * (-359.191) [-358.230] (-361.601) (-358.615) -- 0:00:25
      583500 -- (-358.920) [-355.302] (-355.644) (-356.462) * (-358.237) (-357.556) (-356.150) [-359.370] -- 0:00:24
      584000 -- (-357.738) [-356.621] (-356.297) (-356.557) * (-356.116) (-359.310) [-355.839] (-357.860) -- 0:00:24
      584500 -- (-357.523) (-356.874) (-357.046) [-357.095] * (-355.895) [-359.010] (-358.309) (-357.483) -- 0:00:24
      585000 -- (-356.700) [-359.336] (-357.312) (-358.599) * (-355.951) [-356.039] (-357.009) (-358.895) -- 0:00:24

      Average standard deviation of split frequencies: 0.008547

      585500 -- [-355.470] (-357.144) (-355.502) (-357.518) * (-359.528) (-364.159) (-360.011) [-358.633] -- 0:00:24
      586000 -- (-356.481) [-358.000] (-356.622) (-357.626) * (-356.289) [-357.843] (-358.287) (-358.637) -- 0:00:24
      586500 -- (-357.136) (-358.791) [-356.752] (-357.149) * (-356.315) (-362.441) [-362.202] (-357.507) -- 0:00:24
      587000 -- (-358.380) (-361.805) (-356.778) [-356.451] * (-356.969) (-356.484) [-356.054] (-357.025) -- 0:00:24
      587500 -- (-358.193) [-356.534] (-357.061) (-356.000) * (-356.008) (-356.620) [-358.009] (-361.065) -- 0:00:24
      588000 -- (-356.709) [-358.699] (-361.368) (-356.745) * [-356.620] (-356.169) (-356.245) (-357.169) -- 0:00:24
      588500 -- (-359.119) (-357.771) (-359.298) [-356.992] * (-356.435) [-358.773] (-357.113) (-357.365) -- 0:00:24
      589000 -- (-356.583) [-357.299] (-355.854) (-359.931) * (-358.093) [-361.223] (-359.242) (-356.208) -- 0:00:24
      589500 -- (-357.671) (-356.940) (-360.117) [-360.286] * (-357.303) (-358.306) (-359.267) [-358.683] -- 0:00:24
      590000 -- (-358.345) [-357.631] (-364.686) (-358.623) * (-355.923) (-359.778) (-357.393) [-361.499] -- 0:00:25

      Average standard deviation of split frequencies: 0.008829

      590500 -- [-357.854] (-359.303) (-360.626) (-355.281) * (-357.535) [-356.010] (-359.097) (-358.220) -- 0:00:24
      591000 -- (-358.415) [-355.699] (-358.770) (-356.340) * (-359.356) (-358.880) [-357.094] (-361.588) -- 0:00:24
      591500 -- (-358.068) [-357.508] (-355.798) (-357.654) * (-358.107) [-356.105] (-356.727) (-357.787) -- 0:00:24
      592000 -- (-356.385) [-355.754] (-355.848) (-360.848) * (-359.652) (-360.980) [-356.136] (-355.120) -- 0:00:24
      592500 -- (-355.363) [-356.390] (-355.634) (-358.543) * (-355.964) (-359.704) [-356.463] (-355.299) -- 0:00:24
      593000 -- (-355.838) (-358.894) (-356.561) [-356.217] * [-356.759] (-357.523) (-356.544) (-355.868) -- 0:00:24
      593500 -- (-355.402) (-358.506) (-355.495) [-355.262] * [-358.573] (-357.034) (-356.404) (-356.771) -- 0:00:24
      594000 -- [-358.191] (-358.150) (-355.868) (-357.596) * (-358.362) (-359.551) [-355.872] (-356.578) -- 0:00:24
      594500 -- (-356.103) (-356.693) (-356.183) [-359.189] * (-355.334) [-357.398] (-355.733) (-361.474) -- 0:00:24
      595000 -- [-358.063] (-355.931) (-356.917) (-358.350) * [-355.428] (-356.441) (-357.419) (-357.542) -- 0:00:24

      Average standard deviation of split frequencies: 0.009544

      595500 -- (-357.894) (-357.838) (-360.972) [-355.454] * [-356.443] (-364.049) (-356.137) (-357.625) -- 0:00:24
      596000 -- (-357.040) [-358.905] (-359.785) (-356.643) * (-358.822) (-358.590) (-356.585) [-359.053] -- 0:00:24
      596500 -- [-355.865] (-365.038) (-359.286) (-357.168) * (-357.611) [-357.651] (-359.575) (-364.389) -- 0:00:24
      597000 -- [-356.401] (-359.365) (-359.000) (-359.238) * (-357.251) (-357.779) [-355.145] (-355.144) -- 0:00:24
      597500 -- [-358.402] (-356.086) (-356.114) (-359.153) * (-359.605) (-356.605) (-356.722) [-359.042] -- 0:00:24
      598000 -- (-357.611) (-359.406) [-357.283] (-357.526) * (-355.798) (-355.929) (-355.901) [-356.921] -- 0:00:24
      598500 -- (-360.780) (-358.137) (-362.791) [-357.081] * [-358.761] (-356.848) (-356.281) (-357.186) -- 0:00:24
      599000 -- [-355.953] (-357.198) (-359.735) (-360.238) * (-356.407) (-360.629) [-356.696] (-356.378) -- 0:00:24
      599500 -- [-359.090] (-358.431) (-359.988) (-359.607) * (-360.282) [-357.217] (-357.594) (-358.080) -- 0:00:24
      600000 -- (-357.289) (-355.983) [-358.250] (-356.240) * (-360.108) (-357.431) (-357.418) [-355.813] -- 0:00:24

      Average standard deviation of split frequencies: 0.009925

      600500 -- (-355.939) (-359.900) [-361.287] (-360.329) * (-356.312) [-355.004] (-357.921) (-359.067) -- 0:00:23
      601000 -- [-355.474] (-363.267) (-357.574) (-355.835) * (-356.238) (-355.226) (-358.265) [-356.873] -- 0:00:23
      601500 -- [-355.661] (-358.715) (-356.386) (-356.505) * [-358.077] (-356.877) (-356.213) (-356.812) -- 0:00:23
      602000 -- [-357.062] (-362.017) (-355.591) (-358.101) * (-356.631) (-355.746) (-357.860) [-355.886] -- 0:00:23
      602500 -- [-360.189] (-359.056) (-355.754) (-355.958) * (-356.955) [-355.709] (-356.388) (-356.840) -- 0:00:23
      603000 -- [-356.638] (-355.833) (-358.901) (-355.840) * [-356.969] (-356.723) (-357.391) (-360.883) -- 0:00:23
      603500 -- (-357.858) (-357.266) [-362.154] (-357.692) * [-358.868] (-356.683) (-356.453) (-356.237) -- 0:00:23
      604000 -- [-356.349] (-360.309) (-356.562) (-355.707) * [-359.840] (-359.766) (-359.133) (-357.560) -- 0:00:23
      604500 -- (-357.846) [-355.279] (-358.937) (-360.610) * (-356.240) [-358.743] (-359.688) (-356.723) -- 0:00:23
      605000 -- (-356.854) [-355.675] (-360.190) (-356.985) * (-358.164) (-357.055) (-357.836) [-357.159] -- 0:00:23

      Average standard deviation of split frequencies: 0.009884

      605500 -- (-357.161) (-358.903) (-357.807) [-358.493] * [-359.447] (-357.243) (-357.037) (-358.495) -- 0:00:23
      606000 -- (-357.843) [-355.990] (-356.846) (-362.774) * [-358.106] (-359.797) (-356.372) (-356.508) -- 0:00:23
      606500 -- (-359.007) (-356.614) (-357.769) [-356.891] * (-360.818) (-356.119) (-355.750) [-358.128] -- 0:00:24
      607000 -- (-357.922) [-355.524] (-359.235) (-356.139) * [-357.890] (-356.172) (-355.739) (-356.595) -- 0:00:23
      607500 -- [-356.827] (-358.686) (-364.516) (-356.453) * (-355.816) [-359.845] (-357.402) (-357.394) -- 0:00:23
      608000 -- (-359.350) (-356.384) (-357.728) [-358.749] * (-359.453) (-359.091) (-355.169) [-355.897] -- 0:00:23
      608500 -- (-357.725) (-357.313) [-355.375] (-357.899) * (-355.535) (-361.347) (-355.591) [-355.799] -- 0:00:23
      609000 -- (-358.355) [-356.297] (-360.537) (-357.236) * [-358.152] (-361.933) (-356.384) (-355.540) -- 0:00:23
      609500 -- (-356.217) (-355.935) [-355.254] (-357.387) * [-356.123] (-359.008) (-355.429) (-358.865) -- 0:00:23
      610000 -- (-355.841) (-357.156) (-355.518) [-357.293] * (-358.316) [-358.147] (-358.690) (-357.713) -- 0:00:23

      Average standard deviation of split frequencies: 0.009400

      610500 -- [-356.067] (-356.452) (-362.940) (-356.040) * (-356.373) (-359.459) [-359.048] (-358.884) -- 0:00:23
      611000 -- [-358.156] (-357.191) (-357.558) (-363.625) * (-357.811) (-357.051) [-356.514] (-361.425) -- 0:00:23
      611500 -- [-358.030] (-355.553) (-357.609) (-362.346) * [-356.046] (-359.473) (-358.462) (-356.970) -- 0:00:23
      612000 -- [-355.902] (-359.680) (-355.898) (-363.068) * [-359.284] (-356.318) (-359.652) (-355.387) -- 0:00:23
      612500 -- (-356.404) [-355.562] (-357.976) (-360.342) * (-360.615) (-359.849) (-357.547) [-360.047] -- 0:00:23
      613000 -- (-360.979) [-360.363] (-356.031) (-356.858) * (-357.639) [-356.641] (-359.897) (-355.525) -- 0:00:23
      613500 -- (-358.564) [-357.253] (-357.139) (-360.059) * (-357.843) [-357.254] (-357.157) (-357.169) -- 0:00:23
      614000 -- (-357.969) (-356.711) [-356.652] (-356.108) * (-358.985) [-356.187] (-358.269) (-359.067) -- 0:00:23
      614500 -- (-356.889) [-356.189] (-356.930) (-358.840) * (-357.625) [-360.424] (-357.212) (-359.456) -- 0:00:23
      615000 -- (-359.461) (-357.298) [-355.696] (-356.639) * (-357.323) [-356.164] (-356.026) (-356.040) -- 0:00:23

      Average standard deviation of split frequencies: 0.009693

      615500 -- [-359.349] (-357.350) (-357.347) (-355.643) * [-358.114] (-355.233) (-359.843) (-355.502) -- 0:00:23
      616000 -- [-355.958] (-359.135) (-357.252) (-355.754) * (-356.130) [-357.019] (-358.111) (-355.981) -- 0:00:23
      616500 -- [-360.094] (-357.213) (-357.230) (-361.616) * (-354.913) (-359.312) [-357.351] (-356.085) -- 0:00:23
      617000 -- (-361.834) [-358.070] (-357.509) (-361.810) * (-357.148) [-356.761] (-355.719) (-358.989) -- 0:00:22
      617500 -- (-357.077) (-358.314) [-355.923] (-358.181) * (-358.403) (-355.646) [-357.387] (-356.979) -- 0:00:22
      618000 -- [-357.462] (-355.668) (-357.168) (-357.956) * (-358.629) (-356.745) (-360.118) [-355.298] -- 0:00:22
      618500 -- (-355.852) (-360.031) [-356.232] (-357.728) * (-357.858) (-357.473) [-359.390] (-357.254) -- 0:00:22
      619000 -- [-357.711] (-357.412) (-356.469) (-356.671) * (-355.824) (-360.518) (-358.219) [-355.883] -- 0:00:22
      619500 -- (-356.708) (-355.920) [-356.668] (-358.658) * (-355.491) (-356.321) (-358.241) [-359.167] -- 0:00:22
      620000 -- [-357.401] (-356.213) (-356.986) (-355.387) * (-359.549) [-356.350] (-359.519) (-356.109) -- 0:00:22

      Average standard deviation of split frequencies: 0.009921

      620500 -- [-356.574] (-361.253) (-359.152) (-355.369) * (-357.354) [-357.094] (-357.774) (-355.914) -- 0:00:22
      621000 -- (-357.626) [-356.667] (-358.974) (-355.524) * (-356.617) [-357.065] (-357.143) (-359.927) -- 0:00:22
      621500 -- (-355.454) (-362.091) (-355.727) [-358.049] * [-355.341] (-358.018) (-355.754) (-355.511) -- 0:00:22
      622000 -- (-357.873) (-356.912) [-356.599] (-358.288) * (-356.072) [-356.364] (-357.067) (-357.142) -- 0:00:22
      622500 -- (-359.825) (-356.296) [-355.581] (-359.442) * (-355.781) [-355.482] (-356.619) (-357.651) -- 0:00:22
      623000 -- (-358.003) [-357.001] (-356.718) (-357.328) * (-357.055) (-356.267) (-356.964) [-357.981] -- 0:00:22
      623500 -- (-358.420) (-358.417) (-356.094) [-359.717] * (-357.974) (-360.951) (-361.024) [-358.547] -- 0:00:22
      624000 -- (-357.655) [-356.938] (-355.628) (-355.754) * (-360.262) (-357.538) (-360.157) [-356.452] -- 0:00:22
      624500 -- (-357.747) (-356.901) [-355.773] (-356.490) * (-358.627) (-357.357) (-360.911) [-356.243] -- 0:00:22
      625000 -- [-357.479] (-356.680) (-356.634) (-357.354) * (-360.079) (-356.914) (-361.854) [-356.092] -- 0:00:22

      Average standard deviation of split frequencies: 0.010191

      625500 -- [-355.523] (-358.419) (-358.449) (-363.579) * [-357.626] (-361.759) (-361.020) (-356.022) -- 0:00:22
      626000 -- (-355.423) [-357.356] (-358.758) (-359.682) * (-356.043) [-356.665] (-357.698) (-355.437) -- 0:00:22
      626500 -- [-355.809] (-358.425) (-358.357) (-357.358) * (-356.987) [-357.014] (-363.349) (-356.020) -- 0:00:22
      627000 -- (-359.177) (-360.054) [-356.612] (-358.604) * (-358.913) (-360.604) [-356.094] (-358.883) -- 0:00:22
      627500 -- [-357.022] (-362.442) (-358.812) (-358.090) * (-361.063) [-358.855] (-362.005) (-359.304) -- 0:00:22
      628000 -- (-357.777) (-358.642) (-364.371) [-359.659] * (-355.613) (-358.169) [-357.338] (-358.961) -- 0:00:22
      628500 -- [-357.724] (-356.684) (-355.944) (-358.667) * (-359.064) (-355.616) [-356.955] (-358.482) -- 0:00:22
      629000 -- (-356.555) (-357.742) (-362.579) [-355.693] * (-357.381) [-357.771] (-356.711) (-361.931) -- 0:00:22
      629500 -- (-356.532) (-358.232) (-362.029) [-356.631] * (-356.025) (-355.888) [-355.930] (-357.184) -- 0:00:22
      630000 -- (-356.575) [-356.078] (-365.183) (-357.407) * (-355.953) [-357.390] (-357.814) (-359.181) -- 0:00:22

      Average standard deviation of split frequencies: 0.010465

      630500 -- (-356.356) (-357.649) [-360.660] (-358.246) * (-355.785) (-357.885) (-356.992) [-356.411] -- 0:00:22
      631000 -- [-356.912] (-356.482) (-364.156) (-359.201) * [-357.758] (-359.620) (-355.389) (-364.929) -- 0:00:22
      631500 -- [-358.163] (-355.031) (-357.745) (-356.352) * (-356.377) [-359.343] (-356.783) (-360.539) -- 0:00:22
      632000 -- (-357.442) [-358.468] (-357.865) (-358.676) * (-356.555) [-357.561] (-359.404) (-358.346) -- 0:00:22
      632500 -- [-357.400] (-358.063) (-365.146) (-358.805) * (-357.062) [-358.260] (-359.093) (-358.132) -- 0:00:22
      633000 -- [-356.879] (-356.589) (-362.102) (-357.293) * (-355.657) [-355.513] (-358.671) (-360.019) -- 0:00:22
      633500 -- [-355.523] (-358.837) (-360.611) (-360.172) * (-357.651) (-358.028) (-356.515) [-358.332] -- 0:00:21
      634000 -- (-356.710) [-362.303] (-362.529) (-356.231) * (-356.616) (-359.186) (-355.633) [-357.211] -- 0:00:21
      634500 -- (-357.228) (-359.319) (-369.087) [-358.497] * (-358.527) (-358.006) [-355.725] (-355.777) -- 0:00:21
      635000 -- (-355.779) (-356.686) (-359.063) [-356.967] * (-355.431) [-355.459] (-358.153) (-357.174) -- 0:00:21

      Average standard deviation of split frequencies: 0.009984

      635500 -- [-357.872] (-356.884) (-359.891) (-364.179) * (-355.356) (-357.185) (-356.921) [-356.733] -- 0:00:21
      636000 -- (-356.078) (-356.124) (-357.766) [-356.409] * [-355.410] (-360.298) (-357.159) (-356.500) -- 0:00:21
      636500 -- (-357.872) [-355.767] (-356.212) (-357.729) * (-356.305) (-356.911) [-359.003] (-357.129) -- 0:00:21
      637000 -- (-361.395) (-359.261) [-360.959] (-358.893) * (-356.189) [-358.004] (-355.845) (-359.036) -- 0:00:21
      637500 -- [-357.453] (-355.562) (-359.126) (-358.919) * (-356.848) (-356.511) [-359.813] (-358.010) -- 0:00:21
      638000 -- (-362.154) [-359.253] (-359.164) (-358.128) * (-357.500) (-357.270) (-356.332) [-357.952] -- 0:00:21
      638500 -- (-360.098) (-358.037) [-358.687] (-356.382) * (-358.499) (-360.642) [-358.104] (-356.328) -- 0:00:21
      639000 -- (-356.972) [-359.011] (-356.003) (-362.717) * (-357.784) [-357.393] (-359.951) (-355.685) -- 0:00:21
      639500 -- [-355.665] (-356.454) (-358.032) (-358.186) * [-356.107] (-355.752) (-357.759) (-359.799) -- 0:00:21
      640000 -- (-356.346) [-357.203] (-356.226) (-356.860) * (-355.420) (-356.603) [-356.149] (-361.765) -- 0:00:21

      Average standard deviation of split frequencies: 0.010128

      640500 -- (-357.808) [-357.057] (-357.055) (-356.232) * [-356.251] (-359.260) (-359.190) (-359.592) -- 0:00:21
      641000 -- (-358.591) [-355.141] (-357.178) (-357.110) * (-356.020) [-359.641] (-356.901) (-359.800) -- 0:00:21
      641500 -- (-361.342) (-356.429) (-357.728) [-355.770] * (-360.959) (-356.233) (-356.025) [-355.335] -- 0:00:21
      642000 -- [-358.200] (-361.396) (-360.650) (-355.920) * [-360.477] (-359.888) (-355.673) (-359.323) -- 0:00:21
      642500 -- [-358.274] (-358.612) (-360.540) (-358.854) * (-357.179) (-355.212) [-357.686] (-358.200) -- 0:00:21
      643000 -- (-357.501) (-359.232) [-359.595] (-358.652) * [-357.690] (-356.389) (-362.345) (-355.657) -- 0:00:21
      643500 -- [-356.882] (-359.100) (-357.577) (-359.171) * [-357.501] (-357.780) (-359.358) (-356.407) -- 0:00:21
      644000 -- (-356.468) (-359.187) [-355.874] (-358.175) * [-355.369] (-357.102) (-358.128) (-356.234) -- 0:00:21
      644500 -- (-357.458) (-356.895) [-355.436] (-355.719) * (-356.817) [-358.218] (-360.063) (-356.268) -- 0:00:21
      645000 -- [-356.303] (-362.316) (-358.674) (-356.370) * (-357.446) (-363.598) (-360.055) [-355.339] -- 0:00:21

      Average standard deviation of split frequencies: 0.010431

      645500 -- (-363.805) (-355.778) [-355.733] (-357.304) * (-355.516) [-355.329] (-356.760) (-358.325) -- 0:00:21
      646000 -- [-357.014] (-358.520) (-358.647) (-358.194) * (-356.542) (-356.470) (-359.426) [-359.307] -- 0:00:21
      646500 -- [-355.471] (-359.379) (-362.395) (-357.459) * [-356.070] (-357.703) (-357.748) (-359.876) -- 0:00:21
      647000 -- (-356.691) (-357.494) (-357.072) [-359.093] * (-355.461) [-356.736] (-358.038) (-359.878) -- 0:00:21
      647500 -- [-356.592] (-359.273) (-356.482) (-355.763) * (-357.358) (-356.740) [-358.409] (-356.857) -- 0:00:21
      648000 -- (-356.856) (-360.495) [-355.166] (-359.129) * (-356.487) (-357.421) (-356.436) [-358.079] -- 0:00:21
      648500 -- (-356.555) [-355.348] (-361.522) (-357.482) * (-358.106) (-358.679) (-356.430) [-359.516] -- 0:00:21
      649000 -- (-355.484) (-356.537) (-357.713) [-359.323] * (-360.629) [-355.873] (-362.059) (-357.870) -- 0:00:21
      649500 -- (-356.810) (-357.032) [-360.166] (-359.384) * (-359.124) [-358.934] (-358.413) (-355.848) -- 0:00:21
      650000 -- (-358.282) (-355.817) [-356.357] (-359.931) * (-357.564) (-362.216) [-359.750] (-356.863) -- 0:00:21

      Average standard deviation of split frequencies: 0.010526

      650500 -- (-356.111) (-357.752) (-358.422) [-359.674] * (-359.078) [-360.088] (-360.304) (-356.499) -- 0:00:20
      651000 -- (-361.857) [-356.891] (-356.561) (-358.452) * [-356.342] (-359.325) (-357.200) (-355.961) -- 0:00:20
      651500 -- (-358.067) [-356.424] (-359.085) (-358.306) * (-358.173) (-357.819) (-356.956) [-356.677] -- 0:00:20
      652000 -- [-357.353] (-359.104) (-356.773) (-356.405) * (-358.297) (-360.211) (-358.718) [-356.907] -- 0:00:20
      652500 -- (-356.867) (-355.951) [-357.326] (-357.786) * (-360.062) (-356.452) (-356.070) [-355.908] -- 0:00:20
      653000 -- (-357.955) (-356.008) (-357.965) [-357.053] * (-357.029) (-357.635) [-356.969] (-357.351) -- 0:00:20
      653500 -- (-359.985) [-356.638] (-356.392) (-356.458) * [-357.544] (-356.926) (-356.170) (-357.049) -- 0:00:20
      654000 -- (-357.875) (-359.000) (-355.513) [-358.673] * (-357.257) [-355.807] (-357.365) (-357.282) -- 0:00:20
      654500 -- (-360.302) (-355.351) (-356.586) [-362.114] * (-358.271) [-357.587] (-356.500) (-358.450) -- 0:00:20
      655000 -- (-357.112) [-357.721] (-355.989) (-361.590) * (-357.455) (-357.593) (-363.902) [-359.233] -- 0:00:20

      Average standard deviation of split frequencies: 0.010441

      655500 -- (-355.980) (-359.206) [-355.057] (-358.163) * (-355.993) (-359.426) (-356.457) [-358.863] -- 0:00:20
      656000 -- (-355.360) [-355.610] (-356.278) (-355.242) * (-357.963) (-356.245) (-358.423) [-359.859] -- 0:00:20
      656500 -- (-355.842) (-360.069) (-356.394) [-355.490] * [-356.840] (-357.701) (-356.871) (-356.296) -- 0:00:20
      657000 -- (-357.541) [-356.449] (-358.093) (-358.033) * (-356.213) (-357.971) (-359.210) [-358.662] -- 0:00:20
      657500 -- [-359.302] (-357.220) (-357.929) (-360.539) * [-355.696] (-356.972) (-361.131) (-355.656) -- 0:00:20
      658000 -- [-356.042] (-356.463) (-358.157) (-358.522) * [-355.417] (-356.817) (-357.580) (-360.136) -- 0:00:20
      658500 -- [-356.872] (-357.412) (-356.751) (-359.701) * (-356.001) (-361.094) (-361.398) [-356.397] -- 0:00:20
      659000 -- (-359.018) (-359.719) [-357.967] (-368.170) * (-358.211) [-358.783] (-359.992) (-358.718) -- 0:00:20
      659500 -- (-357.987) (-357.423) [-357.066] (-358.766) * (-355.182) [-357.547] (-356.022) (-358.321) -- 0:00:20
      660000 -- (-355.194) (-356.066) (-356.672) [-358.465] * [-358.469] (-359.816) (-356.155) (-357.668) -- 0:00:20

      Average standard deviation of split frequencies: 0.010283

      660500 -- (-360.556) (-358.331) [-356.226] (-356.225) * (-356.513) (-358.177) (-355.527) [-356.655] -- 0:00:20
      661000 -- (-356.985) (-359.048) (-356.295) [-357.319] * [-356.634] (-357.890) (-355.504) (-357.001) -- 0:00:20
      661500 -- [-356.658] (-356.569) (-355.500) (-356.569) * (-356.354) (-357.869) [-356.010] (-356.489) -- 0:00:20
      662000 -- (-355.900) [-357.575] (-355.896) (-357.242) * (-357.380) [-364.221] (-357.424) (-356.790) -- 0:00:20
      662500 -- (-360.186) (-357.633) (-357.392) [-356.371] * (-357.800) [-357.122] (-359.591) (-357.723) -- 0:00:20
      663000 -- [-357.874] (-355.151) (-357.869) (-355.974) * (-357.647) [-356.090] (-358.749) (-357.562) -- 0:00:20
      663500 -- (-359.715) (-355.806) [-357.598] (-357.012) * (-357.684) (-355.138) [-355.428] (-357.016) -- 0:00:20
      664000 -- [-366.213] (-358.394) (-356.904) (-357.896) * (-361.718) (-358.315) (-356.783) [-359.772] -- 0:00:20
      664500 -- (-361.569) (-359.201) (-356.770) [-356.284] * (-360.438) (-355.461) (-356.545) [-358.337] -- 0:00:20
      665000 -- (-357.597) (-356.154) (-363.917) [-355.833] * (-357.481) (-359.383) (-356.897) [-358.908] -- 0:00:20

      Average standard deviation of split frequencies: 0.010242

      665500 -- (-356.149) [-356.613] (-359.536) (-356.531) * (-356.254) (-356.426) (-356.149) [-359.372] -- 0:00:20
      666000 -- (-356.874) (-356.688) (-359.916) [-356.199] * (-356.225) (-357.526) (-355.922) [-355.630] -- 0:00:20
      666500 -- [-356.140] (-356.539) (-356.680) (-358.937) * (-360.601) (-356.658) [-358.257] (-356.926) -- 0:00:20
      667000 -- (-355.525) (-357.299) (-356.457) [-358.333] * (-357.026) (-359.863) (-355.817) [-356.721] -- 0:00:19
      667500 -- (-355.760) (-356.982) [-362.450] (-360.095) * (-356.702) (-358.284) (-362.566) [-356.330] -- 0:00:19
      668000 -- [-357.164] (-357.427) (-356.551) (-360.398) * (-358.974) (-356.210) [-356.985] (-358.188) -- 0:00:19
      668500 -- (-355.238) [-357.889] (-355.648) (-362.053) * (-358.403) [-356.912] (-356.730) (-359.483) -- 0:00:19
      669000 -- (-362.348) (-358.925) (-359.630) [-356.038] * (-357.666) [-355.999] (-356.154) (-355.828) -- 0:00:19
      669500 -- (-357.940) (-357.392) (-356.346) [-357.492] * (-358.517) [-355.849] (-360.079) (-357.381) -- 0:00:19
      670000 -- (-356.120) (-356.572) [-356.014] (-359.669) * (-361.699) [-357.324] (-358.526) (-358.564) -- 0:00:19

      Average standard deviation of split frequencies: 0.010089

      670500 -- (-360.148) [-356.021] (-356.260) (-357.414) * (-362.209) [-357.783] (-359.657) (-355.929) -- 0:00:19
      671000 -- (-358.253) (-357.432) (-358.060) [-357.288] * (-357.214) (-359.653) (-357.446) [-356.569] -- 0:00:19
      671500 -- (-359.284) [-355.914] (-360.675) (-360.009) * (-355.566) [-363.204] (-357.377) (-357.719) -- 0:00:19
      672000 -- (-356.460) (-361.540) (-358.370) [-355.833] * (-356.395) (-357.872) [-356.243] (-355.960) -- 0:00:19
      672500 -- [-356.337] (-356.649) (-356.505) (-356.131) * (-358.479) [-362.456] (-360.979) (-355.583) -- 0:00:19
      673000 -- (-357.466) (-357.311) [-358.429] (-356.207) * (-356.102) [-359.367] (-357.110) (-358.094) -- 0:00:19
      673500 -- (-357.782) (-356.070) (-357.149) [-355.882] * (-358.670) (-359.567) (-355.263) [-355.959] -- 0:00:19
      674000 -- (-358.018) (-356.612) (-357.439) [-356.166] * (-359.668) (-358.772) [-356.187] (-359.034) -- 0:00:19
      674500 -- (-355.611) [-357.562] (-356.286) (-359.879) * (-356.388) (-357.972) [-356.499] (-358.285) -- 0:00:19
      675000 -- [-358.623] (-356.562) (-361.445) (-360.212) * (-356.203) (-356.042) (-359.872) [-356.506] -- 0:00:19

      Average standard deviation of split frequencies: 0.010050

      675500 -- [-358.294] (-357.844) (-357.608) (-356.311) * (-357.053) (-357.360) (-355.609) [-357.160] -- 0:00:19
      676000 -- [-359.080] (-355.957) (-358.143) (-359.495) * (-356.659) (-358.950) [-355.126] (-357.678) -- 0:00:19
      676500 -- (-356.183) (-356.431) [-356.073] (-360.214) * (-355.780) (-358.233) (-357.510) [-356.711] -- 0:00:19
      677000 -- [-358.369] (-355.757) (-356.957) (-363.559) * [-356.989] (-357.154) (-357.971) (-360.225) -- 0:00:19
      677500 -- (-356.420) [-357.348] (-356.126) (-358.167) * (-356.424) (-357.990) [-356.354] (-359.043) -- 0:00:19
      678000 -- [-357.782] (-361.712) (-359.829) (-361.697) * (-356.382) [-359.452] (-358.611) (-356.087) -- 0:00:19
      678500 -- (-358.506) [-368.196] (-355.796) (-357.481) * [-356.925] (-359.126) (-358.737) (-355.693) -- 0:00:19
      679000 -- (-359.304) (-361.127) [-355.853] (-358.744) * [-355.786] (-358.540) (-358.457) (-355.379) -- 0:00:19
      679500 -- (-356.484) [-355.858] (-357.659) (-358.788) * (-355.674) (-355.435) (-356.019) [-355.761] -- 0:00:19
      680000 -- (-356.967) (-356.119) (-356.515) [-357.974] * (-358.692) (-355.363) [-356.360] (-355.848) -- 0:00:19

      Average standard deviation of split frequencies: 0.009981

      680500 -- (-356.277) (-355.222) [-356.146] (-357.198) * (-356.694) (-356.034) [-357.041] (-355.741) -- 0:00:19
      681000 -- (-360.190) (-356.130) (-356.742) [-358.130] * (-357.739) (-355.698) (-359.578) [-358.669] -- 0:00:19
      681500 -- (-356.051) (-356.508) [-355.275] (-355.152) * (-355.513) (-357.498) [-356.545] (-359.627) -- 0:00:19
      682000 -- (-358.496) [-356.504] (-355.299) (-356.697) * (-357.144) (-358.207) [-356.408] (-357.117) -- 0:00:19
      682500 -- (-357.974) (-357.151) [-356.337] (-358.087) * (-361.719) [-357.101] (-356.716) (-359.134) -- 0:00:19
      683000 -- (-360.507) [-355.980] (-355.081) (-356.723) * [-360.694] (-356.782) (-358.353) (-359.468) -- 0:00:19
      683500 -- (-357.369) (-356.916) (-354.998) [-357.155] * [-358.743] (-357.845) (-361.721) (-356.146) -- 0:00:18
      684000 -- [-358.891] (-362.030) (-355.191) (-357.317) * [-356.043] (-355.599) (-363.145) (-357.825) -- 0:00:18
      684500 -- (-357.976) (-365.630) [-355.127] (-357.868) * (-356.601) (-356.903) [-356.262] (-356.295) -- 0:00:18
      685000 -- (-358.600) (-359.080) [-356.613] (-356.158) * [-357.714] (-357.060) (-357.612) (-358.737) -- 0:00:18

      Average standard deviation of split frequencies: 0.009661

      685500 -- (-359.421) (-358.494) (-356.218) [-355.814] * (-356.171) [-355.250] (-356.657) (-362.140) -- 0:00:18
      686000 -- [-358.698] (-359.489) (-356.473) (-357.269) * (-355.619) (-357.377) [-356.497] (-357.125) -- 0:00:18
      686500 -- [-358.817] (-357.513) (-356.340) (-358.035) * (-357.630) (-356.680) [-355.454] (-357.344) -- 0:00:18
      687000 -- (-358.631) (-356.140) (-357.360) [-357.370] * [-355.522] (-361.698) (-354.967) (-358.208) -- 0:00:18
      687500 -- (-357.311) (-356.142) (-356.534) [-361.425] * (-355.176) (-364.686) [-357.245] (-356.714) -- 0:00:18
      688000 -- (-356.814) (-359.544) (-356.197) [-355.865] * (-355.682) [-359.107] (-357.270) (-356.985) -- 0:00:18
      688500 -- [-356.711] (-356.036) (-356.452) (-356.347) * (-356.807) [-357.635] (-359.029) (-356.286) -- 0:00:18
      689000 -- (-357.134) (-357.334) (-356.685) [-355.998] * (-359.441) (-361.887) (-355.412) [-357.388] -- 0:00:18
      689500 -- (-356.466) (-357.478) (-355.965) [-355.975] * (-359.027) [-355.740] (-357.383) (-360.390) -- 0:00:18
      690000 -- (-357.861) (-358.691) [-356.851] (-356.175) * (-362.978) (-357.330) (-356.423) [-357.061] -- 0:00:18

      Average standard deviation of split frequencies: 0.009756

      690500 -- [-357.321] (-360.321) (-358.578) (-357.491) * (-357.594) (-355.989) [-357.813] (-358.474) -- 0:00:18
      691000 -- (-357.046) [-357.256] (-358.966) (-357.641) * (-359.818) (-356.750) (-357.662) [-358.222] -- 0:00:18
      691500 -- (-359.093) [-356.330] (-363.151) (-357.478) * (-359.055) [-355.659] (-355.836) (-358.119) -- 0:00:18
      692000 -- (-358.495) [-357.161] (-361.266) (-357.495) * (-357.339) (-361.420) [-357.026] (-355.789) -- 0:00:18
      692500 -- (-357.785) (-356.786) (-355.100) [-357.407] * [-358.973] (-360.865) (-362.730) (-356.119) -- 0:00:18
      693000 -- (-356.568) (-359.934) [-358.544] (-358.205) * (-359.788) [-356.432] (-356.650) (-356.364) -- 0:00:18
      693500 -- (-357.221) (-361.384) [-357.347] (-355.446) * (-358.152) (-356.589) [-356.621] (-358.121) -- 0:00:18
      694000 -- (-357.763) (-361.676) [-356.150] (-357.407) * (-359.011) [-360.274] (-363.416) (-355.726) -- 0:00:18
      694500 -- [-360.171] (-364.871) (-358.096) (-357.949) * (-357.647) [-358.207] (-359.067) (-356.387) -- 0:00:18
      695000 -- (-356.040) (-356.146) (-360.409) [-358.038] * (-359.941) (-356.139) (-358.062) [-355.300] -- 0:00:18

      Average standard deviation of split frequencies: 0.010000

      695500 -- (-357.590) (-359.054) [-361.641] (-361.857) * (-359.066) [-358.471] (-358.853) (-357.519) -- 0:00:18
      696000 -- (-358.257) (-361.609) [-357.036] (-361.536) * (-359.097) (-358.235) (-358.010) [-358.707] -- 0:00:18
      696500 -- (-357.933) (-363.697) (-359.437) [-358.887] * (-358.896) [-358.780] (-356.629) (-355.225) -- 0:00:18
      697000 -- (-357.628) [-356.964] (-359.307) (-356.775) * [-356.851] (-368.880) (-355.763) (-357.141) -- 0:00:18
      697500 -- (-356.186) (-355.958) (-357.943) [-356.196] * [-356.339] (-356.877) (-356.111) (-358.195) -- 0:00:18
      698000 -- [-357.439] (-358.278) (-355.652) (-357.551) * [-357.504] (-360.520) (-362.343) (-357.329) -- 0:00:18
      698500 -- (-358.378) [-355.734] (-355.801) (-357.406) * [-359.598] (-356.991) (-356.072) (-358.779) -- 0:00:18
      699000 -- (-355.570) (-356.155) (-356.605) [-356.689] * (-360.445) [-361.676] (-355.802) (-358.677) -- 0:00:18
      699500 -- (-357.180) [-356.437] (-356.173) (-356.787) * (-360.718) [-356.944] (-358.153) (-359.630) -- 0:00:18
      700000 -- (-356.344) (-356.586) (-356.656) [-356.854] * (-356.978) (-360.658) (-357.159) [-359.506] -- 0:00:18

      Average standard deviation of split frequencies: 0.008999

      700500 -- (-357.634) [-358.605] (-357.121) (-357.915) * (-356.689) [-355.652] (-357.967) (-356.422) -- 0:00:17
      701000 -- (-359.831) (-360.711) [-357.427] (-357.044) * [-360.013] (-357.696) (-359.306) (-360.787) -- 0:00:17
      701500 -- (-362.302) (-358.669) (-358.400) [-357.201] * (-357.099) (-357.097) [-357.928] (-355.615) -- 0:00:17
      702000 -- (-355.285) [-356.253] (-357.249) (-358.574) * (-362.446) (-358.850) (-357.635) [-356.710] -- 0:00:17
      702500 -- (-356.877) [-357.003] (-357.132) (-357.837) * (-360.575) [-358.774] (-358.702) (-356.542) -- 0:00:17
      703000 -- (-359.310) (-356.089) (-358.858) [-357.145] * [-357.396] (-356.004) (-358.985) (-357.606) -- 0:00:17
      703500 -- [-356.406] (-360.658) (-355.903) (-359.866) * (-358.773) (-355.811) (-356.521) [-357.064] -- 0:00:17
      704000 -- (-357.319) (-358.238) (-359.747) [-357.120] * (-359.696) (-355.937) [-360.022] (-358.802) -- 0:00:17
      704500 -- (-356.358) (-356.024) (-361.411) [-358.805] * (-356.890) [-356.168] (-363.083) (-358.253) -- 0:00:17
      705000 -- (-360.789) (-361.147) (-356.112) [-355.462] * (-356.978) [-357.254] (-358.906) (-356.325) -- 0:00:17

      Average standard deviation of split frequencies: 0.009701

      705500 -- (-359.718) (-358.280) [-360.064] (-355.747) * (-360.648) (-356.580) [-356.660] (-357.074) -- 0:00:17
      706000 -- (-358.576) [-357.762] (-357.282) (-357.376) * (-359.666) (-358.013) [-358.844] (-355.977) -- 0:00:17
      706500 -- (-355.412) (-356.030) [-355.627] (-358.206) * (-360.826) [-358.348] (-358.799) (-358.457) -- 0:00:17
      707000 -- (-358.043) (-355.180) (-361.004) [-356.979] * [-356.977] (-358.694) (-356.681) (-359.823) -- 0:00:17
      707500 -- (-361.475) (-355.134) [-356.848] (-356.531) * (-357.627) [-358.636] (-356.362) (-358.736) -- 0:00:17
      708000 -- (-358.975) (-356.578) [-356.526] (-356.817) * (-357.731) (-357.857) [-356.462] (-357.729) -- 0:00:17
      708500 -- (-356.062) [-360.505] (-356.934) (-357.414) * [-357.948] (-357.895) (-357.612) (-355.241) -- 0:00:17
      709000 -- (-359.793) (-356.005) (-357.248) [-356.692] * [-360.494] (-360.606) (-356.389) (-357.615) -- 0:00:17
      709500 -- (-355.719) (-355.255) (-356.178) [-358.092] * (-356.194) [-355.706] (-357.134) (-358.380) -- 0:00:17
      710000 -- (-357.600) (-355.336) (-356.253) [-357.580] * (-356.814) (-358.186) (-356.055) [-357.254] -- 0:00:17

      Average standard deviation of split frequencies: 0.009204

      710500 -- (-361.937) [-357.050] (-356.433) (-356.473) * (-356.001) [-357.830] (-355.204) (-358.764) -- 0:00:17
      711000 -- (-357.360) (-356.585) (-356.534) [-355.828] * (-360.491) [-356.544] (-356.036) (-356.110) -- 0:00:17
      711500 -- (-357.185) [-355.902] (-356.292) (-358.942) * (-357.230) (-356.904) (-358.566) [-355.897] -- 0:00:17
      712000 -- (-356.635) (-355.426) [-359.074] (-361.500) * [-357.185] (-358.439) (-359.173) (-358.900) -- 0:00:17
      712500 -- (-356.006) (-358.760) (-356.370) [-360.783] * (-357.732) (-356.743) [-357.402] (-360.539) -- 0:00:17
      713000 -- [-357.094] (-356.984) (-357.337) (-359.371) * (-357.824) (-360.091) (-359.633) [-357.826] -- 0:00:17
      713500 -- [-355.968] (-356.441) (-355.444) (-358.285) * (-355.457) (-361.938) (-358.078) [-356.867] -- 0:00:17
      714000 -- (-356.904) (-356.573) [-355.874] (-356.512) * (-357.584) (-358.069) (-358.095) [-358.005] -- 0:00:17
      714500 -- [-357.142] (-356.480) (-357.123) (-360.196) * (-356.260) (-360.270) (-357.210) [-358.328] -- 0:00:17
      715000 -- (-358.204) (-355.898) (-356.218) [-358.166] * (-355.643) (-357.558) (-357.033) [-358.026] -- 0:00:17

      Average standard deviation of split frequencies: 0.009217

      715500 -- (-358.711) (-361.109) [-355.328] (-358.971) * [-356.165] (-357.195) (-356.514) (-357.635) -- 0:00:17
      716000 -- [-355.859] (-356.570) (-355.297) (-359.805) * (-358.830) (-360.961) (-358.011) [-356.049] -- 0:00:17
      716500 -- [-359.014] (-362.179) (-356.250) (-357.967) * (-359.084) [-359.306] (-359.725) (-358.286) -- 0:00:17
      717000 -- (-355.171) (-358.118) (-356.396) [-359.404] * (-356.975) (-359.393) (-357.488) [-356.963] -- 0:00:16
      717500 -- (-358.222) (-357.291) (-359.602) [-356.226] * (-355.290) (-363.163) (-359.033) [-355.280] -- 0:00:16
      718000 -- (-357.289) [-355.621] (-357.028) (-355.504) * (-356.783) [-364.130] (-356.621) (-358.873) -- 0:00:16
      718500 -- (-361.717) (-355.325) [-361.048] (-359.146) * [-359.697] (-357.691) (-356.797) (-358.551) -- 0:00:16
      719000 -- [-357.164] (-356.183) (-359.768) (-357.495) * (-359.086) (-361.260) [-360.032] (-359.126) -- 0:00:16
      719500 -- (-357.198) (-363.724) (-357.478) [-359.028] * (-360.882) (-358.078) (-357.379) [-358.216] -- 0:00:16
      720000 -- (-356.253) [-363.020] (-362.824) (-356.964) * [-356.744] (-358.062) (-358.998) (-355.187) -- 0:00:16

      Average standard deviation of split frequencies: 0.008872

      720500 -- (-358.539) (-358.705) (-360.871) [-357.758] * (-359.824) [-357.242] (-357.127) (-356.626) -- 0:00:16
      721000 -- (-365.234) (-358.791) [-359.351] (-356.549) * (-358.787) (-355.428) (-355.817) [-358.588] -- 0:00:16
      721500 -- [-357.811] (-355.487) (-355.733) (-355.942) * (-357.941) [-356.246] (-355.268) (-356.306) -- 0:00:16
      722000 -- (-357.899) [-357.575] (-356.877) (-361.310) * [-358.092] (-355.385) (-358.156) (-357.744) -- 0:00:16
      722500 -- (-356.028) (-356.193) (-359.974) [-357.611] * (-356.861) [-356.956] (-362.532) (-358.698) -- 0:00:16
      723000 -- [-357.833] (-355.270) (-356.766) (-360.035) * (-355.462) (-359.112) (-359.145) [-359.334] -- 0:00:16
      723500 -- (-358.212) [-355.378] (-358.341) (-358.589) * (-358.720) (-356.183) [-359.506] (-355.472) -- 0:00:16
      724000 -- (-358.506) (-357.488) [-359.575] (-356.172) * (-355.234) (-356.802) [-357.784] (-355.798) -- 0:00:16
      724500 -- (-356.175) (-360.197) [-358.267] (-355.485) * (-358.108) (-356.096) (-359.382) [-355.873] -- 0:00:16
      725000 -- (-356.029) (-363.648) [-359.807] (-364.677) * (-364.680) [-355.879] (-358.398) (-356.893) -- 0:00:16

      Average standard deviation of split frequencies: 0.008238

      725500 -- (-358.148) [-363.089] (-355.172) (-358.555) * [-356.417] (-355.875) (-358.226) (-357.030) -- 0:00:16
      726000 -- [-355.043] (-361.796) (-357.701) (-363.911) * (-355.171) [-358.047] (-355.175) (-357.630) -- 0:00:16
      726500 -- (-359.586) (-356.928) [-356.783] (-366.644) * (-354.955) [-355.390] (-362.733) (-358.307) -- 0:00:16
      727000 -- [-355.784] (-362.048) (-356.673) (-357.506) * [-355.161] (-355.531) (-359.351) (-359.953) -- 0:00:16
      727500 -- (-356.385) [-358.000] (-356.935) (-357.523) * (-356.565) (-358.522) (-358.969) [-358.861] -- 0:00:16
      728000 -- (-355.984) (-357.448) (-356.304) [-356.458] * (-357.113) [-356.456] (-358.523) (-358.176) -- 0:00:16
      728500 -- (-357.929) [-356.390] (-355.344) (-356.609) * (-355.683) [-358.615] (-359.201) (-358.092) -- 0:00:16
      729000 -- (-357.609) (-358.704) (-355.404) [-355.989] * (-357.884) [-358.681] (-356.736) (-355.346) -- 0:00:16
      729500 -- [-356.394] (-359.669) (-355.516) (-359.839) * [-357.324] (-357.902) (-356.296) (-357.178) -- 0:00:16
      730000 -- (-361.009) (-360.410) (-356.457) [-359.285] * [-356.563] (-357.723) (-357.902) (-355.935) -- 0:00:16

      Average standard deviation of split frequencies: 0.007984

      730500 -- (-357.756) (-357.262) (-358.392) [-357.120] * (-356.255) (-357.439) (-357.181) [-355.461] -- 0:00:16
      731000 -- [-357.554] (-355.252) (-356.473) (-355.507) * (-361.146) (-355.733) [-355.912] (-358.682) -- 0:00:16
      731500 -- (-358.562) [-359.012] (-360.455) (-355.351) * (-358.404) [-355.926] (-356.521) (-356.478) -- 0:00:16
      732000 -- [-359.708] (-355.865) (-358.229) (-356.731) * (-356.844) (-355.880) [-356.513] (-356.475) -- 0:00:16
      732500 -- (-358.346) (-358.480) (-361.785) [-355.662] * (-357.029) (-357.071) (-356.878) [-357.086] -- 0:00:16
      733000 -- (-358.470) (-358.647) (-355.629) [-355.437] * (-357.752) (-356.663) [-358.335] (-361.660) -- 0:00:16
      733500 -- (-357.062) (-359.188) [-357.062] (-355.764) * [-358.247] (-356.435) (-363.018) (-356.422) -- 0:00:15
      734000 -- (-355.436) [-356.143] (-355.859) (-355.676) * (-359.531) [-357.395] (-359.106) (-361.438) -- 0:00:15
      734500 -- [-356.526] (-357.709) (-356.030) (-355.585) * (-358.313) (-362.262) [-357.668] (-356.345) -- 0:00:15
      735000 -- (-362.130) (-356.520) [-356.320] (-356.466) * (-356.672) (-357.664) [-357.990] (-356.288) -- 0:00:15

      Average standard deviation of split frequencies: 0.008366

      735500 -- (-357.123) (-357.728) (-355.899) [-358.108] * (-363.587) (-361.482) (-358.429) [-357.834] -- 0:00:15
      736000 -- (-356.806) (-355.123) [-355.590] (-358.664) * [-356.012] (-359.036) (-356.617) (-357.817) -- 0:00:15
      736500 -- (-356.282) [-355.075] (-360.930) (-357.068) * (-356.867) (-359.412) (-356.117) [-355.220] -- 0:00:15
      737000 -- (-356.475) (-356.518) [-360.809] (-356.438) * (-356.467) (-355.347) (-355.701) [-361.046] -- 0:00:15
      737500 -- (-357.534) [-357.727] (-361.320) (-355.759) * (-358.059) (-357.278) (-357.067) [-359.068] -- 0:00:15
      738000 -- [-358.998] (-357.990) (-359.103) (-355.890) * (-358.258) [-355.352] (-357.163) (-356.352) -- 0:00:15
      738500 -- (-358.125) (-357.692) [-360.265] (-357.462) * (-359.620) [-355.215] (-356.629) (-355.437) -- 0:00:15
      739000 -- (-355.652) (-360.438) (-355.958) [-356.008] * (-355.988) [-356.707] (-359.117) (-357.766) -- 0:00:15
      739500 -- (-359.982) (-357.400) (-366.351) [-357.651] * [-356.164] (-358.285) (-358.062) (-359.872) -- 0:00:15
      740000 -- [-356.124] (-357.568) (-357.831) (-363.623) * (-357.615) [-359.144] (-356.030) (-360.078) -- 0:00:15

      Average standard deviation of split frequencies: 0.008791

      740500 -- (-355.491) (-362.246) [-359.405] (-357.685) * (-356.382) (-356.539) [-356.740] (-362.520) -- 0:00:15
      741000 -- (-355.553) [-356.900] (-359.074) (-355.382) * (-356.185) (-363.636) (-356.636) [-360.178] -- 0:00:15
      741500 -- (-357.226) (-357.455) [-358.136] (-358.999) * (-357.425) (-356.473) [-356.368] (-355.907) -- 0:00:15
      742000 -- [-357.261] (-358.740) (-360.579) (-357.478) * (-362.387) (-358.561) (-360.966) [-356.976] -- 0:00:15
      742500 -- (-356.598) (-356.454) (-360.658) [-355.825] * (-357.025) [-356.094] (-356.428) (-358.815) -- 0:00:15
      743000 -- (-358.329) (-357.918) [-357.649] (-357.180) * (-356.226) (-357.725) (-356.549) [-356.565] -- 0:00:15
      743500 -- [-360.285] (-355.669) (-357.715) (-356.936) * (-354.965) [-358.711] (-358.912) (-355.671) -- 0:00:15
      744000 -- (-356.862) [-357.039] (-359.113) (-357.619) * (-355.238) (-357.539) [-356.709] (-357.991) -- 0:00:15
      744500 -- (-359.483) (-355.790) [-357.346] (-359.925) * (-355.238) [-358.374] (-358.953) (-358.559) -- 0:00:15
      745000 -- (-360.196) (-355.509) [-355.537] (-360.893) * (-360.887) (-360.164) (-355.390) [-358.409] -- 0:00:15

      Average standard deviation of split frequencies: 0.008926

      745500 -- [-355.325] (-356.116) (-357.765) (-359.976) * (-357.039) [-357.590] (-356.214) (-359.319) -- 0:00:15
      746000 -- (-357.173) [-356.129] (-358.586) (-356.515) * (-363.700) (-363.892) [-356.245] (-355.391) -- 0:00:15
      746500 -- (-358.554) (-355.757) [-355.034] (-359.969) * (-358.493) (-357.773) [-356.230] (-357.329) -- 0:00:15
      747000 -- (-357.125) (-360.736) (-356.925) [-355.582] * (-359.322) (-358.629) (-358.516) [-359.037] -- 0:00:15
      747500 -- (-357.648) [-357.430] (-357.643) (-359.000) * (-359.787) (-358.811) [-356.638] (-355.736) -- 0:00:15
      748000 -- (-358.415) (-356.605) (-355.333) [-360.631] * (-358.020) (-359.179) [-357.931] (-357.160) -- 0:00:15
      748500 -- [-359.032] (-358.047) (-359.205) (-363.059) * (-358.723) [-358.028] (-366.356) (-359.266) -- 0:00:15
      749000 -- (-360.209) (-358.517) [-357.304] (-362.580) * (-359.628) (-357.652) [-359.021] (-356.856) -- 0:00:15
      749500 -- [-355.184] (-357.424) (-360.044) (-361.743) * (-363.552) [-356.802] (-360.346) (-357.261) -- 0:00:15
      750000 -- (-355.331) (-356.084) (-356.781) [-356.542] * (-357.438) (-360.289) [-358.516] (-356.541) -- 0:00:15

      Average standard deviation of split frequencies: 0.008282

      750500 -- (-355.597) (-357.305) [-356.077] (-356.000) * [-357.623] (-357.307) (-356.449) (-361.134) -- 0:00:14
      751000 -- (-355.306) (-356.238) [-357.808] (-358.760) * (-359.741) (-360.781) [-356.443] (-362.887) -- 0:00:14
      751500 -- (-356.877) (-355.348) (-356.992) [-358.223] * [-356.482] (-357.478) (-356.441) (-357.314) -- 0:00:14
      752000 -- (-357.158) (-356.369) [-358.190] (-357.772) * [-358.848] (-356.840) (-356.357) (-356.140) -- 0:00:14
      752500 -- [-355.380] (-358.122) (-360.392) (-357.633) * (-362.464) (-356.464) [-358.841] (-360.133) -- 0:00:14
      753000 -- [-355.616] (-355.958) (-362.580) (-357.187) * (-361.275) (-358.570) (-360.831) [-355.119] -- 0:00:14
      753500 -- [-355.522] (-359.792) (-358.012) (-361.655) * [-362.153] (-356.077) (-356.892) (-357.068) -- 0:00:14
      754000 -- (-362.257) (-355.317) [-357.644] (-360.319) * (-357.533) (-359.002) [-356.445] (-359.044) -- 0:00:14
      754500 -- (-358.819) [-355.730] (-356.649) (-361.086) * (-356.494) [-357.281] (-357.659) (-356.397) -- 0:00:14
      755000 -- (-361.716) [-357.549] (-358.207) (-357.412) * [-355.399] (-357.585) (-357.249) (-358.805) -- 0:00:14

      Average standard deviation of split frequencies: 0.008379

      755500 -- (-358.686) (-359.300) (-359.559) [-359.168] * (-355.994) [-355.826] (-355.414) (-357.336) -- 0:00:14
      756000 -- (-357.416) [-359.546] (-356.616) (-357.528) * (-355.942) (-355.828) [-358.501] (-359.283) -- 0:00:14
      756500 -- (-357.013) (-359.101) (-357.018) [-356.669] * (-355.725) [-355.101] (-360.344) (-363.318) -- 0:00:14
      757000 -- (-356.541) (-358.317) (-359.313) [-356.467] * (-364.000) (-355.855) [-356.700] (-360.505) -- 0:00:14
      757500 -- (-357.226) (-357.131) [-358.774] (-357.129) * (-357.604) (-355.237) [-356.898] (-361.698) -- 0:00:14
      758000 -- (-363.896) (-361.346) [-357.732] (-355.813) * (-360.469) (-356.805) (-357.656) [-357.603] -- 0:00:14
      758500 -- (-357.979) (-356.150) [-357.621] (-356.400) * (-357.839) [-355.393] (-355.692) (-359.632) -- 0:00:14
      759000 -- (-357.901) (-356.874) [-357.372] (-356.958) * (-357.325) (-356.979) [-355.577] (-357.599) -- 0:00:14
      759500 -- (-357.079) [-358.595] (-356.252) (-360.594) * (-360.148) (-356.731) [-358.642] (-357.015) -- 0:00:14
      760000 -- (-359.093) (-357.012) [-355.689] (-355.557) * [-356.877] (-358.052) (-357.018) (-357.566) -- 0:00:14

      Average standard deviation of split frequencies: 0.008444

      760500 -- [-358.283] (-355.477) (-356.060) (-358.310) * (-355.583) (-357.763) [-358.771] (-358.927) -- 0:00:14
      761000 -- [-356.319] (-355.152) (-356.044) (-356.753) * (-362.559) (-356.757) (-358.019) [-356.723] -- 0:00:14
      761500 -- (-356.248) (-355.593) (-356.244) [-361.168] * (-357.504) (-355.480) (-358.619) [-359.679] -- 0:00:14
      762000 -- (-360.417) (-360.069) (-355.941) [-356.908] * (-356.940) [-355.299] (-361.834) (-358.885) -- 0:00:14
      762500 -- (-361.497) [-357.394] (-356.764) (-356.356) * (-357.591) [-356.391] (-357.204) (-357.137) -- 0:00:14
      763000 -- (-358.178) [-359.013] (-356.699) (-364.327) * (-357.793) (-358.936) (-358.782) [-359.559] -- 0:00:14
      763500 -- [-356.977] (-357.733) (-360.640) (-358.472) * [-355.400] (-360.739) (-355.649) (-357.484) -- 0:00:14
      764000 -- (-355.016) (-357.974) (-361.576) [-356.886] * (-356.393) (-357.731) (-358.103) [-359.622] -- 0:00:14
      764500 -- (-360.131) (-358.584) (-357.979) [-359.531] * [-356.021] (-357.189) (-362.608) (-358.883) -- 0:00:14
      765000 -- (-358.050) [-358.641] (-355.347) (-356.956) * (-362.992) [-355.667] (-355.797) (-359.144) -- 0:00:14

      Average standard deviation of split frequencies: 0.008308

      765500 -- (-360.470) (-362.387) [-355.539] (-357.418) * (-359.046) (-355.801) (-355.398) [-355.371] -- 0:00:14
      766000 -- (-358.248) [-358.054] (-356.618) (-357.073) * (-358.956) (-355.488) [-356.801] (-355.259) -- 0:00:14
      766500 -- [-356.908] (-357.337) (-358.258) (-357.644) * (-355.890) [-362.528] (-367.889) (-356.895) -- 0:00:14
      767000 -- [-357.843] (-360.871) (-358.486) (-358.863) * (-356.457) (-357.063) [-364.162] (-355.951) -- 0:00:13
      767500 -- (-358.518) [-355.369] (-357.139) (-357.065) * (-358.277) (-356.518) [-359.560] (-357.572) -- 0:00:13
      768000 -- (-358.525) (-357.275) (-358.418) [-356.929] * (-356.686) (-359.773) (-359.531) [-356.479] -- 0:00:13
      768500 -- (-360.794) [-356.393] (-358.345) (-357.384) * [-357.893] (-360.418) (-359.037) (-357.819) -- 0:00:13
      769000 -- (-356.341) [-355.846] (-357.492) (-357.490) * [-356.821] (-358.698) (-360.580) (-358.326) -- 0:00:13
      769500 -- (-356.702) (-356.966) [-356.442] (-357.478) * (-357.591) [-355.800] (-357.412) (-359.412) -- 0:00:13
      770000 -- (-356.628) (-356.845) [-356.734] (-357.132) * (-356.321) [-356.821] (-360.973) (-360.527) -- 0:00:13

      Average standard deviation of split frequencies: 0.008716

      770500 -- (-358.764) (-361.770) [-357.807] (-357.482) * (-355.733) [-355.561] (-356.631) (-358.445) -- 0:00:13
      771000 -- (-356.133) (-357.646) [-356.852] (-358.055) * [-355.945] (-355.549) (-360.975) (-357.161) -- 0:00:13
      771500 -- (-355.082) (-360.236) (-359.215) [-355.359] * (-357.627) (-357.219) [-356.835] (-359.648) -- 0:00:13
      772000 -- (-355.307) (-356.904) (-360.124) [-356.693] * (-356.784) (-357.203) (-357.144) [-355.713] -- 0:00:13
      772500 -- (-359.093) (-360.212) [-356.397] (-357.121) * (-356.711) [-357.139] (-357.721) (-356.089) -- 0:00:13
      773000 -- (-358.332) (-357.690) [-358.033] (-357.315) * (-356.725) (-358.230) [-356.172] (-359.254) -- 0:00:13
      773500 -- (-357.796) [-355.657] (-359.508) (-358.054) * [-358.903] (-358.776) (-356.736) (-355.724) -- 0:00:13
      774000 -- (-359.235) (-358.157) (-358.799) [-356.473] * [-355.798] (-357.364) (-358.477) (-357.619) -- 0:00:13
      774500 -- [-357.320] (-356.168) (-355.251) (-358.009) * (-355.947) (-357.320) (-357.284) [-356.233] -- 0:00:13
      775000 -- (-358.361) (-361.931) (-355.468) [-357.038] * (-359.646) [-359.624] (-361.503) (-357.246) -- 0:00:13

      Average standard deviation of split frequencies: 0.008581

      775500 -- (-357.510) [-356.282] (-355.730) (-355.808) * [-356.297] (-358.325) (-360.042) (-356.050) -- 0:00:13
      776000 -- (-356.278) (-358.895) (-358.293) [-357.772] * [-357.079] (-355.604) (-358.547) (-356.586) -- 0:00:13
      776500 -- [-362.975] (-357.746) (-361.116) (-358.481) * (-358.121) [-355.373] (-356.832) (-356.390) -- 0:00:13
      777000 -- (-356.822) (-355.952) (-357.636) [-362.050] * (-356.499) (-355.936) [-357.138] (-358.130) -- 0:00:13
      777500 -- (-355.262) (-357.629) (-359.768) [-357.643] * [-356.047] (-359.025) (-363.330) (-356.846) -- 0:00:13
      778000 -- [-357.513] (-361.993) (-358.705) (-356.148) * (-356.112) (-359.805) [-365.393] (-358.881) -- 0:00:13
      778500 -- (-361.403) (-356.921) [-359.254] (-356.208) * (-357.455) (-358.560) (-356.201) [-358.153] -- 0:00:13
      779000 -- (-357.655) (-360.983) [-356.962] (-358.850) * (-358.332) (-357.098) [-357.870] (-357.513) -- 0:00:13
      779500 -- (-355.787) (-357.113) (-355.992) [-358.129] * (-355.384) (-355.948) [-358.820] (-357.060) -- 0:00:13
      780000 -- [-355.357] (-356.946) (-356.037) (-358.036) * (-358.003) (-356.769) [-358.415] (-357.546) -- 0:00:13

      Average standard deviation of split frequencies: 0.008831

      780500 -- (-355.894) (-358.415) (-357.294) [-357.933] * (-358.948) [-357.532] (-356.372) (-357.706) -- 0:00:13
      781000 -- (-355.865) (-357.376) [-357.229] (-360.155) * (-360.608) (-358.108) [-355.625] (-359.342) -- 0:00:13
      781500 -- (-357.915) (-361.183) [-356.063] (-356.224) * (-357.125) (-358.441) (-355.900) [-358.295] -- 0:00:13
      782000 -- (-356.432) [-360.869] (-358.775) (-356.005) * [-358.174] (-355.328) (-358.198) (-356.984) -- 0:00:13
      782500 -- [-357.802] (-360.185) (-360.228) (-357.527) * (-355.738) (-358.542) [-359.075] (-357.358) -- 0:00:13
      783000 -- (-361.528) (-357.367) (-358.087) [-356.187] * (-356.103) (-356.507) [-359.000] (-357.593) -- 0:00:13
      783500 -- (-356.217) (-355.461) [-358.774] (-357.780) * (-356.110) (-356.743) [-357.441] (-356.219) -- 0:00:12
      784000 -- (-359.244) [-355.213] (-355.917) (-360.798) * (-357.752) (-358.479) (-357.469) [-358.991] -- 0:00:12
      784500 -- (-359.563) (-356.595) (-360.752) [-361.424] * (-358.272) [-356.172] (-358.762) (-357.481) -- 0:00:12
      785000 -- [-356.561] (-358.705) (-359.425) (-358.538) * (-360.510) (-359.773) [-357.433] (-357.721) -- 0:00:12

      Average standard deviation of split frequencies: 0.008921

      785500 -- [-356.572] (-357.256) (-358.722) (-356.428) * (-358.149) (-356.247) (-361.698) [-358.810] -- 0:00:12
      786000 -- (-355.971) [-355.697] (-358.303) (-356.980) * (-356.569) [-357.581] (-357.547) (-361.469) -- 0:00:12
      786500 -- (-357.056) (-356.386) [-358.360] (-360.216) * [-361.770] (-357.517) (-357.211) (-358.809) -- 0:00:12
      787000 -- [-357.671] (-358.952) (-357.254) (-356.708) * [-357.141] (-355.479) (-356.033) (-357.961) -- 0:00:12
      787500 -- (-355.927) (-359.467) (-357.06