--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:05:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1607/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -390.62          -394.63
2       -390.60          -395.00
--------------------------------------
TOTAL     -390.61          -394.83
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898012    0.090087    0.366441    1.483847    0.870130   1277.07   1362.65    1.000
r(A<->C){all}   0.163706    0.020485    0.000011    0.461322    0.123866    128.64    191.47    1.003
r(A<->G){all}   0.174655    0.021276    0.000064    0.474495    0.134779    202.12    224.97    1.000
r(A<->T){all}   0.169908    0.021360    0.000077    0.459273    0.131684    222.98    230.92    1.002
r(C<->G){all}   0.164915    0.018676    0.000015    0.442295    0.127004    196.10    199.90    1.006
r(C<->T){all}   0.164712    0.020209    0.000007    0.448557    0.126708    185.66    198.41    1.010
r(G<->T){all}   0.162105    0.018823    0.000007    0.431085    0.124892    188.06    276.22    1.001
pi(A){all}      0.188399    0.000540    0.146031    0.236961    0.187837   1164.96   1278.56    1.000
pi(C){all}      0.226211    0.000585    0.178264    0.271718    0.225784   1283.23   1324.82    1.000
pi(G){all}      0.366239    0.000796    0.313485    0.421524    0.366110   1082.11   1240.89    1.000
pi(T){all}      0.219152    0.000594    0.172697    0.266847    0.219326   1080.27   1178.14    1.001
alpha{1,2}      0.411381    0.221647    0.000129    1.345447    0.245221   1301.82   1332.70    1.000
alpha{3}        0.461645    0.225800    0.000166    1.476337    0.307520    983.51   1054.78    1.000
pinvar{all}     0.994342    0.000045    0.981647    0.999995    0.996460    959.24   1057.26    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-377.466061
Model 2: PositiveSelection	-377.466197
Model 0: one-ratio	-377.466229
Model 7: beta	-377.466061
Model 8: beta&w>1	-377.466061


Model 0 vs 1	3.359999999474894E-4

Model 2 vs 1	2.7199999999538704E-4

Model 8 vs 7	0.0
>C1
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C2
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C3
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C4
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C5
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C6
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 

C1              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C2              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C3              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C4              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C5              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C6              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
                **************************************************

C1              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C2              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C3              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C4              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C5              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C6              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2880]--->[2880]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C2              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C3              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C4              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C5              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C6              MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
                **************************************************

C1              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C2              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C3              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C4              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C5              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C6              AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C2              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C3              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C4              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C5              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C6              ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
                **************************************************

C1              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C2              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C3              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C4              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C5              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C6              GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
                **************************************************

C1              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C2              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C3              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C4              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C5              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C6              GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
                **************************************************

C1              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C2              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C3              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C4              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C5              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C6              GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
                **************************************************

C1              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C2              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C3              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C4              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C5              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C6              GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
                **************************************************

C1              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C2              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C3              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C4              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C5              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C6              GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
                **************************************



>C1
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C2
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C3
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C4
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C5
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C6
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C1
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C2
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C3
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C4
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C5
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C6
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 288 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856628
      Setting output file names to "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 276675435
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5448277417
      Seed = 1945043070
      Swapseed = 1579856628
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -644.557766 -- -24.965149
         Chain 2 -- -644.557804 -- -24.965149
         Chain 3 -- -644.557706 -- -24.965149
         Chain 4 -- -644.557706 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -644.557804 -- -24.965149
         Chain 2 -- -644.557766 -- -24.965149
         Chain 3 -- -644.557804 -- -24.965149
         Chain 4 -- -644.557804 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558) 
        500 -- (-403.384) [-395.874] (-404.161) (-412.857) * [-395.007] (-411.332) (-406.449) (-400.486) -- 0:33:19
       1000 -- (-404.848) (-400.072) [-399.984] (-406.318) * (-403.736) [-401.128] (-407.497) (-404.779) -- 0:16:39
       1500 -- [-396.591] (-407.590) (-401.124) (-401.982) * (-395.750) [-403.902] (-398.997) (-404.317) -- 0:11:05
       2000 -- [-402.775] (-403.947) (-397.022) (-398.672) * (-398.383) (-395.186) (-402.179) [-394.756] -- 0:08:19
       2500 -- (-399.446) (-398.333) (-398.067) [-394.663] * (-395.697) (-400.892) [-400.886] (-394.906) -- 0:06:39
       3000 -- (-398.765) (-397.545) [-400.943] (-416.756) * (-403.968) [-400.297] (-400.828) (-399.074) -- 0:05:32
       3500 -- (-399.234) (-398.037) [-395.431] (-399.661) * (-401.980) (-397.626) [-400.630] (-403.152) -- 0:04:44
       4000 -- (-397.699) (-399.503) [-398.798] (-400.823) * (-400.706) (-405.461) [-399.286] (-407.341) -- 0:04:09
       4500 -- (-412.937) (-395.139) (-401.098) [-404.608] * (-395.791) (-404.884) [-396.759] (-402.342) -- 0:03:41
       5000 -- (-404.522) [-397.781] (-401.040) (-403.899) * [-394.175] (-401.032) (-400.692) (-406.821) -- 0:03:19

      Average standard deviation of split frequencies: 0.142850

       5500 -- (-394.421) (-402.614) (-400.540) [-397.131] * (-404.469) (-406.291) [-400.956] (-400.860) -- 0:03:00
       6000 -- (-391.512) (-399.641) (-398.381) [-396.790] * [-400.177] (-402.091) (-407.833) (-400.127) -- 0:02:45
       6500 -- [-390.856] (-400.761) (-398.393) (-396.768) * (-405.356) [-396.262] (-398.771) (-402.162) -- 0:02:32
       7000 -- [-391.113] (-413.786) (-398.709) (-402.730) * (-403.972) (-396.484) [-398.277] (-404.831) -- 0:02:21
       7500 -- (-392.868) (-395.122) (-396.619) [-400.006] * (-407.784) [-398.410] (-402.159) (-403.768) -- 0:02:12
       8000 -- (-390.241) (-398.917) (-398.514) [-400.748] * (-406.790) [-404.856] (-398.882) (-404.646) -- 0:02:04
       8500 -- (-392.279) [-397.624] (-400.337) (-399.583) * (-417.983) [-396.282] (-410.218) (-400.985) -- 0:01:56
       9000 -- (-391.984) (-404.367) (-405.554) [-403.813] * (-401.653) (-398.905) [-403.185] (-389.642) -- 0:01:50
       9500 -- (-392.198) (-398.676) (-417.884) [-398.126] * (-392.836) [-398.403] (-400.292) (-389.185) -- 0:01:44
      10000 -- [-393.880] (-399.141) (-402.277) (-401.753) * (-390.631) [-399.422] (-397.906) (-393.419) -- 0:01:39

      Average standard deviation of split frequencies: 0.081759

      10500 -- (-391.003) [-398.714] (-398.290) (-402.153) * [-389.439] (-406.535) (-400.197) (-392.323) -- 0:01:34
      11000 -- (-392.758) (-406.154) (-395.170) [-403.618] * (-394.147) [-397.435] (-411.073) (-392.445) -- 0:01:29
      11500 -- (-400.978) [-399.407] (-410.088) (-401.692) * (-392.742) [-395.880] (-402.305) (-391.790) -- 0:01:25
      12000 -- (-394.747) [-396.777] (-398.766) (-396.529) * (-392.559) (-395.956) (-409.653) [-394.214] -- 0:01:22
      12500 -- [-392.715] (-395.287) (-397.099) (-409.340) * [-391.224] (-403.457) (-416.431) (-391.318) -- 0:01:19
      13000 -- [-391.813] (-398.649) (-401.966) (-395.644) * (-393.389) [-397.099] (-406.900) (-390.900) -- 0:01:15
      13500 -- [-393.216] (-399.907) (-403.523) (-407.877) * [-390.908] (-399.074) (-406.672) (-391.400) -- 0:01:13
      14000 -- (-394.821) (-403.814) [-398.536] (-402.078) * (-390.861) (-399.126) (-410.221) [-390.198] -- 0:01:10
      14500 -- (-391.606) (-399.792) [-400.763] (-398.453) * (-390.211) (-401.509) (-408.297) [-391.471] -- 0:01:07
      15000 -- (-390.092) [-402.077] (-402.162) (-400.682) * (-390.250) [-400.801] (-403.929) (-391.170) -- 0:01:05

      Average standard deviation of split frequencies: 0.065128

      15500 -- (-392.155) (-395.107) (-401.256) [-402.684] * (-391.083) (-398.663) [-395.432] (-391.461) -- 0:01:03
      16000 -- (-393.304) (-410.736) [-404.824] (-405.695) * (-390.669) (-398.632) [-391.683] (-391.440) -- 0:01:01
      16500 -- (-392.988) (-399.068) (-406.703) [-400.794] * (-389.995) (-398.542) (-391.865) [-390.858] -- 0:01:59
      17000 -- (-391.492) (-396.681) (-406.886) [-398.607] * [-391.694] (-403.481) (-398.407) (-390.537) -- 0:01:55
      17500 -- (-389.846) (-389.590) [-398.292] (-403.845) * (-394.542) (-406.728) (-398.850) [-392.320] -- 0:01:52
      18000 -- (-390.371) (-390.778) [-396.365] (-416.791) * (-396.908) (-396.389) (-393.690) [-391.899] -- 0:01:49
      18500 -- [-391.567] (-393.879) (-406.400) (-411.003) * (-393.129) (-400.290) (-391.955) [-391.357] -- 0:01:46
      19000 -- [-394.577] (-392.748) (-401.788) (-402.740) * (-389.690) [-396.634] (-394.639) (-389.489) -- 0:01:43
      19500 -- (-389.628) (-396.700) (-399.553) [-392.925] * [-391.562] (-397.639) (-393.794) (-391.515) -- 0:01:40
      20000 -- (-397.946) (-392.318) [-396.342] (-389.358) * (-393.346) (-393.530) (-393.883) [-393.428] -- 0:01:38

      Average standard deviation of split frequencies: 0.058450

      20500 -- (-393.715) (-392.565) (-404.186) [-389.137] * (-389.915) (-405.310) (-397.679) [-392.766] -- 0:01:35
      21000 -- (-391.633) (-390.603) [-402.878] (-393.008) * (-389.467) (-395.851) (-395.766) [-392.763] -- 0:01:33
      21500 -- (-390.597) (-390.259) (-405.732) [-391.896] * (-393.972) [-400.173] (-392.439) (-392.740) -- 0:01:31
      22000 -- (-397.692) (-389.419) [-395.138] (-390.345) * (-390.586) [-398.048] (-391.743) (-397.230) -- 0:01:28
      22500 -- (-390.509) (-392.100) [-395.428] (-394.385) * (-390.530) [-404.859] (-394.351) (-392.564) -- 0:01:26
      23000 -- (-392.131) (-395.506) (-407.005) [-395.833] * (-393.192) [-406.950] (-391.662) (-390.192) -- 0:01:24
      23500 -- (-394.296) (-392.202) [-397.426] (-392.388) * (-391.391) (-399.877) (-390.763) [-392.540] -- 0:01:23
      24000 -- [-391.925] (-390.818) (-400.818) (-389.891) * (-396.876) [-402.041] (-392.262) (-392.059) -- 0:01:21
      24500 -- (-390.321) (-389.961) [-405.524] (-393.680) * (-394.506) [-402.325] (-391.544) (-389.657) -- 0:01:19
      25000 -- [-390.092] (-389.939) (-402.348) (-390.596) * (-394.542) (-408.260) (-391.123) [-393.575] -- 0:01:18

      Average standard deviation of split frequencies: 0.045759

      25500 -- (-392.221) (-390.676) [-397.163] (-390.569) * [-392.125] (-395.212) (-390.685) (-392.364) -- 0:01:16
      26000 -- [-391.110] (-389.232) (-407.521) (-389.496) * (-389.692) [-400.789] (-390.589) (-392.140) -- 0:01:14
      26500 -- (-393.011) (-391.603) (-414.724) [-392.726] * (-389.812) (-400.194) [-392.995] (-390.682) -- 0:01:13
      27000 -- (-393.525) [-392.926] (-414.994) (-389.182) * [-389.421] (-397.684) (-391.560) (-391.159) -- 0:01:12
      27500 -- [-389.783] (-393.365) (-410.289) (-389.888) * (-391.203) [-404.193] (-392.889) (-391.649) -- 0:01:10
      28000 -- (-392.486) (-389.167) (-401.860) [-390.151] * (-390.440) [-398.988] (-389.866) (-389.653) -- 0:01:09
      28500 -- (-393.202) (-397.012) (-392.362) [-391.533] * [-392.313] (-398.545) (-391.418) (-395.154) -- 0:01:08
      29000 -- (-392.109) [-391.326] (-397.623) (-391.648) * [-390.890] (-399.643) (-392.414) (-390.809) -- 0:01:06
      29500 -- [-390.373] (-394.414) (-391.144) (-393.248) * (-392.841) [-397.247] (-392.881) (-390.438) -- 0:01:05
      30000 -- (-390.915) (-391.712) (-389.811) [-389.903] * (-392.206) [-398.049] (-391.719) (-391.231) -- 0:01:04

      Average standard deviation of split frequencies: 0.034160

      30500 -- (-390.449) [-390.967] (-391.369) (-389.340) * (-392.220) (-409.279) (-390.479) [-393.529] -- 0:01:03
      31000 -- (-390.805) [-389.781] (-389.685) (-389.471) * (-394.860) (-408.401) [-390.942] (-392.766) -- 0:01:02
      31500 -- (-392.163) (-390.719) (-392.271) [-395.777] * (-391.690) [-399.424] (-390.790) (-393.320) -- 0:01:01
      32000 -- [-392.215] (-393.290) (-390.489) (-390.534) * (-390.205) (-398.574) (-390.851) [-390.011] -- 0:01:00
      32500 -- (-389.184) (-397.321) [-390.668] (-391.874) * (-391.093) (-401.305) (-390.808) [-390.452] -- 0:00:59
      33000 -- [-394.203] (-390.917) (-391.505) (-393.091) * [-390.507] (-402.983) (-390.894) (-391.588) -- 0:01:27
      33500 -- (-391.815) [-391.431] (-389.822) (-391.212) * (-392.249) (-404.979) [-390.614] (-394.071) -- 0:01:26
      34000 -- (-389.659) (-392.804) (-389.962) [-394.729] * (-390.457) (-405.453) [-390.271] (-391.288) -- 0:01:25
      34500 -- (-391.370) (-391.323) [-393.447] (-389.861) * (-390.128) (-411.574) (-392.132) [-390.424] -- 0:01:23
      35000 -- (-391.489) (-390.583) [-391.548] (-393.400) * [-391.065] (-401.670) (-389.854) (-391.960) -- 0:01:22

      Average standard deviation of split frequencies: 0.024552

      35500 -- (-391.970) [-392.821] (-391.430) (-392.271) * (-395.791) [-404.748] (-392.480) (-395.400) -- 0:01:21
      36000 -- [-393.064] (-389.705) (-389.931) (-389.433) * (-392.043) (-403.210) (-392.616) [-389.068] -- 0:01:20
      36500 -- [-390.673] (-393.186) (-392.012) (-389.968) * (-390.944) (-402.506) (-392.774) [-395.394] -- 0:01:19
      37000 -- [-393.809] (-391.534) (-391.573) (-390.032) * (-390.723) (-401.441) (-391.698) [-393.796] -- 0:01:18
      37500 -- (-392.236) (-389.241) [-391.348] (-391.409) * [-389.714] (-399.309) (-394.570) (-390.013) -- 0:01:17
      38000 -- [-394.721] (-393.043) (-390.597) (-394.261) * (-392.655) [-396.121] (-390.244) (-389.267) -- 0:01:15
      38500 -- (-389.948) (-395.047) [-391.178] (-391.640) * (-394.637) (-398.175) (-389.847) [-392.815] -- 0:01:14
      39000 -- (-389.491) (-391.769) (-392.089) [-391.394] * (-397.685) (-399.018) (-391.093) [-390.302] -- 0:01:13
      39500 -- (-390.065) (-390.093) [-393.390] (-393.074) * (-394.684) [-412.094] (-391.032) (-391.078) -- 0:01:12
      40000 -- (-389.524) [-389.443] (-390.470) (-392.958) * (-390.231) (-402.663) (-391.264) [-391.062] -- 0:01:12

      Average standard deviation of split frequencies: 0.023866

      40500 -- (-391.168) [-389.935] (-394.558) (-394.499) * [-390.068] (-400.081) (-391.089) (-390.366) -- 0:01:11
      41000 -- (-391.063) (-392.506) (-399.367) [-389.446] * (-390.847) (-398.153) (-392.589) [-394.545] -- 0:01:10
      41500 -- [-391.044] (-390.087) (-395.372) (-390.255) * (-394.084) [-397.594] (-389.546) (-394.191) -- 0:01:09
      42000 -- [-390.554] (-390.554) (-391.909) (-391.121) * [-391.115] (-400.055) (-390.159) (-391.176) -- 0:01:08
      42500 -- (-392.481) (-389.541) [-391.876] (-390.761) * (-393.495) (-397.996) [-390.436] (-390.656) -- 0:01:07
      43000 -- (-393.914) (-395.926) [-390.518] (-393.491) * (-389.756) (-400.532) (-391.785) [-392.552] -- 0:01:06
      43500 -- [-393.792] (-392.838) (-390.188) (-392.474) * (-390.155) [-397.503] (-392.742) (-390.840) -- 0:01:05
      44000 -- (-394.780) [-393.081] (-393.409) (-390.113) * [-389.805] (-398.366) (-390.114) (-395.088) -- 0:01:05
      44500 -- (-393.384) (-393.064) [-391.355] (-392.191) * (-390.733) [-399.483] (-390.031) (-390.039) -- 0:01:04
      45000 -- [-390.131] (-391.598) (-390.286) (-390.649) * (-390.963) (-401.865) (-389.546) [-390.810] -- 0:01:03

      Average standard deviation of split frequencies: 0.025889

      45500 -- (-395.603) (-391.815) [-394.777] (-392.932) * (-390.364) (-398.995) (-390.609) [-390.910] -- 0:01:02
      46000 -- (-391.213) [-389.974] (-393.615) (-390.537) * (-394.502) (-392.414) (-393.713) [-391.908] -- 0:01:02
      46500 -- (-391.065) (-390.391) [-391.482] (-390.915) * (-391.114) (-390.201) [-391.237] (-392.044) -- 0:01:01
      47000 -- (-391.600) (-391.779) (-389.497) [-391.171] * (-391.847) (-390.931) (-393.339) [-390.077] -- 0:01:00
      47500 -- (-390.217) (-390.444) [-390.599] (-398.809) * (-391.458) (-394.705) (-390.742) [-392.238] -- 0:01:00
      48000 -- (-390.857) (-390.909) (-392.469) [-390.900] * [-389.948] (-390.688) (-392.077) (-390.368) -- 0:00:59
      48500 -- (-391.714) (-390.296) (-389.867) [-393.965] * (-391.302) (-389.361) (-394.006) [-389.931] -- 0:01:18
      49000 -- (-393.767) (-391.208) [-390.010] (-391.532) * (-389.388) (-391.077) (-399.231) [-391.627] -- 0:01:17
      49500 -- (-395.198) (-390.194) (-391.392) [-392.357] * [-390.275] (-392.522) (-391.867) (-393.139) -- 0:01:16
      50000 -- (-393.931) (-390.422) [-391.478] (-392.411) * [-390.702] (-391.071) (-390.733) (-389.200) -- 0:01:16

      Average standard deviation of split frequencies: 0.032564

      50500 -- (-391.615) (-396.571) [-392.962] (-392.360) * (-391.014) (-390.414) [-391.971] (-391.315) -- 0:01:15
      51000 -- (-393.549) [-391.058] (-390.609) (-392.043) * [-390.767] (-391.872) (-394.411) (-392.127) -- 0:01:14
      51500 -- (-391.234) (-393.274) (-397.855) [-390.559] * (-389.984) (-393.139) (-392.777) [-391.253] -- 0:01:13
      52000 -- (-391.305) [-391.827] (-393.737) (-393.424) * (-390.424) (-391.270) [-390.296] (-389.945) -- 0:01:12
      52500 -- (-392.203) (-392.524) [-391.146] (-392.645) * (-389.510) (-393.268) (-389.507) [-390.096] -- 0:01:12
      53000 -- (-390.492) [-394.301] (-397.068) (-392.594) * [-390.171] (-391.416) (-391.365) (-393.150) -- 0:01:11
      53500 -- (-395.100) (-393.996) (-394.837) [-390.176] * (-391.622) (-390.851) [-389.661] (-390.722) -- 0:01:10
      54000 -- (-391.389) [-394.966] (-391.797) (-390.691) * (-390.958) (-390.781) (-392.533) [-390.375] -- 0:01:10
      54500 -- [-389.637] (-392.811) (-394.137) (-393.686) * (-390.994) [-390.865] (-392.501) (-394.750) -- 0:01:09
      55000 -- (-389.524) (-392.951) [-392.753] (-394.906) * [-393.445] (-391.269) (-394.075) (-390.733) -- 0:01:08

      Average standard deviation of split frequencies: 0.030398

      55500 -- (-396.132) (-391.255) [-389.741] (-391.268) * (-389.043) [-389.836] (-394.967) (-393.625) -- 0:01:08
      56000 -- [-391.893] (-390.152) (-390.128) (-393.645) * [-389.540] (-389.457) (-394.095) (-392.313) -- 0:01:07
      56500 -- [-392.097] (-391.245) (-389.132) (-390.971) * (-390.867) (-389.164) [-391.203] (-391.704) -- 0:01:06
      57000 -- (-391.820) (-390.640) (-389.950) [-390.757] * (-390.043) (-389.297) [-391.272] (-391.655) -- 0:01:06
      57500 -- (-392.761) (-390.447) [-390.497] (-391.934) * (-389.530) (-391.300) [-391.435] (-391.366) -- 0:01:05
      58000 -- (-393.346) (-394.235) (-389.242) [-390.641] * (-390.914) (-391.412) (-389.469) [-393.295] -- 0:01:04
      58500 -- (-391.823) [-389.968] (-390.797) (-395.424) * (-392.372) [-392.458] (-394.984) (-391.500) -- 0:01:04
      59000 -- (-391.730) (-390.667) [-390.098] (-395.405) * (-390.123) (-389.995) (-391.357) [-395.644] -- 0:01:03
      59500 -- (-390.556) (-390.665) (-397.711) [-390.231] * (-392.812) (-393.504) [-391.004] (-393.393) -- 0:01:03
      60000 -- (-392.069) (-391.805) (-389.759) [-390.320] * [-392.695] (-398.950) (-389.976) (-391.113) -- 0:01:02

      Average standard deviation of split frequencies: 0.030218

      60500 -- (-393.018) (-390.671) (-390.236) [-390.248] * [-392.376] (-394.821) (-396.563) (-390.144) -- 0:01:02
      61000 -- (-392.776) (-390.602) [-393.257] (-391.537) * (-392.489) [-393.746] (-394.275) (-391.068) -- 0:01:01
      61500 -- [-391.167] (-390.172) (-389.903) (-389.697) * (-392.774) (-391.573) [-389.805] (-390.821) -- 0:01:01
      62000 -- [-390.434] (-390.724) (-392.770) (-390.914) * [-390.495] (-390.251) (-392.661) (-390.496) -- 0:01:00
      62500 -- (-390.346) (-394.201) [-392.168] (-389.492) * [-389.916] (-393.505) (-394.290) (-393.895) -- 0:01:00
      63000 -- (-390.993) (-392.074) (-392.516) [-391.613] * [-389.879] (-399.063) (-392.629) (-393.715) -- 0:00:59
      63500 -- (-390.345) (-389.664) (-391.812) [-390.975] * (-390.813) [-391.054] (-390.325) (-390.998) -- 0:01:13
      64000 -- (-393.126) (-390.902) (-392.902) [-389.734] * [-391.205] (-391.417) (-392.990) (-392.101) -- 0:01:13
      64500 -- (-391.017) (-390.628) [-392.589] (-390.590) * (-389.532) [-389.466] (-391.949) (-393.348) -- 0:01:12
      65000 -- [-390.684] (-392.076) (-393.917) (-390.968) * (-391.137) (-391.212) [-392.213] (-391.775) -- 0:01:11

      Average standard deviation of split frequencies: 0.034209

      65500 -- [-391.856] (-391.618) (-390.018) (-390.385) * (-393.898) [-392.181] (-391.337) (-392.072) -- 0:01:11
      66000 -- [-391.431] (-390.823) (-391.117) (-390.617) * (-390.722) (-394.825) [-389.735] (-389.979) -- 0:01:10
      66500 -- (-392.737) (-392.895) (-392.182) [-390.085] * [-390.756] (-389.853) (-392.508) (-389.725) -- 0:01:10
      67000 -- (-390.189) (-390.142) (-391.675) [-391.981] * (-389.136) (-392.659) [-391.239] (-390.005) -- 0:01:09
      67500 -- [-396.992] (-391.729) (-391.271) (-390.297) * [-392.168] (-395.545) (-389.937) (-392.041) -- 0:01:09
      68000 -- (-392.426) (-389.589) [-390.465] (-391.491) * (-390.962) (-389.891) [-390.505] (-390.267) -- 0:01:08
      68500 -- (-390.295) [-389.749] (-389.735) (-392.480) * [-391.320] (-390.980) (-394.565) (-391.423) -- 0:01:07
      69000 -- (-389.912) [-391.637] (-390.042) (-392.774) * (-390.536) (-392.952) (-390.396) [-391.452] -- 0:01:07
      69500 -- [-395.076] (-391.960) (-395.651) (-394.820) * (-391.788) (-394.577) [-392.450] (-390.959) -- 0:01:06
      70000 -- (-391.699) [-389.454] (-391.003) (-393.966) * (-394.430) (-391.356) (-391.438) [-392.124] -- 0:01:06

      Average standard deviation of split frequencies: 0.031686

      70500 -- (-392.356) (-392.541) [-389.445] (-394.778) * [-390.134] (-389.368) (-389.607) (-390.056) -- 0:01:05
      71000 -- (-391.481) (-391.691) (-390.793) [-393.151] * (-390.571) (-392.235) (-389.744) [-390.748] -- 0:01:05
      71500 -- (-390.703) (-390.793) [-393.191] (-390.360) * (-392.991) (-390.999) [-389.544] (-391.658) -- 0:01:04
      72000 -- (-390.063) (-390.512) [-390.648] (-390.335) * (-390.039) (-390.557) (-394.167) [-393.252] -- 0:01:04
      72500 -- (-391.025) (-391.631) (-391.124) [-389.594] * [-392.202] (-391.649) (-392.507) (-394.052) -- 0:01:03
      73000 -- [-390.829] (-391.595) (-390.270) (-390.851) * (-390.257) (-397.117) (-392.000) [-393.020] -- 0:01:03
      73500 -- (-392.029) (-394.066) (-390.538) [-393.069] * (-391.851) (-392.733) [-391.532] (-392.021) -- 0:01:03
      74000 -- (-395.532) (-393.143) (-391.880) [-392.063] * [-390.875] (-391.961) (-389.869) (-391.046) -- 0:01:02
      74500 -- (-391.594) [-391.987] (-390.055) (-391.159) * (-390.913) (-391.302) [-389.888] (-390.759) -- 0:01:02
      75000 -- (-391.885) (-394.531) [-390.167] (-389.357) * [-391.657] (-392.023) (-389.071) (-389.650) -- 0:01:01

      Average standard deviation of split frequencies: 0.031013

      75500 -- (-391.172) [-389.225] (-393.449) (-393.841) * (-391.426) (-389.879) [-389.561] (-390.760) -- 0:01:01
      76000 -- (-391.318) [-391.085] (-392.740) (-391.414) * (-390.842) [-392.522] (-389.983) (-392.563) -- 0:01:00
      76500 -- (-389.775) (-392.508) (-392.092) [-390.161] * [-391.336] (-392.390) (-391.092) (-390.735) -- 0:01:00
      77000 -- (-390.647) [-389.912] (-392.974) (-391.581) * [-390.533] (-390.900) (-390.455) (-393.455) -- 0:00:59
      77500 -- (-393.728) (-390.510) [-391.148] (-389.838) * (-389.947) (-390.370) [-390.030] (-399.988) -- 0:00:59
      78000 -- (-390.576) (-389.257) (-392.877) [-391.299] * [-390.334] (-390.137) (-390.387) (-393.679) -- 0:00:59
      78500 -- (-391.787) [-391.714] (-392.505) (-393.669) * [-389.910] (-390.573) (-393.902) (-390.273) -- 0:00:58
      79000 -- (-391.889) (-391.157) (-390.013) [-390.234] * (-390.955) (-390.780) [-390.066] (-393.971) -- 0:01:09
      79500 -- (-391.134) (-390.584) [-390.795] (-391.107) * (-390.514) (-389.834) [-391.211] (-393.213) -- 0:01:09
      80000 -- (-389.593) [-389.554] (-392.687) (-391.370) * (-390.864) (-393.672) [-393.587] (-392.628) -- 0:01:09

      Average standard deviation of split frequencies: 0.035063

      80500 -- (-391.473) (-390.020) (-391.710) [-391.246] * (-390.350) [-391.026] (-393.660) (-389.775) -- 0:01:08
      81000 -- [-391.373] (-391.954) (-392.599) (-389.986) * (-390.509) (-390.639) (-392.776) [-390.459] -- 0:01:08
      81500 -- (-390.477) (-391.618) (-391.799) [-393.176] * (-390.707) [-389.061] (-390.682) (-390.535) -- 0:01:07
      82000 -- (-389.746) (-390.262) (-392.996) [-390.417] * (-391.315) [-390.125] (-393.372) (-392.696) -- 0:01:07
      82500 -- (-389.740) (-392.369) [-390.607] (-391.051) * (-389.796) [-391.156] (-390.682) (-389.173) -- 0:01:06
      83000 -- (-389.878) [-391.716] (-389.638) (-390.076) * (-390.480) [-391.361] (-390.655) (-390.615) -- 0:01:06
      83500 -- [-391.965] (-391.447) (-390.427) (-392.536) * (-391.865) (-392.492) (-391.385) [-390.167] -- 0:01:05
      84000 -- [-390.746] (-390.983) (-390.673) (-393.428) * (-392.502) [-392.249] (-391.534) (-391.368) -- 0:01:05
      84500 -- (-389.953) (-395.454) (-390.985) [-389.963] * (-393.051) (-392.716) [-389.920] (-392.193) -- 0:01:05
      85000 -- [-391.761] (-390.367) (-392.386) (-391.335) * (-392.202) [-391.479] (-391.208) (-392.348) -- 0:01:04

      Average standard deviation of split frequencies: 0.030148

      85500 -- (-393.534) (-393.412) (-392.762) [-390.411] * (-393.780) (-389.289) (-391.264) [-389.323] -- 0:01:04
      86000 -- [-390.879] (-392.119) (-390.725) (-392.187) * (-393.108) [-394.673] (-391.257) (-389.798) -- 0:01:03
      86500 -- [-390.078] (-395.879) (-391.211) (-390.576) * [-391.752] (-390.965) (-390.484) (-391.974) -- 0:01:03
      87000 -- [-390.464] (-394.252) (-391.303) (-394.884) * [-393.024] (-392.114) (-390.402) (-389.725) -- 0:01:02
      87500 -- (-389.762) (-395.053) [-390.757] (-390.184) * (-395.067) (-392.279) [-389.212] (-390.643) -- 0:01:02
      88000 -- (-391.487) (-391.535) [-390.855] (-389.651) * (-391.124) (-390.127) [-391.245] (-391.943) -- 0:01:02
      88500 -- (-390.374) [-390.194] (-392.592) (-391.857) * (-391.927) (-392.013) [-392.470] (-391.409) -- 0:01:01
      89000 -- (-391.912) [-389.801] (-394.024) (-390.323) * [-390.534] (-392.821) (-395.385) (-390.066) -- 0:01:01
      89500 -- (-390.855) [-389.623] (-394.838) (-390.454) * (-390.492) [-394.535] (-391.206) (-389.228) -- 0:01:01
      90000 -- (-390.426) (-390.591) [-392.043] (-392.479) * (-389.935) (-393.065) (-395.877) [-389.900] -- 0:01:00

      Average standard deviation of split frequencies: 0.031470

      90500 -- (-389.707) (-395.243) [-391.642] (-389.830) * (-389.929) [-389.320] (-393.621) (-395.367) -- 0:01:00
      91000 -- (-390.894) (-391.238) [-389.539] (-391.251) * (-394.159) [-391.739] (-394.377) (-391.193) -- 0:00:59
      91500 -- (-394.720) (-394.759) [-389.810] (-395.679) * (-390.825) (-393.619) [-391.638] (-390.731) -- 0:00:59
      92000 -- [-389.434] (-390.838) (-390.849) (-395.767) * (-393.730) [-391.047] (-393.014) (-390.234) -- 0:00:59
      92500 -- (-390.427) (-393.484) (-391.551) [-391.700] * [-390.551] (-399.800) (-390.294) (-391.029) -- 0:00:58
      93000 -- [-389.660] (-392.027) (-391.146) (-390.097) * (-391.628) (-391.172) (-394.707) [-389.671] -- 0:01:08
      93500 -- (-391.870) (-391.704) (-391.668) [-391.570] * [-390.679] (-389.616) (-392.175) (-393.580) -- 0:01:07
      94000 -- (-394.471) (-389.689) [-390.036] (-394.831) * (-392.946) [-390.488] (-391.811) (-391.752) -- 0:01:07
      94500 -- [-389.137] (-395.471) (-392.147) (-391.312) * (-398.646) [-390.869] (-390.057) (-391.460) -- 0:01:07
      95000 -- (-391.335) (-394.044) (-391.839) [-392.553] * (-393.704) (-391.926) [-391.503] (-391.127) -- 0:01:06

      Average standard deviation of split frequencies: 0.030690

      95500 -- [-393.602] (-390.542) (-391.096) (-389.860) * (-391.848) (-395.267) (-392.448) [-395.124] -- 0:01:06
      96000 -- (-394.215) [-394.440] (-390.656) (-392.198) * (-391.459) (-393.867) (-390.342) [-391.942] -- 0:01:05
      96500 -- (-394.266) [-390.624] (-391.181) (-389.723) * (-392.037) (-390.396) [-393.146] (-390.605) -- 0:01:05
      97000 -- [-392.414] (-392.771) (-392.480) (-391.644) * (-392.072) (-391.023) (-393.339) [-391.169] -- 0:01:05
      97500 -- (-393.715) (-391.332) (-391.361) [-394.651] * (-390.440) (-390.473) [-392.613] (-392.426) -- 0:01:04
      98000 -- (-391.941) [-389.368] (-389.599) (-390.908) * (-390.193) [-389.100] (-396.349) (-391.531) -- 0:01:04
      98500 -- (-392.558) (-390.739) (-390.696) [-391.401] * (-391.401) [-392.198] (-393.291) (-390.699) -- 0:01:04
      99000 -- (-390.551) [-390.388] (-391.913) (-392.252) * [-391.049] (-389.226) (-390.440) (-395.093) -- 0:01:03
      99500 -- (-391.252) (-392.951) [-392.894] (-392.649) * (-392.730) (-391.915) [-391.294] (-389.775) -- 0:01:03
      100000 -- (-391.864) (-393.186) (-391.292) [-392.306] * (-393.437) [-390.469] (-391.428) (-390.039) -- 0:01:02

      Average standard deviation of split frequencies: 0.029268

      100500 -- (-395.400) (-390.345) [-391.198] (-391.805) * (-391.963) [-389.670] (-389.705) (-390.159) -- 0:01:02
      101000 -- [-390.753] (-393.664) (-390.228) (-396.289) * (-393.014) (-389.706) (-390.339) [-390.908] -- 0:01:02
      101500 -- (-390.693) (-389.535) (-390.562) [-394.747] * (-391.054) (-390.308) [-389.785] (-391.232) -- 0:01:01
      102000 -- (-392.117) (-392.552) [-390.619] (-397.642) * (-392.872) [-390.441] (-389.139) (-392.993) -- 0:01:01
      102500 -- [-389.615] (-389.803) (-391.010) (-397.110) * (-391.354) [-389.940] (-392.893) (-393.104) -- 0:01:01
      103000 -- (-389.225) (-389.732) (-392.909) [-392.433] * (-391.745) (-389.052) (-390.143) [-391.867] -- 0:01:00
      103500 -- (-390.045) (-389.539) (-394.176) [-389.602] * [-389.989] (-390.670) (-389.010) (-390.044) -- 0:01:00
      104000 -- [-390.116] (-389.689) (-393.140) (-389.343) * (-390.384) [-393.204] (-390.617) (-394.218) -- 0:01:00
      104500 -- [-389.373] (-390.876) (-391.515) (-389.851) * (-391.337) (-390.021) (-390.298) [-391.222] -- 0:00:59
      105000 -- (-389.806) (-393.905) [-390.573] (-389.709) * (-391.359) (-390.955) (-391.087) [-390.394] -- 0:00:59

      Average standard deviation of split frequencies: 0.028801

      105500 -- (-389.794) (-391.000) (-390.638) [-391.367] * (-393.281) [-390.362] (-391.641) (-390.832) -- 0:00:59
      106000 -- [-391.230] (-391.039) (-391.056) (-391.633) * (-393.776) (-391.167) [-391.050] (-389.763) -- 0:00:59
      106500 -- (-390.601) (-391.828) [-390.553] (-392.401) * (-389.869) (-393.597) [-391.284] (-389.779) -- 0:00:58
      107000 -- [-391.666] (-392.124) (-391.337) (-396.327) * (-389.539) [-391.464] (-391.825) (-389.759) -- 0:00:58
      107500 -- (-391.020) [-391.754] (-390.705) (-391.139) * (-392.081) [-389.970] (-391.673) (-390.439) -- 0:00:58
      108000 -- [-393.262] (-395.999) (-393.622) (-390.149) * (-392.558) (-391.403) (-391.000) [-389.717] -- 0:00:57
      108500 -- [-389.501] (-393.690) (-390.379) (-391.500) * (-391.965) (-390.479) (-395.050) [-389.534] -- 0:00:57
      109000 -- (-389.616) (-390.040) [-391.075] (-400.224) * (-391.148) [-390.507] (-391.392) (-392.847) -- 0:00:57
      109500 -- (-391.553) (-391.913) (-389.949) [-393.702] * [-394.720] (-392.521) (-389.766) (-392.051) -- 0:01:05
      110000 -- (-392.907) [-390.291] (-391.585) (-390.808) * (-392.864) (-393.672) (-389.564) [-392.289] -- 0:01:04

      Average standard deviation of split frequencies: 0.025771

      110500 -- (-392.302) [-389.661] (-393.969) (-394.371) * [-392.443] (-394.591) (-390.274) (-391.910) -- 0:01:04
      111000 -- [-390.768] (-391.049) (-393.529) (-395.485) * (-393.744) (-394.782) (-392.629) [-389.541] -- 0:01:04
      111500 -- (-390.559) (-389.762) [-389.921] (-391.735) * (-390.302) (-391.254) [-390.499] (-389.376) -- 0:01:03
      112000 -- (-391.340) (-393.754) [-391.568] (-389.672) * (-390.574) (-391.862) [-390.164] (-389.060) -- 0:01:03
      112500 -- (-389.703) (-389.043) [-390.842] (-393.971) * (-391.967) (-391.121) (-393.790) [-389.300] -- 0:01:03
      113000 -- (-390.824) (-390.969) [-389.267] (-392.296) * (-393.582) (-393.649) (-389.246) [-390.106] -- 0:01:02
      113500 -- [-390.741] (-391.288) (-390.254) (-391.556) * [-395.617] (-398.988) (-389.774) (-390.498) -- 0:01:02
      114000 -- (-391.243) [-390.481] (-393.102) (-392.136) * [-390.969] (-392.750) (-389.569) (-391.859) -- 0:01:02
      114500 -- (-390.411) [-389.985] (-393.582) (-394.535) * (-390.098) (-390.250) [-390.196] (-391.469) -- 0:01:01
      115000 -- (-390.981) (-394.091) [-391.031] (-393.732) * [-392.817] (-388.982) (-391.308) (-389.372) -- 0:01:01

      Average standard deviation of split frequencies: 0.029088

      115500 -- (-390.093) [-391.400] (-392.790) (-391.126) * (-392.119) (-389.220) [-392.782] (-391.255) -- 0:01:01
      116000 -- (-393.315) (-392.882) (-390.500) [-390.724] * [-391.391] (-392.369) (-392.929) (-390.060) -- 0:01:00
      116500 -- (-390.273) (-391.541) (-393.925) [-392.203] * (-391.040) (-391.679) (-392.728) [-389.202] -- 0:01:00
      117000 -- (-394.176) (-390.704) [-393.522] (-391.426) * (-391.027) [-391.592] (-390.318) (-389.313) -- 0:01:00
      117500 -- (-392.420) (-391.559) (-393.949) [-391.785] * (-392.579) [-391.873] (-392.831) (-391.430) -- 0:01:00
      118000 -- (-391.331) (-397.189) (-390.813) [-391.513] * (-392.998) (-391.080) (-392.835) [-389.491] -- 0:00:59
      118500 -- (-402.904) (-393.480) [-391.759] (-389.414) * (-390.273) [-391.040] (-389.754) (-390.309) -- 0:00:59
      119000 -- (-393.139) (-391.758) [-389.366] (-389.727) * [-394.219] (-391.065) (-390.372) (-392.020) -- 0:00:59
      119500 -- [-390.330] (-390.288) (-391.008) (-389.443) * (-392.232) [-393.047] (-392.287) (-394.937) -- 0:00:58
      120000 -- (-393.101) [-390.272] (-391.104) (-393.895) * [-390.469] (-390.902) (-393.638) (-390.665) -- 0:00:58

      Average standard deviation of split frequencies: 0.031036

      120500 -- [-394.553] (-390.200) (-390.426) (-393.358) * (-390.497) (-391.468) [-390.163] (-390.197) -- 0:00:58
      121000 -- [-393.713] (-392.729) (-390.713) (-389.986) * (-391.906) [-393.086] (-392.858) (-392.055) -- 0:00:58
      121500 -- [-390.126] (-389.895) (-389.641) (-389.637) * (-390.160) [-391.229] (-391.187) (-394.187) -- 0:00:57
      122000 -- [-392.169] (-389.657) (-390.298) (-391.419) * (-389.146) (-393.077) (-392.121) [-395.018] -- 0:00:57
      122500 -- [-392.484] (-392.269) (-393.060) (-392.354) * (-390.790) [-392.236] (-391.341) (-392.597) -- 0:00:57
      123000 -- [-389.449] (-391.537) (-392.525) (-392.556) * (-392.913) (-395.793) (-393.211) [-391.840] -- 0:00:57
      123500 -- [-391.112] (-390.346) (-391.190) (-390.748) * (-389.654) (-395.808) [-390.140] (-391.149) -- 0:00:56
      124000 -- (-394.122) [-389.387] (-391.376) (-391.077) * (-392.178) (-394.095) (-391.175) [-392.148] -- 0:00:56
      124500 -- [-391.006] (-392.240) (-396.388) (-390.959) * (-389.541) (-392.596) [-392.724] (-391.662) -- 0:00:56
      125000 -- (-390.501) (-395.857) [-391.900] (-394.713) * (-392.759) (-391.956) [-391.036] (-390.669) -- 0:00:56

      Average standard deviation of split frequencies: 0.029143

      125500 -- (-390.094) [-390.668] (-391.264) (-389.990) * [-390.325] (-390.654) (-389.698) (-391.511) -- 0:00:55
      126000 -- (-390.273) (-390.002) (-389.951) [-391.260] * [-389.110] (-391.950) (-390.052) (-390.687) -- 0:00:55
      126500 -- [-393.260] (-392.104) (-391.205) (-392.796) * (-389.763) (-392.805) (-390.835) [-390.862] -- 0:01:02
      127000 -- (-390.149) (-391.055) [-390.017] (-391.120) * (-394.013) [-391.134] (-393.097) (-390.320) -- 0:01:01
      127500 -- (-392.168) (-390.074) (-391.704) [-393.246] * (-397.042) (-390.166) (-391.918) [-389.378] -- 0:01:01
      128000 -- [-390.738] (-390.224) (-394.113) (-391.042) * [-391.014] (-397.276) (-390.558) (-390.551) -- 0:01:01
      128500 -- (-391.034) (-390.644) [-392.402] (-392.158) * [-390.847] (-397.936) (-390.405) (-389.325) -- 0:01:01
      129000 -- (-390.269) (-391.502) [-390.680] (-394.790) * (-390.026) [-389.267] (-391.597) (-390.969) -- 0:01:00
      129500 -- [-392.128] (-392.058) (-392.632) (-393.176) * (-393.383) (-389.450) (-390.485) [-389.419] -- 0:01:00
      130000 -- (-394.786) [-391.335] (-389.819) (-395.960) * (-393.511) (-389.601) (-392.704) [-393.941] -- 0:01:00

      Average standard deviation of split frequencies: 0.026963

      130500 -- (-390.871) (-391.874) [-389.698] (-390.188) * (-391.026) (-390.943) [-391.723] (-391.219) -- 0:00:59
      131000 -- (-392.213) [-394.326] (-391.375) (-390.198) * (-394.780) (-390.828) (-391.556) [-392.497] -- 0:00:59
      131500 -- (-391.479) (-391.936) [-393.730] (-390.359) * (-390.778) [-393.871] (-394.577) (-392.216) -- 0:00:59
      132000 -- (-390.521) [-390.467] (-391.094) (-389.938) * (-390.071) (-391.077) [-395.263] (-391.231) -- 0:00:59
      132500 -- [-389.527] (-393.314) (-392.033) (-395.181) * [-389.460] (-391.560) (-390.425) (-390.048) -- 0:00:58
      133000 -- (-392.020) [-390.875] (-390.687) (-393.191) * (-391.955) (-392.865) (-389.720) [-395.714] -- 0:00:58
      133500 -- (-392.822) [-391.078] (-390.202) (-392.092) * (-392.874) (-390.732) [-390.181] (-393.823) -- 0:00:58
      134000 -- (-393.135) (-390.659) [-391.304] (-391.322) * (-392.602) [-392.660] (-392.494) (-395.585) -- 0:00:58
      134500 -- [-391.750] (-390.893) (-392.002) (-390.464) * (-390.398) (-390.451) [-390.862] (-389.728) -- 0:00:57
      135000 -- (-392.822) (-389.576) (-393.277) [-391.431] * (-390.764) (-391.535) (-389.703) [-390.899] -- 0:00:57

      Average standard deviation of split frequencies: 0.024783

      135500 -- (-391.408) [-390.111] (-392.491) (-391.811) * (-389.450) (-390.509) [-394.574] (-393.130) -- 0:00:57
      136000 -- [-391.973] (-394.022) (-396.647) (-393.637) * (-391.433) [-390.663] (-390.930) (-392.071) -- 0:00:57
      136500 -- [-391.236] (-398.027) (-393.120) (-392.710) * (-390.067) (-390.854) [-391.554] (-391.288) -- 0:00:56
      137000 -- (-390.331) (-394.783) [-392.490] (-392.590) * (-391.795) [-389.262] (-392.187) (-389.881) -- 0:00:56
      137500 -- (-392.930) [-391.800] (-390.388) (-395.198) * (-391.914) [-390.933] (-391.510) (-389.300) -- 0:00:56
      138000 -- (-391.277) (-390.809) [-391.328] (-393.687) * [-389.466] (-390.637) (-392.433) (-392.784) -- 0:00:56
      138500 -- (-391.072) (-392.793) (-390.408) [-391.265] * (-392.191) (-391.450) (-392.517) [-390.119] -- 0:00:55
      139000 -- [-391.012] (-391.943) (-391.814) (-389.983) * (-390.084) (-391.952) (-392.776) [-392.823] -- 0:00:55
      139500 -- (-391.945) (-389.849) (-391.347) [-393.968] * (-390.328) (-390.718) (-391.071) [-389.750] -- 0:00:55
      140000 -- (-390.911) (-389.742) [-389.902] (-390.988) * (-391.487) [-390.561] (-391.041) (-392.106) -- 0:00:55

      Average standard deviation of split frequencies: 0.024164

      140500 -- (-389.541) [-389.518] (-389.580) (-393.898) * (-389.407) (-390.519) (-391.360) [-389.943] -- 0:00:55
      141000 -- (-389.346) (-390.019) (-389.449) [-392.760] * (-391.097) (-394.566) [-391.590] (-390.186) -- 0:00:54
      141500 -- (-391.793) (-392.608) [-390.190] (-391.183) * (-389.612) (-390.109) (-391.463) [-393.265] -- 0:00:54
      142000 -- [-390.828] (-394.376) (-390.397) (-394.206) * (-390.269) (-389.938) [-390.007] (-395.836) -- 0:00:54
      142500 -- (-389.906) [-390.997] (-393.122) (-394.860) * (-391.197) (-391.132) [-392.438] (-395.518) -- 0:00:54
      143000 -- (-389.781) (-389.786) (-389.612) [-391.599] * (-392.337) (-389.953) [-391.223] (-397.899) -- 0:00:53
      143500 -- (-392.218) (-395.222) (-392.915) [-398.725] * (-392.085) (-389.392) (-389.913) [-390.283] -- 0:00:59
      144000 -- (-393.042) [-391.077] (-390.830) (-392.974) * (-389.555) (-391.302) [-391.614] (-393.943) -- 0:00:59
      144500 -- [-391.890] (-390.672) (-391.120) (-391.643) * (-390.815) (-391.236) (-390.176) [-391.138] -- 0:00:59
      145000 -- [-390.205] (-389.939) (-390.107) (-390.903) * (-390.213) [-391.437] (-390.711) (-391.301) -- 0:00:58

      Average standard deviation of split frequencies: 0.022602

      145500 -- [-391.294] (-389.712) (-390.232) (-390.627) * (-391.210) [-390.969] (-390.165) (-392.387) -- 0:00:58
      146000 -- (-392.130) [-391.599] (-391.868) (-392.762) * (-390.387) (-391.105) [-390.522] (-390.438) -- 0:00:58
      146500 -- (-391.771) (-395.681) (-390.270) [-391.852] * [-391.233] (-389.725) (-389.968) (-391.418) -- 0:00:58
      147000 -- [-389.324] (-389.638) (-391.716) (-390.142) * [-390.673] (-390.068) (-391.985) (-392.029) -- 0:00:58
      147500 -- (-389.803) (-390.506) (-389.927) [-389.545] * (-389.346) [-392.800] (-393.633) (-391.325) -- 0:00:57
      148000 -- (-389.966) (-390.105) (-393.859) [-391.332] * (-390.526) (-389.685) [-395.546] (-392.731) -- 0:00:57
      148500 -- (-391.979) (-393.217) [-390.464] (-389.965) * (-391.442) (-390.160) [-389.565] (-390.378) -- 0:00:57
      149000 -- (-391.714) (-392.641) [-392.849] (-391.327) * (-390.148) (-391.625) [-392.365] (-394.627) -- 0:00:57
      149500 -- (-391.508) (-391.666) [-391.789] (-391.399) * (-392.704) [-392.933] (-389.349) (-392.537) -- 0:00:56
      150000 -- [-393.837] (-391.993) (-393.366) (-392.834) * (-394.212) (-394.890) (-390.045) [-389.423] -- 0:00:56

      Average standard deviation of split frequencies: 0.019925

      150500 -- (-391.925) (-390.626) [-389.892] (-391.021) * (-395.348) [-393.794] (-391.912) (-390.745) -- 0:00:56
      151000 -- (-395.869) (-390.369) [-389.798] (-392.697) * (-390.378) (-390.978) [-391.730] (-392.487) -- 0:00:56
      151500 -- (-390.135) (-390.297) (-390.061) [-391.317] * [-393.372] (-394.661) (-390.794) (-390.973) -- 0:00:56
      152000 -- [-390.795] (-393.309) (-389.458) (-391.283) * [-392.090] (-389.566) (-398.594) (-393.554) -- 0:00:55
      152500 -- (-391.454) (-389.649) (-390.574) [-391.460] * (-394.324) (-393.848) (-390.255) [-391.716] -- 0:00:55
      153000 -- (-392.150) (-390.089) (-390.880) [-390.483] * (-393.439) (-392.295) (-391.050) [-390.397] -- 0:00:55
      153500 -- (-397.804) (-391.023) [-390.219] (-392.387) * (-393.010) [-392.162] (-392.639) (-390.650) -- 0:00:55
      154000 -- (-396.151) (-393.292) [-391.743] (-391.158) * (-389.873) (-392.741) [-390.049] (-391.179) -- 0:00:54
      154500 -- (-389.890) [-389.131] (-389.689) (-390.046) * [-389.744] (-392.684) (-390.221) (-389.901) -- 0:00:54
      155000 -- [-390.266] (-392.008) (-392.487) (-393.573) * (-389.993) (-390.389) (-389.407) [-391.172] -- 0:00:54

      Average standard deviation of split frequencies: 0.019138

      155500 -- (-393.830) (-391.415) [-391.692] (-394.171) * (-391.496) [-391.569] (-390.210) (-393.306) -- 0:00:54
      156000 -- (-391.080) (-391.441) (-392.313) [-390.450] * (-393.109) (-394.938) [-390.067] (-390.027) -- 0:00:54
      156500 -- (-392.049) [-389.415] (-390.688) (-390.964) * [-393.264] (-389.922) (-391.708) (-392.248) -- 0:00:53
      157000 -- (-395.469) (-391.974) [-390.713] (-391.518) * [-391.937] (-389.814) (-391.581) (-394.831) -- 0:00:53
      157500 -- (-390.953) [-389.952] (-394.196) (-390.212) * [-390.666] (-394.654) (-390.770) (-390.825) -- 0:00:53
      158000 -- (-389.665) (-394.651) [-392.049] (-392.811) * (-389.739) (-390.206) [-389.996] (-390.283) -- 0:00:53
      158500 -- [-389.501] (-390.056) (-390.300) (-391.430) * (-393.063) [-390.224] (-389.388) (-390.270) -- 0:00:53
      159000 -- [-391.992] (-392.065) (-389.773) (-392.852) * (-391.169) [-391.060] (-391.776) (-390.354) -- 0:00:52
      159500 -- (-391.555) [-392.092] (-392.670) (-394.264) * (-394.266) [-390.713] (-396.337) (-390.570) -- 0:00:52
      160000 -- (-392.105) [-394.226] (-389.415) (-391.994) * (-391.272) [-390.874] (-394.563) (-390.896) -- 0:00:52

      Average standard deviation of split frequencies: 0.019805

      160500 -- (-389.756) (-391.611) (-390.787) [-390.151] * (-390.870) [-391.321] (-391.404) (-392.406) -- 0:00:57
      161000 -- (-388.914) (-394.352) [-390.280] (-391.773) * (-390.445) (-394.039) (-391.153) [-390.898] -- 0:00:57
      161500 -- (-389.243) [-392.039] (-391.477) (-393.011) * (-390.128) [-392.620] (-394.527) (-392.259) -- 0:00:57
      162000 -- [-389.315] (-390.076) (-391.220) (-393.165) * (-389.792) (-392.033) (-397.894) [-391.743] -- 0:00:56
      162500 -- (-392.443) (-389.845) [-390.378] (-391.038) * (-389.322) (-391.104) [-390.032] (-392.839) -- 0:00:56
      163000 -- [-393.630] (-390.340) (-389.303) (-388.958) * (-389.837) (-392.588) (-389.367) [-391.895] -- 0:00:56
      163500 -- (-390.371) (-389.799) [-390.373] (-389.687) * (-389.744) [-389.733] (-394.705) (-391.832) -- 0:00:56
      164000 -- (-390.368) (-389.732) [-390.434] (-396.192) * [-393.080] (-391.801) (-391.505) (-394.193) -- 0:00:56
      164500 -- (-392.448) (-390.935) [-391.117] (-390.391) * (-391.784) [-392.065] (-393.851) (-390.993) -- 0:00:55
      165000 -- (-391.537) [-390.358] (-391.144) (-394.025) * [-389.125] (-392.080) (-390.269) (-389.367) -- 0:00:55

      Average standard deviation of split frequencies: 0.020304

      165500 -- [-390.630] (-392.173) (-395.123) (-393.742) * [-393.901] (-395.220) (-389.942) (-390.358) -- 0:00:55
      166000 -- (-391.064) (-392.439) [-390.499] (-397.837) * (-396.740) (-389.306) (-392.071) [-392.273] -- 0:00:55
      166500 -- [-391.851] (-390.914) (-390.102) (-393.782) * (-390.271) (-389.502) (-390.668) [-390.538] -- 0:00:55
      167000 -- (-393.573) (-389.276) (-392.597) [-392.531] * (-390.739) (-390.614) [-390.037] (-392.260) -- 0:00:54
      167500 -- [-391.543] (-389.560) (-392.038) (-391.908) * (-390.093) (-395.030) (-390.386) [-391.028] -- 0:00:54
      168000 -- (-389.572) [-389.480] (-391.629) (-389.775) * (-391.308) (-390.265) [-390.846] (-389.536) -- 0:00:54
      168500 -- [-395.146] (-389.414) (-390.327) (-394.017) * (-390.665) (-393.578) [-390.084] (-390.766) -- 0:00:54
      169000 -- (-395.504) [-389.425] (-390.911) (-390.948) * (-390.358) [-393.464] (-389.645) (-394.315) -- 0:00:54
      169500 -- (-390.615) [-390.388] (-390.036) (-390.413) * (-392.253) (-395.750) [-389.780] (-392.565) -- 0:00:53
      170000 -- (-390.403) [-392.367] (-389.921) (-390.631) * (-392.552) (-391.738) [-394.547] (-392.709) -- 0:00:53

      Average standard deviation of split frequencies: 0.019586

      170500 -- [-389.496] (-389.639) (-391.368) (-389.076) * (-393.546) (-390.486) [-390.378] (-392.269) -- 0:00:53
      171000 -- (-392.387) (-390.419) [-392.552] (-389.816) * (-390.904) [-390.196] (-391.570) (-395.343) -- 0:00:53
      171500 -- [-391.080] (-391.992) (-394.176) (-390.573) * (-390.808) [-390.145] (-396.395) (-390.038) -- 0:00:53
      172000 -- (-390.612) [-391.769] (-390.183) (-391.391) * (-393.191) (-392.043) (-397.037) [-394.204] -- 0:00:52
      172500 -- [-391.292] (-391.934) (-391.399) (-390.369) * (-391.487) (-390.038) [-392.168] (-397.326) -- 0:00:52
      173000 -- (-392.194) (-390.308) (-393.602) [-391.354] * (-391.614) (-391.017) [-394.108] (-394.734) -- 0:00:52
      173500 -- [-395.430] (-390.123) (-394.053) (-392.522) * (-392.728) (-390.643) (-391.811) [-390.600] -- 0:00:52
      174000 -- [-389.602] (-389.926) (-389.861) (-390.275) * (-392.188) (-391.693) [-390.071] (-389.289) -- 0:00:52
      174500 -- (-390.320) (-390.725) [-391.191] (-390.771) * (-389.925) (-394.453) [-390.434] (-389.388) -- 0:00:52
      175000 -- (-392.362) (-390.702) [-395.859] (-392.862) * (-390.040) (-391.879) (-397.417) [-390.435] -- 0:00:51

      Average standard deviation of split frequencies: 0.020356

      175500 -- (-392.274) (-391.085) [-396.315] (-391.530) * (-390.078) [-390.617] (-394.541) (-390.446) -- 0:00:51
      176000 -- (-391.617) (-391.679) (-392.255) [-392.079] * [-391.626] (-392.810) (-389.826) (-392.547) -- 0:00:51
      176500 -- (-389.271) [-390.456] (-391.123) (-392.616) * (-389.577) (-392.069) [-389.373] (-391.731) -- 0:00:51
      177000 -- (-391.884) [-391.213] (-394.318) (-392.930) * [-390.600] (-391.933) (-393.992) (-391.976) -- 0:00:51
      177500 -- (-391.676) [-392.281] (-393.151) (-394.465) * (-394.187) [-391.437] (-390.916) (-394.817) -- 0:00:55
      178000 -- (-391.911) (-391.591) [-392.931] (-395.468) * [-395.794] (-392.553) (-389.672) (-390.596) -- 0:00:55
      178500 -- (-391.125) (-389.794) (-390.164) [-399.361] * (-391.800) [-390.996] (-390.015) (-392.987) -- 0:00:55
      179000 -- (-390.015) (-391.455) [-397.050] (-391.040) * (-389.916) [-391.082] (-391.424) (-396.431) -- 0:00:55
      179500 -- (-391.699) [-389.274] (-394.101) (-391.479) * (-390.757) (-389.771) [-393.146] (-393.501) -- 0:00:54
      180000 -- (-391.444) [-389.698] (-391.197) (-390.607) * [-393.652] (-391.609) (-391.666) (-392.826) -- 0:00:54

      Average standard deviation of split frequencies: 0.021454

      180500 -- (-393.055) (-390.348) (-392.544) [-390.262] * (-390.434) (-393.909) (-391.984) [-393.303] -- 0:00:54
      181000 -- (-391.305) (-390.180) [-390.970] (-392.039) * (-389.478) (-393.091) (-390.096) [-390.563] -- 0:00:54
      181500 -- (-390.871) (-389.899) [-393.311] (-390.809) * (-391.860) [-391.113] (-392.696) (-391.219) -- 0:00:54
      182000 -- (-394.376) (-391.626) (-390.663) [-391.740] * (-390.735) (-390.493) [-390.333] (-391.029) -- 0:00:53
      182500 -- (-390.734) (-394.931) [-390.605] (-393.024) * (-392.522) [-390.107] (-391.491) (-393.497) -- 0:00:53
      183000 -- (-392.940) [-393.451] (-389.228) (-391.520) * (-390.862) [-389.879] (-390.073) (-393.141) -- 0:00:53
      183500 -- [-390.802] (-394.771) (-391.062) (-391.930) * (-390.857) (-391.709) [-389.822] (-390.840) -- 0:00:53
      184000 -- (-391.858) (-389.178) (-390.888) [-390.805] * (-391.893) [-391.728] (-390.622) (-389.071) -- 0:00:53
      184500 -- [-392.912] (-389.908) (-389.828) (-393.839) * (-391.408) [-390.601] (-392.507) (-389.556) -- 0:00:53
      185000 -- (-391.216) [-389.612] (-390.492) (-389.801) * (-391.751) [-390.580] (-391.364) (-392.517) -- 0:00:52

      Average standard deviation of split frequencies: 0.018755

      185500 -- [-390.473] (-389.410) (-394.453) (-389.977) * (-391.550) (-390.326) [-390.498] (-390.199) -- 0:00:52
      186000 -- (-391.275) (-389.216) [-390.559] (-396.315) * (-391.010) (-389.402) [-391.181] (-390.634) -- 0:00:52
      186500 -- (-393.742) (-389.527) [-390.505] (-394.273) * [-393.432] (-391.475) (-395.291) (-389.821) -- 0:00:52
      187000 -- (-395.873) [-392.781] (-391.033) (-390.930) * (-390.220) (-393.485) [-393.457] (-396.093) -- 0:00:52
      187500 -- [-391.837] (-392.318) (-391.218) (-389.273) * [-389.541] (-394.379) (-390.556) (-393.746) -- 0:00:52
      188000 -- (-392.383) [-391.000] (-390.027) (-389.438) * (-389.583) [-392.406] (-391.298) (-391.409) -- 0:00:51
      188500 -- (-391.696) (-390.929) [-390.378] (-390.349) * (-390.041) [-390.640] (-390.778) (-389.836) -- 0:00:51
      189000 -- (-390.354) (-391.191) (-390.822) [-390.063] * (-393.083) (-391.853) (-391.965) [-395.988] -- 0:00:51
      189500 -- [-391.687] (-390.229) (-390.757) (-390.114) * [-394.727] (-390.912) (-395.228) (-390.920) -- 0:00:51
      190000 -- [-389.903] (-391.145) (-390.643) (-392.471) * (-391.757) (-389.078) [-391.853] (-389.697) -- 0:00:51

      Average standard deviation of split frequencies: 0.017060

      190500 -- [-390.310] (-390.338) (-390.782) (-391.249) * [-392.764] (-389.668) (-389.761) (-390.046) -- 0:00:50
      191000 -- [-394.507] (-390.814) (-389.691) (-390.336) * (-394.728) [-391.597] (-391.698) (-389.340) -- 0:00:50
      191500 -- (-390.075) (-391.451) (-390.264) [-394.133] * [-391.619] (-392.576) (-391.389) (-393.705) -- 0:00:50
      192000 -- (-390.837) (-393.503) [-392.079] (-390.951) * (-391.585) (-391.630) [-390.459] (-394.163) -- 0:00:50
      192500 -- [-390.199] (-393.020) (-391.014) (-390.503) * [-390.743] (-390.841) (-389.388) (-395.507) -- 0:00:50
      193000 -- [-393.267] (-390.775) (-391.556) (-392.298) * (-394.958) (-391.873) (-394.490) [-391.342] -- 0:00:50
      193500 -- (-392.391) (-390.508) [-389.734] (-395.769) * [-394.805] (-390.746) (-392.657) (-395.359) -- 0:00:50
      194000 -- (-393.050) (-389.992) [-389.685] (-391.159) * (-389.622) (-391.129) (-395.056) [-391.345] -- 0:00:49
      194500 -- (-389.196) [-390.938] (-391.477) (-393.507) * (-391.478) (-390.916) (-396.835) [-391.127] -- 0:00:53
      195000 -- (-389.488) [-390.628] (-392.062) (-391.099) * (-392.198) [-392.011] (-393.460) (-393.188) -- 0:00:53

      Average standard deviation of split frequencies: 0.015633

      195500 -- (-394.315) (-391.640) [-391.465] (-389.979) * (-394.094) (-395.822) [-390.187] (-394.940) -- 0:00:53
      196000 -- (-392.720) (-389.899) [-392.725] (-390.493) * (-390.207) [-390.746] (-392.833) (-394.672) -- 0:00:53
      196500 -- (-391.028) (-389.406) [-391.393] (-389.216) * (-391.080) [-390.666] (-390.558) (-391.033) -- 0:00:53
      197000 -- (-390.279) (-390.621) (-389.573) [-391.312] * (-390.082) [-391.785] (-391.480) (-392.610) -- 0:00:52
      197500 -- (-391.442) (-390.260) [-390.208] (-391.732) * [-392.178] (-389.545) (-390.668) (-392.273) -- 0:00:52
      198000 -- (-390.953) (-390.613) [-390.143] (-390.134) * (-390.629) [-393.592] (-391.038) (-390.171) -- 0:00:52
      198500 -- (-390.313) [-390.956] (-389.827) (-390.750) * (-393.775) (-391.171) (-389.766) [-390.866] -- 0:00:52
      199000 -- [-390.475] (-389.160) (-389.321) (-391.378) * (-395.061) (-392.687) (-394.742) [-390.961] -- 0:00:52
      199500 -- (-392.606) (-394.507) (-397.866) [-391.141] * [-394.033] (-390.507) (-391.837) (-391.955) -- 0:00:52
      200000 -- (-391.725) (-393.481) (-392.668) [-391.145] * (-389.872) (-392.339) [-393.227] (-393.766) -- 0:00:51

      Average standard deviation of split frequencies: 0.015201

      200500 -- [-390.903] (-393.107) (-390.995) (-392.527) * (-389.928) (-392.633) (-392.239) [-391.759] -- 0:00:51
      201000 -- (-390.009) (-392.317) [-390.623] (-392.152) * (-392.959) (-392.909) (-393.106) [-390.209] -- 0:00:51
      201500 -- (-390.879) (-396.273) [-391.276] (-391.182) * [-392.669] (-390.188) (-392.849) (-395.164) -- 0:00:51
      202000 -- (-390.468) (-395.397) (-392.482) [-392.287] * (-390.856) (-393.078) [-389.100] (-393.428) -- 0:00:51
      202500 -- (-389.549) (-391.324) (-392.327) [-391.596] * (-389.446) [-390.705] (-390.072) (-391.580) -- 0:00:51
      203000 -- (-390.052) [-390.409] (-394.397) (-391.749) * [-389.113] (-390.725) (-393.414) (-391.301) -- 0:00:51
      203500 -- (-391.741) (-390.013) [-393.098] (-390.735) * (-389.492) [-392.393] (-390.796) (-392.640) -- 0:00:50
      204000 -- (-395.595) [-392.565] (-391.203) (-391.881) * [-391.037] (-390.738) (-390.703) (-391.493) -- 0:00:50
      204500 -- (-390.403) (-396.097) (-392.831) [-391.106] * [-389.173] (-389.920) (-392.195) (-393.099) -- 0:00:50
      205000 -- (-392.391) (-396.153) [-390.541] (-391.427) * (-390.698) [-391.955] (-391.119) (-394.679) -- 0:00:50

      Average standard deviation of split frequencies: 0.014453

      205500 -- (-391.854) [-392.024] (-391.025) (-392.499) * (-389.822) (-392.409) (-391.405) [-390.266] -- 0:00:50
      206000 -- [-393.935] (-392.518) (-391.285) (-391.783) * (-389.783) (-391.163) [-390.558] (-399.095) -- 0:00:50
      206500 -- (-395.797) (-391.990) (-391.477) [-394.174] * [-390.215] (-391.264) (-391.092) (-393.000) -- 0:00:49
      207000 -- (-390.733) [-390.412] (-389.699) (-394.074) * (-390.849) (-396.640) [-391.333] (-389.789) -- 0:00:49
      207500 -- (-390.215) (-395.962) [-390.687] (-389.286) * (-393.835) (-394.253) [-392.338] (-391.000) -- 0:00:49
      208000 -- [-389.771] (-389.903) (-393.413) (-389.587) * (-390.395) (-393.955) [-389.556] (-394.973) -- 0:00:49
      208500 -- [-390.828] (-390.187) (-392.405) (-391.718) * [-389.303] (-392.428) (-390.971) (-392.304) -- 0:00:49
      209000 -- (-390.697) [-390.836] (-391.008) (-392.904) * (-389.567) (-394.408) (-390.989) [-390.559] -- 0:00:49
      209500 -- (-392.403) (-389.670) (-393.302) [-391.066] * (-390.205) [-389.485] (-391.378) (-390.581) -- 0:00:49
      210000 -- (-389.950) [-391.737] (-391.078) (-391.767) * [-392.472] (-390.040) (-393.129) (-394.261) -- 0:00:48

      Average standard deviation of split frequencies: 0.013426

      210500 -- [-391.084] (-391.574) (-397.358) (-390.596) * [-392.184] (-394.022) (-391.956) (-392.206) -- 0:00:48
      211000 -- (-389.960) (-395.745) (-391.625) [-391.262] * [-389.624] (-391.174) (-389.800) (-390.412) -- 0:00:48
      211500 -- [-395.065] (-391.134) (-390.218) (-393.989) * [-389.813] (-390.464) (-392.182) (-389.362) -- 0:00:48
      212000 -- (-390.358) (-391.382) (-389.289) [-394.331] * (-390.909) [-389.674] (-392.081) (-389.647) -- 0:00:52
      212500 -- (-391.702) (-390.247) [-393.248] (-392.319) * (-392.060) [-392.051] (-391.108) (-390.353) -- 0:00:51
      213000 -- (-393.815) (-392.517) (-392.005) [-392.624] * (-391.741) (-390.929) [-395.336] (-391.388) -- 0:00:51
      213500 -- (-393.126) [-390.918] (-392.135) (-394.079) * [-393.018] (-389.952) (-389.542) (-392.635) -- 0:00:51
      214000 -- (-392.110) (-391.521) [-390.072] (-389.834) * [-390.362] (-389.918) (-393.351) (-389.135) -- 0:00:51
      214500 -- (-389.949) (-392.677) (-391.090) [-389.468] * (-393.132) (-392.380) [-389.804] (-391.430) -- 0:00:51
      215000 -- [-391.647] (-391.491) (-392.625) (-391.296) * (-390.709) [-392.305] (-391.419) (-397.895) -- 0:00:51

      Average standard deviation of split frequencies: 0.013865

      215500 -- (-392.177) [-389.453] (-391.970) (-393.201) * (-392.276) (-391.334) [-392.494] (-390.441) -- 0:00:50
      216000 -- (-391.124) [-391.881] (-389.650) (-396.892) * (-390.466) (-393.219) [-391.251] (-389.776) -- 0:00:50
      216500 -- (-396.389) (-391.001) [-390.319] (-392.033) * (-392.514) (-396.435) [-392.285] (-389.252) -- 0:00:50
      217000 -- (-390.080) [-392.224] (-390.263) (-394.669) * (-389.554) [-394.592] (-391.190) (-389.420) -- 0:00:50
      217500 -- (-392.435) (-390.247) [-389.979] (-390.293) * (-389.637) (-402.028) [-389.989] (-389.808) -- 0:00:50
      218000 -- [-390.328] (-394.168) (-391.990) (-389.818) * (-390.321) (-390.305) [-390.726] (-391.876) -- 0:00:50
      218500 -- [-392.074] (-393.616) (-390.806) (-389.415) * [-390.490] (-391.631) (-393.710) (-390.703) -- 0:00:50
      219000 -- (-395.303) (-390.720) [-390.070] (-390.303) * (-391.286) [-390.198] (-389.782) (-395.265) -- 0:00:49
      219500 -- (-396.662) [-389.876] (-396.898) (-390.062) * [-390.235] (-392.719) (-390.599) (-391.506) -- 0:00:49
      220000 -- (-391.893) (-402.495) [-391.083] (-389.910) * (-391.809) (-391.353) (-391.394) [-392.368] -- 0:00:49

      Average standard deviation of split frequencies: 0.014326

      220500 -- [-393.595] (-396.105) (-390.572) (-392.081) * (-390.561) (-392.159) [-391.795] (-393.620) -- 0:00:49
      221000 -- (-391.744) (-394.005) (-391.762) [-390.248] * [-391.284] (-390.306) (-390.875) (-391.437) -- 0:00:49
      221500 -- (-393.835) (-392.209) [-391.811] (-392.017) * (-393.850) [-392.885] (-392.113) (-390.220) -- 0:00:49
      222000 -- (-391.030) [-393.644] (-394.478) (-389.929) * (-392.369) (-401.388) [-394.146] (-391.437) -- 0:00:49
      222500 -- (-391.802) [-390.239] (-390.973) (-391.469) * [-390.395] (-399.712) (-391.911) (-390.576) -- 0:00:48
      223000 -- (-392.092) (-390.815) [-391.537] (-392.423) * [-391.119] (-391.967) (-390.335) (-389.810) -- 0:00:48
      223500 -- (-392.409) [-391.961] (-391.362) (-394.634) * [-391.130] (-390.588) (-389.375) (-396.284) -- 0:00:48
      224000 -- (-392.197) [-390.178] (-391.041) (-394.369) * (-392.345) (-392.703) [-390.026] (-391.557) -- 0:00:48
      224500 -- [-391.136] (-390.571) (-396.348) (-389.585) * (-391.118) (-390.505) [-391.517] (-392.452) -- 0:00:48
      225000 -- (-389.931) (-389.754) [-389.635] (-393.883) * (-390.528) (-390.090) [-390.737] (-391.807) -- 0:00:48

      Average standard deviation of split frequencies: 0.012979

      225500 -- (-389.725) (-391.933) [-389.912] (-389.681) * (-390.746) (-391.683) (-389.364) [-391.068] -- 0:00:48
      226000 -- (-391.581) (-392.012) [-394.235] (-393.884) * (-389.111) (-390.929) [-392.770] (-394.594) -- 0:00:47
      226500 -- (-392.354) (-390.775) [-391.029] (-391.808) * (-391.203) [-390.702] (-394.837) (-392.923) -- 0:00:47
      227000 -- [-393.153] (-389.587) (-391.518) (-393.279) * [-390.459] (-389.448) (-390.428) (-391.137) -- 0:00:47
      227500 -- (-395.422) (-390.534) [-391.256] (-392.864) * (-390.760) [-391.068] (-392.455) (-393.284) -- 0:00:47
      228000 -- (-392.672) (-391.295) [-392.251] (-391.548) * (-390.975) (-390.828) (-391.216) [-391.072] -- 0:00:47
      228500 -- (-391.219) [-393.457] (-389.635) (-393.032) * [-389.433] (-394.357) (-396.083) (-390.566) -- 0:00:50
      229000 -- (-389.895) (-391.330) [-392.899] (-393.510) * (-391.229) [-390.227] (-393.944) (-391.562) -- 0:00:50
      229500 -- [-389.568] (-389.974) (-393.778) (-392.041) * (-392.444) [-391.375] (-391.215) (-393.653) -- 0:00:50
      230000 -- (-392.888) (-390.089) (-391.133) [-392.005] * [-395.474] (-389.856) (-391.566) (-391.749) -- 0:00:50

      Average standard deviation of split frequencies: 0.011808

      230500 -- (-392.249) (-390.543) (-394.589) [-393.158] * (-396.414) [-389.814] (-395.667) (-392.576) -- 0:00:50
      231000 -- (-391.534) (-393.295) [-392.602] (-391.455) * (-399.603) (-390.213) (-392.654) [-391.369] -- 0:00:49
      231500 -- [-390.950] (-391.240) (-389.746) (-392.311) * [-392.303] (-392.965) (-390.185) (-391.144) -- 0:00:49
      232000 -- (-395.176) [-390.719] (-390.704) (-389.205) * (-390.594) [-391.976] (-392.559) (-395.343) -- 0:00:49
      232500 -- [-390.061] (-392.754) (-390.981) (-391.445) * [-392.000] (-390.769) (-392.054) (-393.704) -- 0:00:49
      233000 -- [-390.558] (-397.239) (-391.924) (-393.415) * [-390.021] (-391.017) (-390.487) (-393.798) -- 0:00:49
      233500 -- (-393.699) [-390.611] (-391.466) (-390.991) * (-389.406) (-392.557) (-390.101) [-391.827] -- 0:00:49
      234000 -- (-393.128) (-389.745) (-390.773) [-390.215] * (-392.009) (-390.810) (-391.608) [-390.925] -- 0:00:49
      234500 -- [-392.866] (-389.670) (-390.678) (-390.501) * (-394.075) [-389.500] (-393.195) (-390.670) -- 0:00:48
      235000 -- (-389.950) (-390.188) [-389.051] (-390.601) * (-392.184) [-390.193] (-392.418) (-391.613) -- 0:00:48

      Average standard deviation of split frequencies: 0.010653

      235500 -- (-393.583) (-391.503) [-391.270] (-389.359) * (-389.630) (-392.984) (-389.913) [-390.450] -- 0:00:48
      236000 -- [-391.444] (-395.088) (-391.677) (-393.110) * [-390.587] (-397.247) (-392.045) (-389.823) -- 0:00:48
      236500 -- [-390.446] (-390.105) (-391.978) (-390.567) * (-390.182) (-395.660) (-390.667) [-389.897] -- 0:00:48
      237000 -- [-393.422] (-390.917) (-389.795) (-391.166) * (-390.203) [-394.092] (-390.498) (-391.179) -- 0:00:48
      237500 -- (-392.961) (-391.822) (-390.040) [-390.980] * (-390.449) (-396.690) (-391.869) [-391.697] -- 0:00:48
      238000 -- (-391.004) (-392.035) [-389.172] (-391.896) * (-395.749) (-391.315) [-390.120] (-391.601) -- 0:00:48
      238500 -- (-393.983) [-391.469] (-390.338) (-392.277) * [-392.597] (-391.258) (-392.629) (-390.118) -- 0:00:47
      239000 -- (-395.151) (-389.586) [-391.894] (-390.351) * [-391.421] (-393.192) (-391.859) (-389.463) -- 0:00:47
      239500 -- [-391.369] (-391.538) (-392.574) (-391.462) * (-391.018) [-397.250] (-393.160) (-394.182) -- 0:00:47
      240000 -- (-391.358) [-393.062] (-389.969) (-390.220) * (-390.981) (-392.033) (-390.302) [-390.825] -- 0:00:47

      Average standard deviation of split frequencies: 0.012559

      240500 -- [-390.574] (-394.212) (-391.474) (-390.611) * (-390.621) (-389.760) (-389.822) [-390.611] -- 0:00:47
      241000 -- (-393.449) (-392.428) [-392.886] (-390.119) * [-390.991] (-389.276) (-390.597) (-390.966) -- 0:00:47
      241500 -- (-392.044) [-390.808] (-389.967) (-389.696) * [-389.686] (-392.222) (-389.672) (-392.458) -- 0:00:47
      242000 -- (-389.310) (-391.580) [-389.662] (-392.910) * [-391.337] (-389.299) (-391.969) (-392.176) -- 0:00:46
      242500 -- (-392.264) [-392.123] (-390.750) (-392.413) * (-391.413) (-389.591) (-396.023) [-393.829] -- 0:00:46
      243000 -- (-391.906) (-390.705) (-389.959) [-390.057] * [-392.218] (-389.596) (-397.280) (-391.465) -- 0:00:46
      243500 -- [-390.638] (-390.040) (-391.039) (-389.711) * (-389.817) (-389.235) (-400.043) [-392.115] -- 0:00:46
      244000 -- [-390.236] (-392.921) (-391.624) (-392.107) * (-390.724) [-395.947] (-396.938) (-389.448) -- 0:00:46
      244500 -- [-390.311] (-389.646) (-390.884) (-390.883) * (-390.047) (-390.469) (-393.630) [-389.356] -- 0:00:46
      245000 -- (-397.593) (-393.811) [-391.207] (-394.107) * (-390.091) (-391.896) (-391.913) [-389.852] -- 0:00:46

      Average standard deviation of split frequencies: 0.013212

      245500 -- (-394.785) (-391.140) (-389.768) [-395.448] * [-390.523] (-391.545) (-392.928) (-390.671) -- 0:00:46
      246000 -- [-391.717] (-393.452) (-398.366) (-392.106) * [-390.852] (-392.115) (-398.847) (-389.551) -- 0:00:49
      246500 -- [-389.587] (-390.546) (-390.716) (-394.527) * [-391.720] (-391.803) (-391.369) (-393.606) -- 0:00:48
      247000 -- (-389.121) [-394.004] (-390.931) (-391.186) * (-391.042) (-391.152) [-389.601] (-390.645) -- 0:00:48
      247500 -- (-389.413) (-394.283) (-390.699) [-390.689] * (-391.029) [-389.958] (-389.461) (-394.989) -- 0:00:48
      248000 -- (-389.541) (-394.850) (-393.811) [-390.275] * (-395.011) [-390.085] (-392.079) (-394.872) -- 0:00:48
      248500 -- (-390.484) (-395.362) [-392.106] (-394.866) * (-389.398) (-391.185) (-391.632) [-392.572] -- 0:00:48
      249000 -- (-393.904) [-390.009] (-390.970) (-394.373) * [-391.870] (-391.418) (-391.463) (-392.867) -- 0:00:48
      249500 -- (-389.931) (-390.017) (-391.063) [-390.242] * (-394.575) (-390.307) [-392.448] (-392.093) -- 0:00:48
      250000 -- (-393.974) (-392.425) [-390.139] (-390.288) * (-393.925) (-393.662) (-390.449) [-392.576] -- 0:00:48

      Average standard deviation of split frequencies: 0.014253

      250500 -- (-392.109) (-392.376) [-391.168] (-392.925) * (-389.527) (-394.563) (-392.162) [-391.017] -- 0:00:47
      251000 -- [-392.020] (-391.744) (-391.029) (-391.983) * [-389.732] (-389.842) (-396.044) (-390.414) -- 0:00:47
      251500 -- (-393.855) (-390.952) [-390.539] (-393.842) * (-390.949) [-389.763] (-394.457) (-394.773) -- 0:00:47
      252000 -- [-392.227] (-392.091) (-390.579) (-389.582) * [-389.709] (-389.329) (-389.594) (-391.536) -- 0:00:47
      252500 -- (-392.819) (-394.365) (-392.207) [-390.476] * (-389.256) (-390.357) (-390.103) [-391.228] -- 0:00:47
      253000 -- [-389.806] (-392.546) (-390.222) (-389.911) * (-390.688) [-393.540] (-391.171) (-389.442) -- 0:00:47
      253500 -- (-390.122) (-392.291) (-391.153) [-390.463] * (-396.727) (-394.606) [-390.369] (-389.639) -- 0:00:47
      254000 -- (-391.975) (-392.103) (-394.129) [-391.861] * [-393.628] (-391.215) (-395.060) (-393.355) -- 0:00:46
      254500 -- [-392.012] (-389.724) (-394.983) (-396.356) * (-393.361) [-390.329] (-395.646) (-389.803) -- 0:00:46
      255000 -- (-391.614) (-389.798) [-390.837] (-392.488) * (-390.858) (-391.871) (-391.181) [-392.148] -- 0:00:46

      Average standard deviation of split frequencies: 0.012696

      255500 -- (-391.501) [-390.807] (-393.357) (-391.637) * (-390.486) [-390.150] (-393.351) (-393.499) -- 0:00:46
      256000 -- (-391.443) (-391.201) (-392.520) [-397.185] * (-391.136) [-392.329] (-389.208) (-392.941) -- 0:00:46
      256500 -- [-390.955] (-391.734) (-391.976) (-395.030) * (-390.146) (-391.873) [-389.725] (-393.168) -- 0:00:46
      257000 -- (-392.085) (-389.728) [-390.014] (-394.504) * (-392.110) [-390.546] (-391.784) (-391.595) -- 0:00:46
      257500 -- (-392.362) (-389.577) (-391.388) [-392.122] * (-391.087) (-390.478) [-391.154] (-396.308) -- 0:00:46
      258000 -- (-393.342) (-395.176) [-390.412] (-392.991) * [-390.902] (-390.674) (-390.936) (-392.473) -- 0:00:46
      258500 -- (-396.055) (-390.972) [-390.861] (-395.526) * (-396.970) (-391.508) (-392.264) [-390.510] -- 0:00:45
      259000 -- [-395.161] (-390.005) (-391.161) (-394.526) * (-392.898) (-390.416) (-391.532) [-391.598] -- 0:00:45
      259500 -- (-398.465) (-390.456) [-391.143] (-391.764) * [-393.239] (-390.815) (-393.146) (-390.804) -- 0:00:45
      260000 -- [-390.428] (-389.517) (-396.073) (-390.782) * [-390.881] (-393.343) (-392.288) (-390.621) -- 0:00:45

      Average standard deviation of split frequencies: 0.011041

      260500 -- (-391.276) (-390.300) [-393.653] (-389.747) * (-391.034) (-394.466) (-392.499) [-389.608] -- 0:00:45
      261000 -- (-390.310) (-405.077) [-389.573] (-390.480) * (-393.290) (-393.011) (-389.474) [-391.198] -- 0:00:45
      261500 -- (-391.738) (-402.860) (-390.375) [-390.979] * (-391.588) [-392.231] (-391.824) (-391.483) -- 0:00:45
      262000 -- (-390.391) (-402.094) (-392.366) [-389.880] * (-392.298) (-392.518) [-391.720] (-391.461) -- 0:00:45
      262500 -- (-390.277) [-391.389] (-392.390) (-393.930) * [-391.352] (-390.526) (-393.906) (-392.563) -- 0:00:44
      263000 -- (-389.895) [-389.786] (-389.106) (-390.857) * [-390.176] (-392.822) (-392.405) (-390.008) -- 0:00:47
      263500 -- [-391.352] (-390.839) (-394.170) (-389.657) * [-392.794] (-392.617) (-395.701) (-391.554) -- 0:00:47
      264000 -- [-390.404] (-390.179) (-392.778) (-391.257) * (-391.717) [-393.829] (-391.606) (-391.749) -- 0:00:47
      264500 -- (-390.303) (-392.314) (-389.953) [-389.276] * (-394.508) [-393.377] (-389.242) (-392.117) -- 0:00:47
      265000 -- (-391.819) [-390.115] (-391.004) (-393.331) * [-389.705] (-397.174) (-391.411) (-393.797) -- 0:00:47

      Average standard deviation of split frequencies: 0.012312

      265500 -- [-391.479] (-389.542) (-389.762) (-390.186) * (-390.755) (-391.506) [-392.384] (-393.478) -- 0:00:47
      266000 -- [-391.976] (-390.277) (-390.233) (-393.181) * (-391.920) (-392.710) [-389.532] (-391.567) -- 0:00:46
      266500 -- (-392.170) (-390.739) (-392.494) [-390.083] * (-392.626) (-390.265) [-391.090] (-390.833) -- 0:00:46
      267000 -- (-394.048) (-391.129) [-389.534] (-391.556) * (-390.444) (-391.321) (-389.970) [-389.293] -- 0:00:46
      267500 -- (-392.631) [-392.790] (-388.928) (-392.851) * (-393.385) (-392.431) [-394.391] (-390.025) -- 0:00:46
      268000 -- (-390.150) [-390.889] (-389.877) (-389.767) * [-393.101] (-392.805) (-392.007) (-391.841) -- 0:00:46
      268500 -- (-393.501) (-389.858) (-395.534) [-389.957] * (-392.839) (-389.078) [-392.732] (-392.712) -- 0:00:46
      269000 -- (-391.453) [-390.393] (-392.178) (-389.976) * (-393.112) [-389.750] (-392.164) (-390.657) -- 0:00:46
      269500 -- (-391.758) (-393.896) [-392.807] (-391.048) * (-391.948) (-391.387) (-390.656) [-395.248] -- 0:00:46
      270000 -- (-390.975) (-391.014) [-391.165] (-390.157) * (-389.572) (-389.539) [-390.779] (-390.777) -- 0:00:45

      Average standard deviation of split frequencies: 0.012466

      270500 -- [-389.909] (-391.637) (-394.727) (-390.302) * [-390.842] (-392.650) (-392.447) (-391.851) -- 0:00:45
      271000 -- (-390.593) (-390.859) (-392.071) [-389.223] * (-392.375) [-390.860] (-390.297) (-394.073) -- 0:00:45
      271500 -- (-391.473) (-391.207) [-390.842] (-390.755) * [-394.348] (-389.540) (-389.952) (-390.492) -- 0:00:45
      272000 -- (-389.333) (-390.392) [-392.557] (-391.592) * [-390.187] (-390.782) (-392.228) (-391.040) -- 0:00:45
      272500 -- (-393.828) (-392.271) (-393.576) [-391.653] * [-389.183] (-390.940) (-393.567) (-390.306) -- 0:00:45
      273000 -- [-390.964] (-392.138) (-389.618) (-395.137) * (-390.902) (-390.250) (-389.228) [-390.533] -- 0:00:45
      273500 -- (-392.293) [-389.379] (-392.481) (-393.019) * (-394.669) (-389.946) [-389.866] (-389.698) -- 0:00:45
      274000 -- (-390.943) [-390.939] (-391.987) (-393.403) * (-391.150) (-398.926) [-389.252] (-391.135) -- 0:00:45
      274500 -- [-389.666] (-390.043) (-393.745) (-389.728) * [-391.211] (-391.113) (-390.098) (-390.467) -- 0:00:44
      275000 -- (-389.355) [-390.299] (-390.077) (-389.197) * (-394.021) (-391.005) (-389.481) [-391.754] -- 0:00:44

      Average standard deviation of split frequencies: 0.011956

      275500 -- (-391.547) [-390.508] (-393.475) (-390.937) * [-394.068] (-389.612) (-398.152) (-389.291) -- 0:00:44
      276000 -- (-392.623) (-389.311) (-390.883) [-392.270] * (-391.880) (-392.135) [-392.983] (-392.031) -- 0:00:44
      276500 -- [-390.027] (-394.154) (-391.710) (-394.360) * (-390.544) (-389.766) (-391.311) [-390.362] -- 0:00:44
      277000 -- (-390.766) [-390.160] (-390.732) (-391.587) * (-390.277) (-393.026) [-391.039] (-389.758) -- 0:00:44
      277500 -- (-393.162) [-391.658] (-391.842) (-390.829) * (-389.416) (-393.437) [-389.736] (-394.641) -- 0:00:44
      278000 -- (-391.560) (-395.800) [-391.201] (-393.986) * [-389.668] (-394.558) (-390.040) (-390.183) -- 0:00:44
      278500 -- (-392.490) [-390.004] (-391.026) (-393.695) * (-390.680) (-390.880) (-389.391) [-390.307] -- 0:00:44
      279000 -- (-392.292) (-390.665) (-395.853) [-390.255] * (-389.865) [-390.657] (-390.024) (-393.859) -- 0:00:43
      279500 -- (-392.198) [-390.396] (-391.320) (-389.253) * (-389.316) (-389.402) (-389.360) [-392.167] -- 0:00:43
      280000 -- (-392.474) (-390.004) (-391.617) [-391.005] * (-390.474) [-389.706] (-394.486) (-391.096) -- 0:00:46

      Average standard deviation of split frequencies: 0.011580

      280500 -- (-391.042) [-390.270] (-390.673) (-390.340) * (-391.711) (-389.495) [-391.825] (-390.037) -- 0:00:46
      281000 -- (-390.489) [-391.470] (-389.856) (-394.066) * [-391.030] (-396.552) (-391.390) (-390.762) -- 0:00:46
      281500 -- (-391.755) [-390.159] (-390.011) (-389.875) * (-395.052) (-394.801) [-390.969] (-392.062) -- 0:00:45
      282000 -- (-389.951) [-390.293] (-390.413) (-392.421) * (-392.031) (-390.247) (-391.905) [-390.694] -- 0:00:45
      282500 -- (-390.554) (-391.114) (-391.910) [-389.426] * (-393.816) (-390.863) [-389.399] (-391.333) -- 0:00:45
      283000 -- (-395.318) (-390.643) (-399.745) [-391.380] * [-392.504] (-389.854) (-389.685) (-394.847) -- 0:00:45
      283500 -- (-393.229) (-395.916) (-392.972) [-391.395] * (-394.683) (-393.235) (-393.739) [-391.961] -- 0:00:45
      284000 -- [-390.892] (-393.612) (-391.077) (-390.811) * (-393.700) (-391.735) (-391.315) [-390.483] -- 0:00:45
      284500 -- (-393.212) (-394.252) [-390.792] (-390.835) * (-390.026) (-390.276) [-391.677] (-392.111) -- 0:00:45
      285000 -- (-390.220) [-389.279] (-391.895) (-390.217) * [-390.707] (-392.491) (-397.643) (-391.042) -- 0:00:45

      Average standard deviation of split frequencies: 0.009706

      285500 -- [-393.208] (-392.328) (-394.249) (-389.477) * (-392.802) (-391.496) (-392.744) [-390.063] -- 0:00:45
      286000 -- [-392.090] (-392.182) (-392.093) (-390.164) * (-394.571) [-390.325] (-390.859) (-390.052) -- 0:00:44
      286500 -- [-393.015] (-396.427) (-389.633) (-394.493) * (-392.520) [-390.805] (-390.422) (-390.009) -- 0:00:44
      287000 -- (-392.970) (-397.129) (-390.769) [-391.481] * (-391.151) [-393.571] (-391.325) (-392.333) -- 0:00:44
      287500 -- (-393.263) (-394.840) [-389.604] (-395.218) * (-392.083) [-390.160] (-392.543) (-391.624) -- 0:00:44
      288000 -- (-397.091) [-391.417] (-395.500) (-393.513) * (-390.599) [-390.264] (-390.372) (-391.374) -- 0:00:44
      288500 -- [-393.011] (-390.702) (-391.866) (-390.718) * [-391.535] (-390.398) (-389.971) (-389.983) -- 0:00:44
      289000 -- (-391.290) [-390.805] (-390.164) (-393.611) * (-391.497) (-394.541) [-390.262] (-389.453) -- 0:00:44
      289500 -- (-390.605) (-390.828) (-393.991) [-390.463] * [-389.878] (-395.560) (-390.567) (-390.199) -- 0:00:44
      290000 -- (-391.893) [-392.652] (-390.070) (-390.533) * (-391.117) (-390.076) (-392.863) [-391.821] -- 0:00:44

      Average standard deviation of split frequencies: 0.008830

      290500 -- (-389.757) (-391.702) [-392.022] (-394.632) * (-389.889) (-390.448) [-391.357] (-392.971) -- 0:00:43
      291000 -- (-391.284) (-391.542) (-392.875) [-391.402] * (-390.479) (-389.928) [-390.539] (-389.763) -- 0:00:43
      291500 -- (-391.416) [-392.043] (-391.065) (-391.381) * (-392.276) (-392.137) [-391.889] (-391.016) -- 0:00:43
      292000 -- [-394.842] (-390.546) (-390.150) (-391.704) * (-391.684) [-393.149] (-390.912) (-391.662) -- 0:00:43
      292500 -- [-393.323] (-389.783) (-394.471) (-394.611) * (-391.968) [-392.370] (-390.577) (-394.069) -- 0:00:43
      293000 -- (-390.815) [-394.020] (-389.434) (-392.230) * [-390.526] (-394.867) (-391.778) (-391.855) -- 0:00:43
      293500 -- (-390.889) (-389.995) (-389.588) [-392.785] * (-389.496) [-395.026] (-390.615) (-392.309) -- 0:00:43
      294000 -- (-391.964) (-395.115) [-390.228] (-394.978) * (-390.802) [-394.617] (-394.802) (-392.380) -- 0:00:43
      294500 -- (-390.579) [-391.330] (-391.924) (-391.452) * (-389.594) (-391.523) [-390.902] (-392.630) -- 0:00:43
      295000 -- (-391.738) [-391.200] (-392.219) (-391.774) * (-390.364) (-392.856) (-391.695) [-389.368] -- 0:00:43

      Average standard deviation of split frequencies: 0.008494

      295500 -- (-391.840) (-389.761) [-392.703] (-391.326) * (-391.081) [-391.961] (-390.959) (-390.452) -- 0:00:42
      296000 -- (-391.045) (-391.368) [-390.296] (-391.598) * [-391.052] (-395.441) (-394.262) (-390.272) -- 0:00:42
      296500 -- (-389.502) (-393.483) (-394.114) [-390.553] * (-391.997) (-392.099) [-393.450] (-393.092) -- 0:00:42
      297000 -- (-390.912) [-393.354] (-392.375) (-394.207) * (-392.059) [-392.436] (-392.468) (-392.249) -- 0:00:42
      297500 -- (-391.241) (-393.813) [-390.790] (-390.617) * (-391.329) (-389.881) (-396.812) [-389.630] -- 0:00:44
      298000 -- (-392.567) (-389.892) [-389.855] (-398.074) * (-390.576) (-390.127) (-390.595) [-390.702] -- 0:00:44
      298500 -- (-396.412) (-390.694) [-389.627] (-390.471) * (-391.552) [-391.137] (-390.897) (-399.066) -- 0:00:44
      299000 -- (-393.429) [-390.410] (-392.623) (-393.596) * (-389.679) [-394.191] (-393.906) (-391.034) -- 0:00:44
      299500 -- (-393.659) (-389.966) [-391.308] (-390.613) * [-391.490] (-392.386) (-391.099) (-389.648) -- 0:00:44
      300000 -- (-390.389) (-390.759) [-389.836] (-389.027) * (-391.719) [-393.512] (-394.117) (-392.415) -- 0:00:44

      Average standard deviation of split frequencies: 0.009320

      300500 -- (-391.719) [-391.533] (-390.914) (-391.571) * (-391.958) (-389.699) [-392.265] (-390.258) -- 0:00:44
      301000 -- (-396.672) [-391.129] (-391.114) (-393.142) * (-392.665) [-390.002] (-391.119) (-389.907) -- 0:00:44
      301500 -- [-390.590] (-392.564) (-389.891) (-390.736) * (-396.213) (-394.574) (-394.910) [-390.637] -- 0:00:44
      302000 -- (-392.017) [-391.162] (-389.852) (-389.931) * (-390.527) [-393.209] (-393.848) (-390.769) -- 0:00:43
      302500 -- (-390.013) (-393.014) [-391.112] (-389.201) * (-391.991) (-391.091) [-389.410] (-391.597) -- 0:00:43
      303000 -- (-391.863) [-392.073] (-391.003) (-390.037) * (-395.124) (-392.957) (-389.674) [-389.344] -- 0:00:43
      303500 -- (-389.718) [-392.130] (-394.944) (-390.237) * [-389.558] (-393.066) (-389.540) (-391.141) -- 0:00:43
      304000 -- (-390.290) [-391.446] (-392.947) (-392.128) * (-390.733) [-389.942] (-392.336) (-392.640) -- 0:00:43
      304500 -- (-390.625) [-390.031] (-393.473) (-391.706) * (-392.208) (-389.398) (-390.191) [-390.020] -- 0:00:43
      305000 -- (-391.310) (-390.056) [-389.132] (-392.189) * (-389.824) (-390.287) (-394.089) [-391.042] -- 0:00:43

      Average standard deviation of split frequencies: 0.010541

      305500 -- (-392.985) [-390.198] (-389.240) (-393.146) * (-392.855) [-389.306] (-391.202) (-398.206) -- 0:00:43
      306000 -- (-391.700) (-390.826) [-388.953] (-393.016) * (-392.374) (-390.980) [-391.684] (-394.630) -- 0:00:43
      306500 -- (-390.070) (-391.153) [-389.672] (-393.715) * [-390.488] (-389.771) (-395.871) (-392.488) -- 0:00:42
      307000 -- (-391.131) (-394.121) [-390.831] (-392.217) * [-390.996] (-392.443) (-390.292) (-393.129) -- 0:00:42
      307500 -- (-392.707) (-390.563) (-390.870) [-391.658] * (-394.645) (-391.762) (-390.570) [-391.537] -- 0:00:42
      308000 -- [-390.868] (-392.431) (-394.694) (-389.449) * (-392.683) (-394.276) [-395.249] (-389.531) -- 0:00:42
      308500 -- (-392.100) (-391.942) (-390.540) [-390.986] * (-394.328) (-393.114) (-390.191) [-391.239] -- 0:00:42
      309000 -- [-390.082] (-393.243) (-391.920) (-390.903) * (-391.631) (-394.242) (-390.174) [-391.252] -- 0:00:42
      309500 -- (-392.375) (-390.534) [-394.076] (-392.665) * (-393.181) (-390.805) (-391.612) [-392.099] -- 0:00:42
      310000 -- (-391.772) (-390.376) [-392.080] (-392.974) * (-391.585) (-390.408) (-392.335) [-392.733] -- 0:00:42

      Average standard deviation of split frequencies: 0.011181

      310500 -- (-390.026) [-389.828] (-392.661) (-395.595) * [-391.202] (-390.072) (-392.903) (-392.434) -- 0:00:42
      311000 -- [-390.311] (-390.045) (-396.040) (-393.501) * (-396.787) [-389.640] (-391.254) (-389.348) -- 0:00:42
      311500 -- (-392.103) (-390.612) (-390.155) [-391.555] * (-392.013) [-391.102] (-391.470) (-395.081) -- 0:00:41
      312000 -- [-391.241] (-393.150) (-390.296) (-393.192) * (-394.678) (-389.254) (-391.605) [-392.810] -- 0:00:41
      312500 -- (-393.430) [-389.903] (-391.047) (-389.390) * [-391.050] (-390.348) (-389.598) (-391.343) -- 0:00:41
      313000 -- (-389.722) (-390.538) [-391.197] (-392.470) * [-390.995] (-392.651) (-389.489) (-392.699) -- 0:00:41
      313500 -- [-390.128] (-391.928) (-389.232) (-392.515) * [-390.964] (-393.219) (-391.509) (-391.233) -- 0:00:41
      314000 -- (-389.997) [-389.736] (-390.772) (-392.785) * (-392.503) [-390.171] (-393.171) (-392.784) -- 0:00:41
      314500 -- (-391.293) (-393.251) (-391.006) [-390.977] * [-389.392] (-391.146) (-392.118) (-390.823) -- 0:00:43
      315000 -- (-392.854) [-392.966] (-391.926) (-392.385) * (-391.849) (-390.001) [-390.110] (-391.308) -- 0:00:43

      Average standard deviation of split frequencies: 0.010360

      315500 -- (-392.403) (-390.639) (-389.303) [-391.835] * [-394.043] (-394.068) (-391.964) (-389.174) -- 0:00:43
      316000 -- [-392.290] (-389.918) (-391.118) (-391.380) * (-390.776) [-391.613] (-389.828) (-396.383) -- 0:00:43
      316500 -- (-392.780) (-392.331) [-392.083] (-392.839) * (-390.463) (-392.603) (-389.851) [-391.630] -- 0:00:43
      317000 -- (-392.950) [-390.118] (-395.020) (-396.901) * [-390.680] (-391.233) (-390.613) (-396.086) -- 0:00:43
      317500 -- (-397.708) [-391.185] (-392.078) (-392.186) * (-392.120) (-392.519) (-393.489) [-391.184] -- 0:00:42
      318000 -- (-389.993) (-392.592) [-389.645] (-389.931) * (-393.550) [-391.708] (-391.671) (-392.955) -- 0:00:42
      318500 -- [-390.829] (-390.605) (-394.935) (-390.012) * (-390.399) [-390.987] (-389.208) (-398.790) -- 0:00:42
      319000 -- (-393.494) (-390.757) (-391.122) [-392.338] * (-390.977) (-390.928) [-390.863] (-391.162) -- 0:00:42
      319500 -- (-394.311) (-389.212) (-391.311) [-391.032] * [-390.152] (-389.562) (-390.183) (-391.188) -- 0:00:42
      320000 -- [-390.798] (-391.240) (-390.707) (-391.210) * (-393.475) [-389.203] (-394.775) (-390.889) -- 0:00:42

      Average standard deviation of split frequencies: 0.010372

      320500 -- [-390.548] (-390.721) (-389.677) (-392.363) * (-391.962) (-391.455) [-391.487] (-390.822) -- 0:00:42
      321000 -- (-392.525) [-390.024] (-393.963) (-389.862) * (-391.461) [-394.039] (-392.463) (-390.496) -- 0:00:42
      321500 -- [-390.634] (-392.006) (-391.051) (-393.084) * (-389.599) (-392.362) (-392.820) [-389.593] -- 0:00:42
      322000 -- (-395.673) (-393.267) (-389.413) [-393.625] * (-393.506) [-390.631] (-395.299) (-393.475) -- 0:00:42
      322500 -- (-392.403) (-392.038) [-389.520] (-400.796) * (-391.632) (-389.464) (-392.271) [-389.797] -- 0:00:42
      323000 -- [-399.061] (-391.465) (-389.778) (-393.750) * [-392.158] (-389.742) (-394.037) (-390.902) -- 0:00:41
      323500 -- (-391.514) (-389.661) (-395.130) [-395.857] * (-392.272) [-389.844] (-394.544) (-390.812) -- 0:00:41
      324000 -- (-392.604) (-390.093) (-394.657) [-393.420] * [-392.062] (-390.617) (-392.901) (-390.949) -- 0:00:41
      324500 -- [-390.825] (-392.134) (-389.927) (-391.462) * (-392.617) [-391.272] (-390.635) (-392.746) -- 0:00:41
      325000 -- (-392.732) [-392.250] (-392.371) (-392.790) * [-390.046] (-390.107) (-394.197) (-391.904) -- 0:00:41

      Average standard deviation of split frequencies: 0.011006

      325500 -- (-391.228) [-391.324] (-390.918) (-390.324) * (-390.838) [-391.726] (-389.908) (-390.388) -- 0:00:41
      326000 -- (-390.248) (-389.380) (-392.245) [-390.907] * (-390.220) (-391.214) [-391.788] (-390.452) -- 0:00:41
      326500 -- [-391.785] (-389.640) (-392.305) (-391.727) * (-390.449) (-393.355) [-389.598] (-390.931) -- 0:00:41
      327000 -- (-390.482) [-390.807] (-393.777) (-391.804) * (-390.849) (-390.219) (-390.019) [-390.340] -- 0:00:41
      327500 -- [-392.261] (-391.417) (-392.242) (-393.628) * (-391.169) (-394.317) (-393.594) [-390.152] -- 0:00:41
      328000 -- (-392.957) [-391.059] (-390.626) (-389.192) * (-389.899) (-396.517) (-391.117) [-389.561] -- 0:00:40
      328500 -- (-392.911) [-390.184] (-392.094) (-394.542) * (-392.075) (-389.893) (-389.867) [-393.545] -- 0:00:40
      329000 -- (-392.552) [-389.240] (-396.640) (-391.207) * (-397.753) (-392.386) [-389.121] (-389.692) -- 0:00:40
      329500 -- [-391.142] (-392.219) (-392.036) (-390.041) * [-394.328] (-391.316) (-390.538) (-392.340) -- 0:00:40
      330000 -- (-393.159) [-392.978] (-389.162) (-393.625) * (-392.536) (-390.336) [-391.548] (-391.476) -- 0:00:42

      Average standard deviation of split frequencies: 0.010505

      330500 -- [-391.248] (-393.812) (-393.271) (-393.460) * (-397.002) [-389.436] (-393.437) (-389.500) -- 0:00:42
      331000 -- [-391.508] (-394.148) (-393.971) (-392.200) * (-393.245) [-389.885] (-390.424) (-391.512) -- 0:00:42
      331500 -- (-390.504) (-392.340) [-392.177] (-390.612) * (-391.023) [-389.426] (-393.768) (-391.529) -- 0:00:42
      332000 -- [-392.130] (-391.195) (-391.697) (-393.148) * [-392.115] (-389.899) (-392.493) (-390.103) -- 0:00:42
      332500 -- (-390.621) [-389.926] (-389.794) (-390.905) * (-396.372) [-389.353] (-391.146) (-389.475) -- 0:00:42
      333000 -- (-391.299) (-393.715) [-393.974] (-390.021) * (-393.297) (-390.652) [-390.589] (-392.663) -- 0:00:42
      333500 -- [-389.845] (-389.490) (-393.262) (-389.847) * (-391.349) [-389.376] (-392.488) (-396.808) -- 0:00:41
      334000 -- (-390.232) (-389.454) (-392.962) [-389.303] * (-391.323) (-393.312) (-391.486) [-390.133] -- 0:00:41
      334500 -- (-390.375) [-391.262] (-391.814) (-393.016) * (-393.830) (-391.930) [-391.444] (-390.642) -- 0:00:41
      335000 -- (-392.023) (-391.068) (-390.230) [-390.201] * (-393.662) (-391.343) (-391.237) [-391.323] -- 0:00:41

      Average standard deviation of split frequencies: 0.009673

      335500 -- (-394.769) (-391.335) [-391.603] (-394.386) * [-389.638] (-392.355) (-391.082) (-391.161) -- 0:00:41
      336000 -- (-390.864) [-390.856] (-390.001) (-391.034) * [-392.439] (-394.045) (-390.292) (-390.890) -- 0:00:41
      336500 -- (-390.326) (-391.474) [-394.848] (-391.751) * (-391.379) [-393.516] (-392.922) (-392.407) -- 0:00:41
      337000 -- [-389.152] (-392.219) (-390.337) (-393.354) * (-393.742) (-391.626) (-390.354) [-390.947] -- 0:00:41
      337500 -- [-392.031] (-390.864) (-391.703) (-390.377) * (-394.998) (-394.123) (-389.534) [-389.124] -- 0:00:41
      338000 -- (-390.872) (-390.693) (-389.495) [-389.019] * [-390.738] (-399.126) (-390.457) (-389.502) -- 0:00:41
      338500 -- [-392.363] (-392.341) (-390.917) (-390.457) * [-393.726] (-390.471) (-390.443) (-391.700) -- 0:00:41
      339000 -- (-391.732) (-390.857) (-394.523) [-390.326] * (-392.348) (-393.160) [-391.898] (-390.859) -- 0:00:40
      339500 -- [-391.441] (-394.296) (-393.955) (-390.709) * (-390.800) (-391.423) (-391.787) [-390.447] -- 0:00:40
      340000 -- (-393.146) [-392.013] (-397.470) (-391.392) * (-389.667) (-390.234) (-391.668) [-389.788] -- 0:00:40

      Average standard deviation of split frequencies: 0.010488

      340500 -- (-391.265) (-392.868) (-392.356) [-395.243] * [-389.765] (-392.095) (-392.548) (-391.902) -- 0:00:40
      341000 -- [-394.952] (-392.772) (-391.368) (-390.340) * (-391.165) (-390.488) [-391.943] (-391.851) -- 0:00:40
      341500 -- (-390.642) (-390.223) (-390.677) [-389.809] * (-392.874) (-389.987) (-390.888) [-389.777] -- 0:00:40
      342000 -- (-389.933) [-394.650] (-390.874) (-394.187) * (-390.808) (-391.243) (-391.143) [-390.017] -- 0:00:40
      342500 -- [-391.349] (-392.399) (-390.392) (-393.454) * (-389.554) (-391.054) (-392.125) [-389.230] -- 0:00:40
      343000 -- (-389.648) (-395.369) [-392.012] (-392.636) * (-391.254) (-391.708) [-389.626] (-390.732) -- 0:00:40
      343500 -- (-389.598) (-392.310) (-394.435) [-391.943] * [-393.101] (-390.178) (-390.062) (-394.100) -- 0:00:40
      344000 -- (-393.817) (-393.235) [-390.824] (-396.590) * (-392.755) (-392.465) [-392.797] (-391.401) -- 0:00:40
      344500 -- [-392.733] (-392.526) (-392.120) (-393.410) * (-390.073) (-394.944) [-391.994] (-391.630) -- 0:00:39
      345000 -- [-390.950] (-391.197) (-393.051) (-393.012) * [-391.124] (-393.996) (-390.032) (-390.584) -- 0:00:39

      Average standard deviation of split frequencies: 0.009896

      345500 -- (-395.776) (-391.622) (-392.425) [-389.937] * [-390.938] (-390.903) (-391.637) (-393.450) -- 0:00:41
      346000 -- (-390.116) (-392.074) [-392.344] (-390.102) * (-395.446) (-391.040) [-391.969] (-392.200) -- 0:00:41
      346500 -- (-391.118) (-390.854) [-390.218] (-391.013) * (-394.897) [-391.312] (-391.010) (-389.837) -- 0:00:41
      347000 -- (-392.425) (-394.080) [-389.861] (-390.598) * (-393.779) [-390.380] (-390.635) (-390.746) -- 0:00:41
      347500 -- (-393.010) (-396.156) [-392.968] (-394.305) * [-391.531] (-389.959) (-392.644) (-392.389) -- 0:00:41
      348000 -- [-392.372] (-392.463) (-390.000) (-393.397) * [-390.293] (-390.194) (-390.957) (-390.085) -- 0:00:41
      348500 -- (-394.483) (-393.749) [-398.916] (-395.085) * (-392.670) [-389.911] (-392.899) (-391.517) -- 0:00:41
      349000 -- (-392.245) [-392.655] (-390.739) (-391.197) * (-390.585) [-392.183] (-397.366) (-393.472) -- 0:00:41
      349500 -- (-391.005) [-392.107] (-391.621) (-390.887) * (-390.939) [-392.584] (-391.439) (-395.478) -- 0:00:40
      350000 -- [-390.136] (-391.987) (-390.989) (-391.320) * (-390.922) (-391.334) (-391.326) [-391.140] -- 0:00:40

      Average standard deviation of split frequencies: 0.009858

      350500 -- [-390.622] (-390.578) (-390.118) (-395.362) * (-390.000) (-390.206) [-391.425] (-389.748) -- 0:00:40
      351000 -- (-393.955) [-391.195] (-393.271) (-397.374) * (-389.709) [-390.763] (-395.692) (-390.270) -- 0:00:40
      351500 -- (-391.018) [-390.027] (-391.231) (-391.496) * (-391.812) [-389.624] (-397.895) (-392.589) -- 0:00:40
      352000 -- (-392.362) (-390.242) [-391.645] (-390.772) * [-391.721] (-393.031) (-395.978) (-391.401) -- 0:00:40
      352500 -- (-394.419) (-392.576) [-392.558] (-389.052) * [-390.234] (-391.512) (-392.984) (-393.168) -- 0:00:40
      353000 -- (-392.516) (-394.425) (-392.862) [-392.006] * [-392.426] (-393.036) (-389.099) (-391.104) -- 0:00:40
      353500 -- [-390.258] (-396.382) (-390.762) (-390.293) * (-391.136) [-390.441] (-391.714) (-390.777) -- 0:00:40
      354000 -- (-391.030) (-393.408) (-391.960) [-389.052] * [-392.607] (-390.090) (-394.914) (-391.660) -- 0:00:40
      354500 -- (-389.811) (-393.123) (-393.244) [-392.516] * (-390.062) (-390.132) (-394.121) [-390.432] -- 0:00:40
      355000 -- (-389.331) [-390.499] (-390.481) (-395.793) * [-395.417] (-389.485) (-394.035) (-393.831) -- 0:00:39

      Average standard deviation of split frequencies: 0.008828

      355500 -- (-389.510) [-389.893] (-389.853) (-397.004) * (-389.747) (-392.597) (-391.981) [-391.573] -- 0:00:39
      356000 -- (-389.982) (-389.493) (-390.505) [-392.812] * [-391.388] (-391.252) (-391.632) (-392.044) -- 0:00:39
      356500 -- (-396.305) [-389.641] (-394.357) (-389.765) * (-390.023) (-398.096) [-390.619] (-392.328) -- 0:00:39
      357000 -- [-390.182] (-389.936) (-390.730) (-391.371) * [-390.209] (-390.633) (-390.160) (-391.538) -- 0:00:39
      357500 -- (-391.604) (-391.522) [-390.219] (-390.902) * (-390.149) (-389.659) [-390.375] (-390.274) -- 0:00:39
      358000 -- (-393.637) (-391.377) [-392.793] (-391.604) * (-392.072) (-392.187) [-391.109] (-391.134) -- 0:00:39
      358500 -- (-389.994) [-391.577] (-391.507) (-391.415) * (-393.452) (-391.697) [-392.530] (-392.337) -- 0:00:39
      359000 -- [-391.568] (-393.001) (-393.298) (-392.441) * [-390.899] (-391.006) (-394.531) (-394.643) -- 0:00:39
      359500 -- [-391.559] (-393.234) (-391.897) (-395.854) * (-390.300) [-391.295] (-393.139) (-391.483) -- 0:00:39
      360000 -- [-392.658] (-392.066) (-389.118) (-390.774) * (-390.763) [-391.332] (-389.278) (-393.355) -- 0:00:39

      Average standard deviation of split frequencies: 0.008786

      360500 -- (-390.129) [-392.636] (-389.895) (-392.049) * [-389.610] (-391.550) (-389.923) (-392.156) -- 0:00:39
      361000 -- (-389.608) [-392.392] (-392.752) (-397.297) * (-389.723) (-389.728) (-390.091) [-392.423] -- 0:00:40
      361500 -- (-391.549) (-393.444) [-391.674] (-392.943) * [-389.564] (-390.749) (-392.838) (-394.647) -- 0:00:40
      362000 -- [-390.436] (-391.310) (-390.861) (-393.047) * [-392.060] (-394.363) (-390.624) (-390.759) -- 0:00:40
      362500 -- (-390.469) [-391.281] (-391.310) (-391.740) * (-394.519) [-392.161] (-392.271) (-390.281) -- 0:00:40
      363000 -- [-392.998] (-394.333) (-392.443) (-391.445) * (-390.893) [-394.123] (-391.175) (-389.536) -- 0:00:40
      363500 -- (-393.314) (-391.826) (-396.576) [-389.816] * (-392.724) (-392.455) [-390.857] (-393.351) -- 0:00:40
      364000 -- (-392.109) (-390.674) [-392.574] (-391.564) * (-390.951) [-391.579] (-389.668) (-391.479) -- 0:00:40
      364500 -- [-391.007] (-390.448) (-390.300) (-390.623) * (-391.739) (-390.676) [-392.320] (-389.931) -- 0:00:40
      365000 -- (-391.215) (-390.268) [-390.837] (-393.273) * [-390.405] (-391.703) (-392.362) (-392.513) -- 0:00:40

      Average standard deviation of split frequencies: 0.009789

      365500 -- [-390.628] (-389.026) (-392.483) (-394.080) * (-392.366) (-392.264) (-391.880) [-389.899] -- 0:00:39
      366000 -- (-392.987) (-392.027) (-391.641) [-391.557] * (-391.956) (-390.079) (-390.238) [-393.113] -- 0:00:39
      366500 -- [-389.943] (-390.846) (-392.939) (-395.151) * (-391.132) (-391.240) [-396.717] (-392.253) -- 0:00:39
      367000 -- [-389.956] (-392.107) (-388.972) (-389.510) * [-395.100] (-390.141) (-391.757) (-393.693) -- 0:00:39
      367500 -- (-390.397) [-390.324] (-389.837) (-392.317) * (-395.278) (-390.090) (-391.562) [-390.859] -- 0:00:39
      368000 -- (-392.360) [-391.222] (-390.742) (-391.533) * (-394.924) [-390.914] (-393.302) (-392.354) -- 0:00:39
      368500 -- (-392.528) (-390.222) [-391.794] (-392.157) * (-390.181) (-393.219) (-390.501) [-392.706] -- 0:00:39
      369000 -- (-397.485) (-390.163) [-390.986] (-390.454) * (-391.367) (-394.045) [-391.715] (-390.847) -- 0:00:39
      369500 -- (-394.904) (-390.454) [-392.082] (-393.293) * [-391.966] (-390.590) (-390.665) (-393.785) -- 0:00:39
      370000 -- (-394.316) (-392.040) (-393.359) [-390.797] * [-390.916] (-392.037) (-390.775) (-395.320) -- 0:00:39

      Average standard deviation of split frequencies: 0.009639

      370500 -- (-392.906) (-391.235) (-392.442) [-391.086] * (-389.938) (-394.285) [-389.452] (-391.229) -- 0:00:39
      371000 -- [-390.481] (-391.776) (-390.197) (-391.146) * [-390.324] (-390.908) (-392.437) (-391.490) -- 0:00:38
      371500 -- [-390.452] (-394.243) (-395.663) (-390.880) * (-392.651) (-392.878) (-392.856) [-390.648] -- 0:00:38
      372000 -- (-390.325) [-390.425] (-391.276) (-390.324) * [-392.259] (-391.299) (-394.976) (-390.563) -- 0:00:38
      372500 -- (-390.863) (-389.803) (-390.535) [-391.451] * (-390.635) [-391.019] (-391.137) (-401.532) -- 0:00:38
      373000 -- (-389.768) [-390.744] (-395.236) (-389.785) * (-390.130) (-392.470) [-392.529] (-390.949) -- 0:00:38
      373500 -- (-392.173) (-390.479) (-390.538) [-392.320] * (-391.457) [-391.792] (-394.123) (-391.335) -- 0:00:38
      374000 -- (-391.311) [-391.392] (-389.292) (-393.091) * (-390.967) (-390.193) [-390.989] (-391.460) -- 0:00:38
      374500 -- (-391.478) [-390.069] (-392.664) (-389.944) * (-391.625) (-391.991) (-393.694) [-393.333] -- 0:00:38
      375000 -- (-393.019) (-392.775) [-390.506] (-391.462) * (-392.065) [-392.106] (-392.817) (-390.433) -- 0:00:38

      Average standard deviation of split frequencies: 0.009634

      375500 -- [-394.060] (-398.560) (-390.172) (-392.917) * [-390.626] (-391.518) (-395.075) (-389.696) -- 0:00:38
      376000 -- (-393.109) (-393.871) [-390.270] (-392.426) * (-390.179) (-394.271) [-394.428] (-390.868) -- 0:00:38
      376500 -- (-392.901) (-390.806) (-389.098) [-390.312] * [-391.257] (-389.736) (-397.833) (-392.496) -- 0:00:38
      377000 -- (-396.745) (-396.685) (-390.675) [-391.402] * (-395.407) [-392.455] (-398.800) (-392.885) -- 0:00:38
      377500 -- (-392.331) (-393.581) [-391.264] (-392.606) * (-390.785) (-390.556) (-394.409) [-389.623] -- 0:00:37
      378000 -- (-390.955) [-394.468] (-390.754) (-389.540) * (-391.107) [-391.805] (-390.252) (-391.770) -- 0:00:39
      378500 -- (-391.698) (-391.113) [-389.732] (-390.627) * [-392.277] (-390.390) (-392.679) (-392.007) -- 0:00:39
      379000 -- (-390.004) (-391.946) (-392.203) [-391.896] * [-390.117] (-392.770) (-395.024) (-390.807) -- 0:00:39
      379500 -- [-389.765] (-390.647) (-391.348) (-391.208) * (-395.952) (-391.108) [-391.292] (-390.870) -- 0:00:39
      380000 -- (-389.125) (-390.508) [-391.517] (-394.010) * [-392.553] (-389.984) (-392.129) (-390.629) -- 0:00:39

      Average standard deviation of split frequencies: 0.009972

      380500 -- (-390.643) (-393.636) [-394.232] (-394.910) * (-389.188) [-391.013] (-390.791) (-390.629) -- 0:00:39
      381000 -- (-389.245) (-391.987) [-393.244] (-393.893) * [-389.983] (-389.417) (-389.040) (-390.155) -- 0:00:38
      381500 -- (-395.849) (-390.553) (-390.357) [-394.073] * (-390.588) [-390.998] (-389.040) (-390.427) -- 0:00:38
      382000 -- (-392.396) (-390.689) (-389.403) [-397.940] * (-392.367) (-396.753) [-393.091] (-391.570) -- 0:00:38
      382500 -- (-392.121) (-390.234) (-389.436) [-390.473] * [-391.571] (-398.479) (-392.041) (-393.447) -- 0:00:38
      383000 -- (-392.874) (-390.254) (-392.130) [-389.563] * (-392.384) [-398.197] (-390.380) (-393.114) -- 0:00:38
      383500 -- (-392.378) (-390.245) (-389.788) [-390.309] * (-389.794) (-396.603) (-393.591) [-391.246] -- 0:00:38
      384000 -- (-396.784) [-391.887] (-391.895) (-394.890) * (-389.491) [-390.995] (-394.031) (-396.634) -- 0:00:38
      384500 -- [-389.481] (-390.171) (-390.136) (-393.333) * (-389.876) (-391.206) (-395.047) [-394.119] -- 0:00:38
      385000 -- [-396.321] (-389.602) (-391.606) (-394.802) * (-392.052) (-393.664) (-392.481) [-390.564] -- 0:00:38

      Average standard deviation of split frequencies: 0.010284

      385500 -- (-399.169) (-393.217) [-391.397] (-390.161) * (-389.728) [-391.127] (-390.168) (-391.756) -- 0:00:38
      386000 -- (-395.410) (-390.692) (-392.657) [-391.352] * (-389.900) (-391.844) [-391.290] (-394.349) -- 0:00:38
      386500 -- (-393.079) (-392.102) (-392.779) [-395.945] * [-390.545] (-392.126) (-390.640) (-394.485) -- 0:00:38
      387000 -- [-391.904] (-390.380) (-391.511) (-392.619) * [-392.193] (-394.437) (-391.284) (-391.013) -- 0:00:38
      387500 -- (-391.912) [-389.415] (-392.486) (-391.732) * (-390.198) (-394.406) [-392.727] (-390.394) -- 0:00:37
      388000 -- (-393.390) [-389.892] (-392.768) (-392.025) * (-392.448) [-390.746] (-391.107) (-396.238) -- 0:00:37
      388500 -- (-392.117) [-390.416] (-390.123) (-395.216) * (-390.765) (-393.352) (-390.819) [-393.185] -- 0:00:37
      389000 -- (-390.622) [-390.564] (-391.032) (-392.984) * (-392.143) (-391.749) [-391.490] (-390.576) -- 0:00:37
      389500 -- [-391.812] (-390.690) (-393.984) (-397.256) * [-391.626] (-390.600) (-392.839) (-391.834) -- 0:00:37
      390000 -- (-393.330) [-390.089] (-394.015) (-394.019) * [-389.447] (-392.025) (-392.500) (-392.022) -- 0:00:37

      Average standard deviation of split frequencies: 0.009586

      390500 -- [-390.444] (-390.579) (-393.817) (-390.908) * (-390.535) (-397.471) (-394.770) [-390.272] -- 0:00:37
      391000 -- (-391.128) (-391.366) (-390.358) [-392.364] * [-392.851] (-389.886) (-392.639) (-390.497) -- 0:00:37
      391500 -- (-392.630) [-391.410] (-391.242) (-395.815) * [-389.693] (-391.602) (-390.093) (-390.982) -- 0:00:37
      392000 -- [-390.105] (-391.029) (-391.459) (-394.943) * [-394.404] (-394.621) (-390.467) (-390.252) -- 0:00:37
      392500 -- (-390.726) [-392.783] (-390.047) (-397.836) * (-391.242) (-390.383) [-392.601] (-392.171) -- 0:00:37
      393000 -- (-390.656) (-395.534) (-390.913) [-397.999] * [-393.557] (-391.070) (-390.343) (-390.044) -- 0:00:37
      393500 -- (-391.207) [-390.168] (-395.294) (-391.479) * (-391.333) [-390.195] (-389.793) (-391.858) -- 0:00:36
      394000 -- [-391.958] (-389.294) (-393.651) (-393.315) * (-390.137) (-389.858) [-391.115] (-394.375) -- 0:00:36
      394500 -- (-392.908) (-390.910) [-392.486] (-393.681) * (-390.715) (-389.352) (-392.491) [-397.998] -- 0:00:36
      395000 -- (-392.454) [-390.055] (-389.449) (-393.224) * (-392.645) (-389.247) (-392.496) [-394.635] -- 0:00:36

      Average standard deviation of split frequencies: 0.010383

      395500 -- (-394.418) (-390.790) [-391.467] (-390.982) * (-391.494) [-390.374] (-389.749) (-390.212) -- 0:00:38
      396000 -- [-395.495] (-391.071) (-392.691) (-391.098) * (-392.592) (-389.687) [-390.193] (-389.624) -- 0:00:38
      396500 -- (-392.063) [-391.748] (-396.093) (-389.896) * [-392.215] (-392.213) (-391.378) (-391.604) -- 0:00:38
      397000 -- [-391.164] (-393.343) (-391.499) (-391.648) * (-392.604) (-390.103) (-392.258) [-390.844] -- 0:00:37
      397500 -- (-390.848) (-393.393) [-396.006] (-390.108) * [-391.876] (-391.495) (-389.930) (-389.246) -- 0:00:37
      398000 -- (-390.759) (-391.998) (-391.037) [-390.862] * (-392.176) [-391.927] (-393.536) (-391.067) -- 0:00:37
      398500 -- [-392.434] (-391.071) (-391.155) (-393.420) * (-393.775) (-391.373) (-389.088) [-393.404] -- 0:00:37
      399000 -- (-392.142) (-389.038) (-393.066) [-389.841] * (-394.959) (-393.079) [-393.548] (-390.058) -- 0:00:37
      399500 -- (-392.489) (-390.666) [-393.162] (-389.483) * (-390.158) (-391.357) [-389.257] (-391.736) -- 0:00:37
      400000 -- (-394.726) (-390.018) [-389.164] (-395.068) * (-390.815) (-391.386) [-390.665] (-391.032) -- 0:00:37

      Average standard deviation of split frequencies: 0.010393

      400500 -- (-390.881) (-391.063) [-391.492] (-391.222) * [-391.021] (-392.102) (-390.514) (-395.040) -- 0:00:37
      401000 -- (-389.413) (-390.584) [-392.012] (-393.533) * (-394.307) (-392.081) (-390.543) [-392.669] -- 0:00:37
      401500 -- [-394.190] (-396.461) (-395.364) (-390.218) * [-391.583] (-391.229) (-391.121) (-391.496) -- 0:00:37
      402000 -- (-389.692) (-391.624) [-395.825] (-395.127) * (-391.171) [-391.513] (-389.266) (-390.740) -- 0:00:37
      402500 -- (-393.669) (-390.578) [-395.583] (-394.715) * [-390.863] (-390.943) (-390.342) (-391.084) -- 0:00:37
      403000 -- [-392.509] (-390.183) (-393.204) (-394.840) * (-394.266) (-393.263) [-392.608] (-392.383) -- 0:00:37
      403500 -- [-391.107] (-389.053) (-391.587) (-390.437) * [-390.117] (-391.319) (-390.606) (-389.431) -- 0:00:36
      404000 -- (-392.484) (-390.904) [-391.224] (-391.339) * (-390.617) (-390.195) (-392.259) [-391.958] -- 0:00:36
      404500 -- (-390.484) (-390.198) (-395.042) [-392.029] * (-389.323) [-391.503] (-391.969) (-393.880) -- 0:00:36
      405000 -- (-390.902) (-392.941) (-389.716) [-392.240] * (-395.351) (-390.307) (-393.986) [-391.084] -- 0:00:36

      Average standard deviation of split frequencies: 0.010256

      405500 -- [-389.789] (-392.954) (-393.283) (-397.318) * (-392.260) (-393.232) (-393.796) [-395.044] -- 0:00:36
      406000 -- [-390.051] (-390.931) (-391.773) (-390.296) * [-392.637] (-390.496) (-390.881) (-390.020) -- 0:00:36
      406500 -- (-389.636) [-390.287] (-392.590) (-391.887) * (-390.718) (-395.833) (-390.604) [-392.602] -- 0:00:36
      407000 -- (-391.322) [-389.264] (-390.750) (-393.456) * (-392.368) (-391.468) (-393.220) [-391.525] -- 0:00:36
      407500 -- (-390.623) (-390.179) [-389.496] (-390.988) * (-393.042) (-394.688) [-391.789] (-391.216) -- 0:00:36
      408000 -- (-390.965) [-393.509] (-390.633) (-389.649) * (-392.821) [-390.251] (-391.460) (-392.042) -- 0:00:36
      408500 -- [-390.317] (-392.216) (-392.410) (-390.351) * (-391.131) (-393.502) (-389.488) [-390.957] -- 0:00:36
      409000 -- (-394.303) (-390.734) (-389.661) [-392.939] * (-391.375) (-390.219) [-393.944] (-391.564) -- 0:00:36
      409500 -- [-391.912] (-394.124) (-392.961) (-389.848) * [-389.272] (-390.514) (-394.510) (-392.086) -- 0:00:36
      410000 -- (-391.574) (-391.080) [-394.236] (-389.946) * (-389.466) (-391.943) [-391.761] (-390.874) -- 0:00:35

      Average standard deviation of split frequencies: 0.010331

      410500 -- (-398.120) [-398.958] (-394.399) (-390.488) * [-390.374] (-390.531) (-391.945) (-391.503) -- 0:00:35
      411000 -- (-396.123) (-392.125) (-393.706) [-391.188] * [-393.139] (-391.093) (-391.558) (-391.455) -- 0:00:35
      411500 -- (-393.331) [-389.277] (-392.055) (-390.483) * (-392.774) (-390.674) [-391.100] (-389.869) -- 0:00:37
      412000 -- (-392.262) (-392.291) [-390.741] (-391.154) * (-394.834) (-393.403) [-390.770] (-393.044) -- 0:00:37
      412500 -- (-391.519) (-390.989) (-395.176) [-391.194] * (-392.815) [-393.663] (-390.506) (-390.986) -- 0:00:37
      413000 -- (-391.719) [-390.200] (-390.324) (-391.713) * (-391.995) (-390.785) [-392.050] (-390.464) -- 0:00:36
      413500 -- (-390.733) [-390.872] (-390.616) (-392.818) * (-391.407) (-390.088) (-390.183) [-389.999] -- 0:00:36
      414000 -- (-393.559) [-392.136] (-393.324) (-393.009) * (-393.745) (-389.772) [-391.743] (-389.647) -- 0:00:36
      414500 -- (-393.100) (-390.728) (-393.949) [-394.114] * (-393.339) (-392.332) (-391.049) [-390.989] -- 0:00:36
      415000 -- (-393.807) (-390.402) (-390.741) [-390.356] * (-389.622) (-390.496) [-390.968] (-392.679) -- 0:00:36

      Average standard deviation of split frequencies: 0.010325

      415500 -- [-391.707] (-392.555) (-390.817) (-392.234) * (-394.529) [-390.333] (-391.466) (-392.896) -- 0:00:36
      416000 -- (-390.412) (-390.038) (-390.156) [-394.542] * (-396.573) (-390.834) (-391.582) [-391.088] -- 0:00:36
      416500 -- (-389.399) [-390.312] (-389.550) (-393.644) * (-394.832) (-390.190) (-391.856) [-391.594] -- 0:00:36
      417000 -- (-392.006) [-392.108] (-394.482) (-392.140) * (-390.871) (-390.153) [-390.834] (-392.642) -- 0:00:36
      417500 -- [-391.338] (-391.905) (-398.089) (-391.663) * (-390.009) (-393.483) (-389.558) [-390.915] -- 0:00:36
      418000 -- (-391.269) [-394.070] (-395.308) (-392.017) * (-395.449) [-389.924] (-391.712) (-391.490) -- 0:00:36
      418500 -- (-389.922) (-391.651) [-392.525] (-391.105) * [-392.673] (-390.745) (-390.697) (-390.270) -- 0:00:36
      419000 -- (-390.761) (-392.919) (-392.055) [-392.031] * (-391.424) (-391.039) [-390.653] (-390.458) -- 0:00:36
      419500 -- (-394.773) [-391.966] (-395.928) (-392.071) * (-392.000) (-390.216) (-390.931) [-391.444] -- 0:00:35
      420000 -- (-392.134) (-392.125) [-395.843] (-395.714) * (-395.621) (-389.529) (-392.302) [-389.902] -- 0:00:35

      Average standard deviation of split frequencies: 0.010397

      420500 -- (-392.701) (-394.714) (-398.605) [-390.724] * [-392.520] (-389.988) (-390.200) (-390.679) -- 0:00:35
      421000 -- (-393.414) (-392.331) (-391.397) [-391.368] * (-394.914) (-389.032) [-389.895] (-390.072) -- 0:00:35
      421500 -- (-391.705) (-391.125) (-391.151) [-391.460] * (-390.268) [-390.358] (-389.897) (-390.698) -- 0:00:35
      422000 -- (-394.794) (-391.391) [-391.551] (-391.465) * (-392.114) (-391.678) [-390.917] (-389.419) -- 0:00:35
      422500 -- (-393.013) [-390.740] (-390.460) (-392.862) * [-390.833] (-390.019) (-395.257) (-392.935) -- 0:00:35
      423000 -- (-389.402) (-391.936) [-389.268] (-395.962) * (-394.450) (-391.974) (-389.963) [-392.076] -- 0:00:35
      423500 -- (-391.685) (-392.314) (-389.710) [-393.617] * [-392.754] (-391.445) (-392.028) (-390.663) -- 0:00:35
      424000 -- (-392.525) (-393.086) [-390.172] (-392.337) * (-392.255) (-392.406) (-392.384) [-389.625] -- 0:00:35
      424500 -- (-391.881) (-390.524) [-389.656] (-391.538) * (-391.386) (-393.391) [-393.132] (-397.257) -- 0:00:35
      425000 -- (-391.943) [-390.270] (-392.950) (-391.198) * (-390.256) [-391.249] (-391.612) (-391.799) -- 0:00:35

      Average standard deviation of split frequencies: 0.010250

      425500 -- [-392.159] (-390.466) (-392.880) (-391.438) * [-389.275] (-394.641) (-390.700) (-390.860) -- 0:00:35
      426000 -- (-392.329) [-392.207] (-399.709) (-390.343) * (-393.226) (-389.571) [-391.293] (-390.258) -- 0:00:35
      426500 -- (-399.729) [-391.597] (-395.715) (-392.072) * (-391.594) (-389.697) (-389.836) [-395.714] -- 0:00:34
      427000 -- [-392.693] (-401.784) (-391.084) (-390.420) * (-393.883) (-389.418) [-390.387] (-399.869) -- 0:00:34
      427500 -- (-391.364) [-389.628] (-390.208) (-396.867) * (-393.437) [-390.284] (-390.929) (-395.115) -- 0:00:34
      428000 -- [-391.462] (-391.072) (-389.083) (-391.708) * [-391.445] (-392.992) (-390.225) (-395.176) -- 0:00:34
      428500 -- (-391.352) [-390.069] (-390.895) (-390.616) * (-392.319) (-388.944) [-391.820] (-392.037) -- 0:00:34
      429000 -- (-393.934) (-390.381) [-390.876] (-392.687) * (-394.548) (-394.591) [-390.764] (-389.425) -- 0:00:35
      429500 -- (-391.362) [-390.774] (-394.179) (-392.972) * (-390.386) [-391.309] (-391.589) (-390.463) -- 0:00:35
      430000 -- (-391.910) [-389.169] (-391.866) (-391.222) * (-396.190) (-389.402) (-389.838) [-390.607] -- 0:00:35

      Average standard deviation of split frequencies: 0.010459

      430500 -- (-390.830) (-392.691) (-391.799) [-394.081] * (-392.420) [-391.536] (-390.735) (-389.611) -- 0:00:35
      431000 -- (-391.650) (-393.524) [-393.068] (-391.478) * (-391.581) (-390.335) (-390.640) [-389.192] -- 0:00:35
      431500 -- (-389.746) (-391.897) [-393.335] (-393.128) * (-390.079) [-389.499] (-390.982) (-389.806) -- 0:00:35
      432000 -- (-391.617) [-391.320] (-392.065) (-393.541) * [-390.329] (-392.026) (-394.784) (-394.231) -- 0:00:35
      432500 -- [-393.822] (-392.338) (-396.296) (-394.989) * [-394.453] (-391.937) (-397.685) (-392.721) -- 0:00:35
      433000 -- (-390.556) (-392.063) (-391.284) [-392.082] * (-394.395) [-389.905] (-394.849) (-390.125) -- 0:00:35
      433500 -- [-389.938] (-391.327) (-391.229) (-391.077) * (-392.403) [-390.625] (-395.985) (-391.747) -- 0:00:35
      434000 -- (-391.428) [-390.475] (-391.491) (-390.630) * (-390.952) (-389.781) (-392.437) [-389.936] -- 0:00:35
      434500 -- (-390.927) (-392.597) [-394.758] (-390.601) * [-393.465] (-391.907) (-391.180) (-394.588) -- 0:00:35
      435000 -- (-391.567) (-392.015) [-390.480] (-393.471) * [-390.620] (-390.702) (-392.674) (-395.295) -- 0:00:35

      Average standard deviation of split frequencies: 0.010692

      435500 -- (-391.563) [-389.942] (-390.413) (-389.679) * (-389.860) (-389.165) [-389.854] (-392.179) -- 0:00:34
      436000 -- (-389.169) [-394.076] (-389.507) (-390.719) * (-390.572) (-389.799) [-389.818] (-389.970) -- 0:00:34
      436500 -- [-390.580] (-391.183) (-389.069) (-405.241) * [-391.859] (-390.122) (-389.408) (-389.920) -- 0:00:34
      437000 -- [-391.829] (-391.547) (-389.761) (-392.200) * (-392.909) (-390.856) [-390.391] (-392.483) -- 0:00:34
      437500 -- (-391.614) (-393.349) [-389.134] (-392.678) * (-389.707) [-390.417] (-389.354) (-395.006) -- 0:00:34
      438000 -- (-392.709) (-392.392) [-389.476] (-392.121) * (-391.990) [-389.265] (-391.891) (-391.341) -- 0:00:34
      438500 -- (-392.810) (-389.822) (-391.727) [-389.451] * (-395.958) (-390.652) [-390.948] (-390.730) -- 0:00:34
      439000 -- [-393.845] (-391.604) (-390.471) (-391.775) * (-399.365) [-390.485] (-391.244) (-392.248) -- 0:00:34
      439500 -- (-391.486) (-390.596) [-392.182] (-395.058) * (-399.620) (-389.996) [-392.257] (-392.677) -- 0:00:34
      440000 -- (-390.673) (-390.021) [-389.472] (-394.283) * (-393.369) (-395.240) (-389.354) [-390.740] -- 0:00:34

      Average standard deviation of split frequencies: 0.010096

      440500 -- (-392.546) (-390.702) [-389.716] (-392.222) * (-390.287) (-393.995) [-391.951] (-396.808) -- 0:00:34
      441000 -- (-389.794) (-393.726) [-389.514] (-389.089) * (-391.769) (-391.108) [-390.684] (-391.213) -- 0:00:34
      441500 -- (-394.470) (-391.853) (-389.345) [-391.026] * [-392.938] (-393.324) (-390.260) (-399.220) -- 0:00:34
      442000 -- (-389.461) (-394.358) [-389.432] (-392.179) * (-394.963) [-390.189] (-393.000) (-392.577) -- 0:00:34
      442500 -- (-391.737) (-390.164) (-389.414) [-390.290] * (-389.850) (-392.111) (-389.842) [-391.155] -- 0:00:34
      443000 -- (-389.963) (-390.086) (-395.003) [-392.148] * (-390.113) (-389.651) (-391.714) [-391.973] -- 0:00:33
      443500 -- (-389.617) [-389.460] (-389.847) (-392.286) * (-390.551) (-392.953) [-392.402] (-391.064) -- 0:00:33
      444000 -- (-389.539) (-389.327) (-390.624) [-390.278] * (-390.519) (-390.678) [-390.978] (-389.726) -- 0:00:33
      444500 -- [-392.507] (-390.762) (-391.599) (-389.910) * (-389.863) (-389.066) (-392.959) [-392.557] -- 0:00:33
      445000 -- [-389.930] (-390.063) (-391.942) (-391.519) * (-389.756) [-389.958] (-394.990) (-389.858) -- 0:00:33

      Average standard deviation of split frequencies: 0.010966

      445500 -- (-390.486) (-394.501) [-392.054] (-391.837) * (-390.424) (-391.035) (-391.506) [-390.246] -- 0:00:34
      446000 -- (-394.672) [-391.433] (-389.961) (-392.277) * (-394.819) [-390.555] (-391.910) (-389.399) -- 0:00:34
      446500 -- (-391.672) [-391.113] (-390.416) (-391.476) * (-391.672) (-393.031) (-392.341) [-390.352] -- 0:00:34
      447000 -- [-392.980] (-392.604) (-390.531) (-390.540) * (-392.411) [-389.875] (-394.405) (-390.771) -- 0:00:34
      447500 -- (-392.790) (-391.487) (-389.807) [-393.034] * [-391.842] (-392.615) (-393.146) (-392.009) -- 0:00:34
      448000 -- (-391.579) (-390.440) (-390.277) [-394.513] * [-390.607] (-390.120) (-390.528) (-393.444) -- 0:00:34
      448500 -- (-392.614) (-390.391) [-389.970] (-391.769) * (-392.690) (-390.826) (-390.465) [-393.163] -- 0:00:34
      449000 -- (-390.327) (-393.212) (-393.818) [-391.325] * (-391.361) (-390.643) (-391.487) [-390.998] -- 0:00:34
      449500 -- (-390.853) [-390.570] (-391.541) (-391.018) * (-391.250) (-390.391) [-390.330] (-389.992) -- 0:00:34
      450000 -- (-393.679) (-389.402) (-390.387) [-390.323] * (-390.428) [-389.359] (-389.442) (-390.977) -- 0:00:34

      Average standard deviation of split frequencies: 0.010983

      450500 -- [-395.397] (-391.356) (-390.769) (-391.352) * (-390.869) (-389.709) [-389.826] (-392.579) -- 0:00:34
      451000 -- (-393.266) (-390.796) (-389.513) [-393.476] * [-390.365] (-392.589) (-389.203) (-394.786) -- 0:00:34
      451500 -- (-390.322) (-391.502) [-393.270] (-396.089) * (-392.911) (-391.118) (-389.413) [-389.626] -- 0:00:34
      452000 -- (-396.053) (-394.282) [-392.901] (-394.066) * (-390.208) (-390.800) (-390.262) [-389.891] -- 0:00:33
      452500 -- [-390.423] (-390.384) (-394.633) (-392.498) * [-396.067] (-390.658) (-391.109) (-390.357) -- 0:00:33
      453000 -- [-393.825] (-391.679) (-390.053) (-390.693) * (-390.656) (-393.288) (-390.938) [-390.516] -- 0:00:33
      453500 -- (-391.914) [-391.135] (-393.086) (-392.313) * [-392.146] (-391.203) (-392.116) (-391.550) -- 0:00:33
      454000 -- (-399.594) (-391.935) (-391.832) [-392.753] * (-395.651) [-393.068] (-389.845) (-394.336) -- 0:00:33
      454500 -- (-392.390) [-394.853] (-389.617) (-392.129) * (-390.465) (-392.949) [-390.438] (-391.394) -- 0:00:33
      455000 -- (-391.644) [-391.602] (-389.629) (-389.746) * (-391.270) (-392.219) [-390.178] (-391.595) -- 0:00:33

      Average standard deviation of split frequencies: 0.010855

      455500 -- (-389.454) (-393.080) (-390.625) [-390.649] * [-390.447] (-392.824) (-389.281) (-391.622) -- 0:00:33
      456000 -- [-391.855] (-390.095) (-394.163) (-390.804) * [-390.004] (-389.083) (-389.017) (-394.238) -- 0:00:33
      456500 -- (-391.658) [-392.229] (-394.904) (-390.609) * (-391.197) [-391.481] (-390.160) (-393.526) -- 0:00:33
      457000 -- [-390.435] (-393.940) (-394.076) (-390.187) * (-390.297) [-389.529] (-390.622) (-390.477) -- 0:00:33
      457500 -- [-391.635] (-392.727) (-389.197) (-390.184) * (-389.516) (-393.977) (-393.783) [-389.389] -- 0:00:33
      458000 -- (-390.173) (-390.983) [-390.601] (-391.139) * (-393.996) (-390.336) (-394.952) [-391.421] -- 0:00:33
      458500 -- (-392.290) (-395.888) (-397.330) [-390.283] * (-393.093) (-392.020) [-397.283] (-391.443) -- 0:00:33
      459000 -- (-391.755) [-390.495] (-393.710) (-390.749) * (-391.921) [-389.563] (-390.425) (-390.522) -- 0:00:33
      459500 -- (-394.936) (-389.875) [-395.699] (-390.892) * [-391.836] (-390.721) (-393.093) (-391.009) -- 0:00:32
      460000 -- [-393.959] (-390.939) (-389.791) (-391.829) * (-391.472) (-390.146) (-392.683) [-391.090] -- 0:00:32

      Average standard deviation of split frequencies: 0.009274

      460500 -- (-393.289) (-391.468) [-391.001] (-393.414) * (-392.400) (-392.972) [-394.358] (-392.272) -- 0:00:32
      461000 -- (-391.173) (-391.876) [-391.901] (-395.646) * [-395.323] (-393.751) (-392.466) (-391.906) -- 0:00:32
      461500 -- (-395.217) [-392.792] (-390.638) (-390.776) * (-395.462) [-389.379] (-390.611) (-392.950) -- 0:00:32
      462000 -- (-390.623) (-396.195) [-390.285] (-393.937) * [-393.772] (-392.522) (-391.698) (-394.765) -- 0:00:32
      462500 -- [-393.095] (-389.058) (-389.289) (-393.492) * [-390.299] (-389.796) (-389.979) (-391.085) -- 0:00:33
      463000 -- [-392.408] (-391.167) (-390.734) (-393.218) * (-390.796) (-389.825) [-390.212] (-391.295) -- 0:00:33
      463500 -- (-393.604) (-391.533) [-393.138] (-392.115) * (-391.387) [-391.562] (-393.937) (-393.380) -- 0:00:33
      464000 -- (-390.251) (-390.506) [-392.012] (-395.564) * (-390.716) (-391.953) [-391.013] (-390.959) -- 0:00:33
      464500 -- (-400.831) [-393.722] (-391.235) (-392.676) * [-389.691] (-390.026) (-392.444) (-390.445) -- 0:00:33
      465000 -- (-394.412) (-394.053) (-391.861) [-390.250] * (-391.717) [-391.887] (-389.911) (-390.706) -- 0:00:33

      Average standard deviation of split frequencies: 0.009818

      465500 -- (-397.129) (-391.599) (-391.169) [-389.943] * (-392.161) (-391.349) (-390.832) [-391.267] -- 0:00:33
      466000 -- [-392.224] (-390.909) (-389.451) (-390.338) * [-391.376] (-395.868) (-390.745) (-390.900) -- 0:00:33
      466500 -- [-391.197] (-391.184) (-389.693) (-394.813) * [-389.448] (-398.974) (-393.661) (-391.564) -- 0:00:33
      467000 -- (-392.288) (-390.629) [-391.164] (-390.780) * (-390.260) (-393.562) [-391.300] (-390.959) -- 0:00:33
      467500 -- (-393.798) [-390.836] (-390.381) (-393.429) * (-393.954) (-389.728) [-389.612] (-389.874) -- 0:00:33
      468000 -- (-390.149) [-391.606] (-393.416) (-392.560) * (-390.842) (-389.918) (-390.314) [-390.198] -- 0:00:32
      468500 -- (-389.085) [-391.349] (-393.802) (-390.085) * [-393.029] (-392.841) (-390.976) (-390.074) -- 0:00:32
      469000 -- (-389.927) (-390.873) (-389.338) [-392.391] * (-392.313) [-389.511] (-391.111) (-394.915) -- 0:00:32
      469500 -- (-391.521) (-389.842) [-392.589] (-391.413) * (-392.224) (-393.604) (-390.848) [-391.031] -- 0:00:32
      470000 -- (-392.464) (-390.631) [-393.467] (-390.327) * (-391.778) (-391.213) (-389.696) [-391.915] -- 0:00:32

      Average standard deviation of split frequencies: 0.009485

      470500 -- (-391.323) [-391.488] (-392.171) (-391.813) * (-389.450) (-393.983) (-390.740) [-389.692] -- 0:00:32
      471000 -- (-396.841) [-394.927] (-390.720) (-392.200) * (-390.047) (-391.150) [-391.007] (-389.695) -- 0:00:32
      471500 -- (-395.344) (-392.750) (-393.136) [-392.661] * [-389.219] (-392.070) (-390.213) (-391.955) -- 0:00:32
      472000 -- [-393.938] (-392.219) (-390.095) (-391.233) * [-389.552] (-392.774) (-391.486) (-390.826) -- 0:00:32
      472500 -- (-396.979) [-395.084] (-393.721) (-392.458) * (-390.938) [-392.184] (-392.034) (-390.866) -- 0:00:32
      473000 -- (-393.006) (-389.699) [-390.547] (-390.111) * (-391.027) (-393.912) [-390.056] (-392.186) -- 0:00:32
      473500 -- [-390.855] (-393.748) (-390.526) (-390.470) * (-389.792) [-395.185] (-390.555) (-393.770) -- 0:00:32
      474000 -- (-389.631) [-390.491] (-395.453) (-390.689) * (-389.266) (-394.155) (-392.199) [-391.359] -- 0:00:32
      474500 -- (-392.405) [-392.535] (-393.935) (-392.790) * (-393.765) (-390.303) [-389.969] (-391.630) -- 0:00:32
      475000 -- [-395.546] (-391.311) (-393.532) (-393.176) * (-392.959) (-391.093) (-394.055) [-389.470] -- 0:00:32

      Average standard deviation of split frequencies: 0.009670

      475500 -- (-393.596) (-390.569) [-391.876] (-391.144) * (-389.704) (-389.689) [-392.025] (-389.965) -- 0:00:31
      476000 -- (-391.692) [-391.860] (-393.252) (-390.784) * [-391.052] (-390.106) (-393.883) (-391.247) -- 0:00:31
      476500 -- [-390.909] (-391.549) (-389.958) (-390.436) * [-392.468] (-391.212) (-392.232) (-391.655) -- 0:00:31
      477000 -- [-391.551] (-389.844) (-391.274) (-390.728) * (-392.352) (-391.747) [-391.115] (-390.974) -- 0:00:31
      477500 -- (-390.201) [-390.651] (-390.554) (-390.453) * (-389.742) (-392.594) (-397.464) [-392.437] -- 0:00:31
      478000 -- (-393.063) (-391.286) (-390.534) [-391.421] * (-390.252) (-389.738) [-390.315] (-390.976) -- 0:00:31
      478500 -- (-392.014) (-393.599) (-390.844) [-389.479] * (-389.819) (-395.546) (-391.729) [-393.434] -- 0:00:31
      479000 -- (-392.192) (-393.261) (-393.475) [-391.701] * (-392.303) [-391.700] (-389.512) (-391.827) -- 0:00:31
      479500 -- (-391.202) [-392.938] (-389.445) (-391.148) * (-389.715) (-389.667) (-390.997) [-393.420] -- 0:00:32
      480000 -- (-390.682) (-394.171) [-390.517] (-393.076) * (-390.215) (-397.994) [-391.327] (-394.373) -- 0:00:32

      Average standard deviation of split frequencies: 0.009862

      480500 -- (-391.418) (-390.067) [-393.936] (-389.748) * (-390.576) [-391.620] (-389.950) (-392.056) -- 0:00:32
      481000 -- (-392.196) (-391.859) (-394.967) [-389.163] * (-393.342) (-389.611) [-389.431] (-393.700) -- 0:00:32
      481500 -- [-391.065] (-392.601) (-390.919) (-390.980) * (-392.646) (-390.033) [-389.912] (-390.172) -- 0:00:32
      482000 -- [-390.526] (-392.960) (-391.167) (-390.998) * (-393.161) (-391.523) (-393.040) [-392.279] -- 0:00:32
      482500 -- [-391.480] (-389.829) (-391.716) (-392.112) * [-391.538] (-392.536) (-390.742) (-394.298) -- 0:00:32
      483000 -- (-392.128) (-391.363) [-389.594] (-392.226) * (-389.202) (-391.847) [-389.607] (-397.179) -- 0:00:32
      483500 -- (-390.772) (-391.568) (-391.853) [-390.629] * (-390.420) (-392.919) (-390.768) [-393.166] -- 0:00:32
      484000 -- (-392.370) (-389.708) [-394.648] (-391.088) * (-392.402) (-390.478) [-392.387] (-391.969) -- 0:00:31
      484500 -- [-393.064] (-391.729) (-391.378) (-390.245) * (-393.285) (-394.605) (-392.956) [-394.162] -- 0:00:31
      485000 -- (-390.850) [-389.868] (-390.671) (-392.661) * [-391.090] (-393.914) (-390.720) (-392.694) -- 0:00:31

      Average standard deviation of split frequencies: 0.008945

      485500 -- (-390.040) (-391.292) (-389.914) [-393.581] * (-390.977) (-392.415) (-391.198) [-394.089] -- 0:00:31
      486000 -- [-390.031] (-392.146) (-397.087) (-389.743) * (-391.690) (-392.235) [-392.351] (-394.254) -- 0:00:31
      486500 -- (-390.022) (-394.870) (-398.538) [-389.797] * (-393.689) (-394.311) [-392.909] (-391.414) -- 0:00:31
      487000 -- [-390.066] (-392.150) (-391.970) (-389.444) * (-389.995) [-391.685] (-389.297) (-389.328) -- 0:00:31
      487500 -- [-389.968] (-392.907) (-390.752) (-391.978) * (-389.802) (-390.846) (-389.409) [-389.663] -- 0:00:31
      488000 -- (-390.651) [-391.062] (-389.743) (-391.584) * (-393.026) (-392.174) [-393.768] (-392.523) -- 0:00:31
      488500 -- (-390.215) [-390.628] (-389.606) (-392.494) * (-390.550) (-392.055) [-390.545] (-393.184) -- 0:00:31
      489000 -- (-395.119) (-391.460) (-391.669) [-390.280] * (-389.553) [-391.136] (-391.578) (-391.994) -- 0:00:31
      489500 -- (-394.659) (-391.815) (-392.059) [-393.244] * (-390.676) (-394.448) [-390.683] (-392.696) -- 0:00:31
      490000 -- [-391.135] (-393.910) (-390.408) (-392.562) * (-391.017) (-392.371) (-391.527) [-389.264] -- 0:00:31

      Average standard deviation of split frequencies: 0.009607

      490500 -- (-394.610) [-389.630] (-391.025) (-394.443) * (-395.289) (-390.444) (-391.262) [-391.708] -- 0:00:31
      491000 -- (-394.287) (-392.262) [-391.858] (-392.721) * (-398.711) (-390.779) (-391.485) [-390.584] -- 0:00:31
      491500 -- (-393.645) (-397.133) (-398.749) [-390.743] * (-392.581) (-394.834) [-391.801] (-393.960) -- 0:00:31
      492000 -- [-391.283] (-392.203) (-392.426) (-391.345) * (-392.716) [-391.339] (-392.953) (-395.285) -- 0:00:30
      492500 -- (-390.847) (-390.725) [-391.721] (-391.769) * (-392.447) (-391.674) [-389.610] (-392.046) -- 0:00:30
      493000 -- (-395.242) [-389.955] (-390.419) (-391.156) * (-395.916) (-390.757) [-390.636] (-395.570) -- 0:00:30
      493500 -- (-394.029) (-389.424) (-391.163) [-390.762] * [-394.694] (-395.544) (-394.157) (-397.130) -- 0:00:30
      494000 -- (-390.824) (-393.097) (-391.624) [-391.794] * [-389.624] (-391.126) (-391.755) (-392.072) -- 0:00:30
      494500 -- (-393.474) (-391.647) [-389.464] (-389.736) * (-396.124) [-390.638] (-392.155) (-393.415) -- 0:00:30
      495000 -- [-389.098] (-390.728) (-390.242) (-392.700) * [-390.933] (-392.797) (-389.630) (-391.666) -- 0:00:30

      Average standard deviation of split frequencies: 0.009399

      495500 -- (-389.753) (-390.887) (-392.042) [-391.175] * [-392.132] (-392.027) (-392.547) (-391.301) -- 0:00:30
      496000 -- (-390.358) [-392.554] (-390.844) (-390.008) * (-391.187) (-393.988) (-391.360) [-390.740] -- 0:00:30
      496500 -- (-390.430) (-390.831) [-391.108] (-391.438) * (-391.878) [-390.311] (-396.807) (-391.899) -- 0:00:30
      497000 -- (-391.041) [-389.936] (-393.310) (-391.227) * (-393.048) (-394.034) (-391.977) [-389.843] -- 0:00:31
      497500 -- (-396.378) (-390.108) [-396.757] (-389.802) * (-393.493) (-393.423) (-391.622) [-396.217] -- 0:00:31
      498000 -- (-398.396) (-389.443) [-391.102] (-389.527) * (-391.997) (-390.767) [-390.431] (-396.420) -- 0:00:31
      498500 -- [-389.968] (-393.703) (-391.460) (-393.090) * (-390.376) [-390.559] (-390.602) (-396.221) -- 0:00:31
      499000 -- (-393.295) (-392.410) (-389.759) [-392.486] * (-390.618) (-397.709) (-394.927) [-389.236] -- 0:00:31
      499500 -- (-394.992) (-391.451) (-391.182) [-393.407] * (-389.634) (-390.734) (-398.955) [-393.287] -- 0:00:31
      500000 -- (-394.035) (-390.882) (-392.117) [-391.465] * (-392.485) [-389.901] (-401.995) (-395.677) -- 0:00:31

      Average standard deviation of split frequencies: 0.008862

      500500 -- (-393.898) [-389.883] (-389.950) (-393.878) * (-396.833) [-391.199] (-393.668) (-391.292) -- 0:00:30
      501000 -- (-389.406) [-388.955] (-389.968) (-391.309) * (-391.602) (-391.350) [-391.615] (-392.053) -- 0:00:30
      501500 -- (-389.061) [-390.635] (-389.677) (-392.741) * (-393.553) (-391.942) [-390.069] (-390.672) -- 0:00:30
      502000 -- (-395.772) (-390.961) [-390.241] (-390.120) * (-392.794) (-395.624) [-393.083] (-391.060) -- 0:00:30
      502500 -- (-392.663) (-391.215) (-390.827) [-392.705] * (-390.457) [-391.882] (-396.645) (-389.853) -- 0:00:30
      503000 -- (-391.980) (-389.150) (-393.450) [-393.863] * (-392.249) (-390.484) (-394.279) [-390.620] -- 0:00:30
      503500 -- (-389.778) [-389.823] (-391.346) (-389.464) * (-391.970) [-390.137] (-393.028) (-390.486) -- 0:00:30
      504000 -- [-391.536] (-392.243) (-392.621) (-390.163) * [-393.805] (-389.966) (-391.077) (-392.323) -- 0:00:30
      504500 -- [-391.390] (-392.443) (-391.189) (-391.360) * (-391.412) [-389.902] (-391.273) (-393.007) -- 0:00:30
      505000 -- [-390.265] (-390.306) (-394.103) (-389.989) * (-389.473) [-391.534] (-390.330) (-390.115) -- 0:00:30

      Average standard deviation of split frequencies: 0.009207

      505500 -- (-391.243) [-389.973] (-392.120) (-390.803) * [-391.059] (-389.582) (-390.731) (-393.361) -- 0:00:30
      506000 -- (-391.312) (-395.008) (-393.758) [-390.744] * (-393.578) (-390.183) [-391.567] (-391.791) -- 0:00:30
      506500 -- (-397.311) [-390.646] (-392.033) (-391.384) * (-389.388) (-391.632) (-391.760) [-390.951] -- 0:00:30
      507000 -- [-391.846] (-391.247) (-391.160) (-390.337) * [-390.165] (-389.765) (-393.027) (-389.818) -- 0:00:30
      507500 -- (-393.508) [-390.430] (-390.410) (-390.960) * (-393.288) [-389.514] (-390.781) (-395.804) -- 0:00:30
      508000 -- (-393.980) (-390.653) (-390.235) [-390.725] * (-389.402) [-391.046] (-394.299) (-394.574) -- 0:00:30
      508500 -- (-389.083) (-392.608) [-389.764] (-391.266) * [-390.034] (-392.600) (-390.971) (-391.005) -- 0:00:29
      509000 -- (-391.095) (-390.623) (-391.477) [-392.043] * (-390.042) [-393.243] (-392.389) (-389.911) -- 0:00:29
      509500 -- [-391.631] (-396.519) (-394.648) (-394.074) * [-389.585] (-395.070) (-390.813) (-396.437) -- 0:00:29
      510000 -- (-389.704) (-390.174) [-391.036] (-394.161) * (-390.094) (-390.716) (-390.039) [-389.667] -- 0:00:29

      Average standard deviation of split frequencies: 0.009828

      510500 -- (-389.214) (-394.198) (-392.905) [-390.236] * (-391.929) (-390.800) (-391.902) [-389.263] -- 0:00:29
      511000 -- [-389.735] (-393.215) (-392.777) (-392.745) * (-393.610) [-394.189] (-389.274) (-390.435) -- 0:00:29
      511500 -- [-391.870] (-390.432) (-389.986) (-391.126) * (-392.400) (-397.839) (-392.537) [-390.507] -- 0:00:29
      512000 -- (-392.899) (-390.079) (-391.420) [-391.963] * (-390.045) (-395.720) (-395.330) [-390.697] -- 0:00:29
      512500 -- (-390.555) [-390.412] (-389.590) (-393.072) * (-395.009) (-390.621) (-393.840) [-391.122] -- 0:00:29
      513000 -- (-392.509) (-390.378) (-390.240) [-389.472] * (-391.841) (-393.307) (-390.417) [-393.827] -- 0:00:29
      513500 -- (-394.203) (-390.345) (-392.197) [-391.026] * (-390.508) (-393.248) (-389.521) [-390.992] -- 0:00:29
      514000 -- (-394.020) [-391.528] (-396.230) (-392.142) * [-389.294] (-391.164) (-393.677) (-391.442) -- 0:00:30
      514500 -- (-393.169) (-390.641) [-389.204] (-389.728) * (-391.476) (-392.463) [-389.448] (-391.265) -- 0:00:30
      515000 -- (-391.172) (-389.769) (-391.919) [-392.379] * (-392.072) [-392.165] (-390.409) (-395.907) -- 0:00:30

      Average standard deviation of split frequencies: 0.009948

      515500 -- [-391.478] (-390.944) (-391.978) (-390.090) * (-390.269) (-391.281) (-396.399) [-393.067] -- 0:00:30
      516000 -- [-392.663] (-390.691) (-391.990) (-389.511) * (-392.686) (-390.013) [-395.667] (-394.998) -- 0:00:30
      516500 -- (-391.027) (-391.748) [-392.309] (-391.738) * [-391.919] (-392.732) (-389.918) (-391.659) -- 0:00:29
      517000 -- (-391.712) (-391.416) [-389.883] (-390.659) * (-394.912) [-391.734] (-394.156) (-389.678) -- 0:00:29
      517500 -- (-389.644) [-391.245] (-391.023) (-394.704) * (-397.749) [-390.810] (-392.272) (-392.033) -- 0:00:29
      518000 -- (-390.516) (-397.017) (-390.393) [-393.994] * (-391.846) [-390.371] (-391.962) (-393.454) -- 0:00:29
      518500 -- (-391.577) (-392.695) [-393.571] (-392.751) * (-389.234) (-391.012) [-389.502] (-390.027) -- 0:00:29
      519000 -- [-392.281] (-390.472) (-392.939) (-393.615) * (-390.473) (-389.933) (-391.744) [-392.103] -- 0:00:29
      519500 -- (-390.212) [-389.317] (-393.143) (-389.844) * [-390.044] (-391.553) (-392.631) (-391.210) -- 0:00:29
      520000 -- (-390.121) (-391.388) (-391.301) [-390.523] * (-391.189) [-394.217] (-391.562) (-389.866) -- 0:00:29

      Average standard deviation of split frequencies: 0.009708

      520500 -- (-389.762) [-395.408] (-392.273) (-390.789) * (-391.250) [-394.296] (-396.998) (-391.971) -- 0:00:29
      521000 -- (-390.546) (-392.333) (-390.703) [-390.987] * (-390.017) (-395.784) (-392.642) [-389.669] -- 0:00:29
      521500 -- (-389.615) (-393.141) [-390.187] (-392.294) * (-391.120) (-393.944) [-389.645] (-391.613) -- 0:00:29
      522000 -- (-389.400) (-391.579) [-393.531] (-390.015) * (-390.190) [-389.734] (-393.052) (-392.886) -- 0:00:29
      522500 -- (-390.788) (-394.466) (-390.782) [-393.682] * (-389.888) (-391.865) [-391.098] (-393.726) -- 0:00:29
      523000 -- [-392.747] (-393.810) (-389.823) (-395.235) * (-391.506) (-390.601) [-389.917] (-391.695) -- 0:00:29
      523500 -- (-392.164) [-390.702] (-394.069) (-392.990) * (-397.440) (-393.226) [-393.048] (-393.320) -- 0:00:29
      524000 -- (-393.391) (-393.706) (-395.208) [-392.336] * [-389.887] (-392.079) (-392.200) (-391.892) -- 0:00:29
      524500 -- (-391.142) [-391.378] (-391.859) (-390.235) * (-392.116) [-390.036] (-391.484) (-399.549) -- 0:00:29
      525000 -- [-389.875] (-391.345) (-391.796) (-392.715) * [-391.956] (-390.461) (-391.950) (-390.559) -- 0:00:28

      Average standard deviation of split frequencies: 0.009808

      525500 -- [-391.267] (-390.440) (-394.448) (-392.585) * (-393.367) (-393.234) (-390.000) [-391.385] -- 0:00:28
      526000 -- (-393.288) [-391.562] (-390.253) (-392.628) * (-393.003) (-390.887) [-392.090] (-392.493) -- 0:00:28
      526500 -- (-397.352) (-391.435) (-392.154) [-390.483] * (-393.247) (-389.629) (-389.612) [-390.560] -- 0:00:28
      527000 -- (-395.888) (-391.443) [-392.533] (-391.471) * (-392.350) (-391.563) (-390.453) [-391.997] -- 0:00:28
      527500 -- [-392.756] (-390.077) (-390.423) (-390.568) * (-392.399) (-393.721) (-391.082) [-391.006] -- 0:00:28
      528000 -- (-393.849) (-390.732) [-391.803] (-389.471) * (-390.116) (-392.388) [-391.770] (-391.300) -- 0:00:28
      528500 -- (-392.658) (-390.933) [-391.359] (-390.689) * [-389.376] (-392.147) (-390.127) (-389.433) -- 0:00:28
      529000 -- [-390.597] (-394.798) (-391.125) (-389.766) * (-391.095) (-393.821) (-394.035) [-389.649] -- 0:00:28
      529500 -- (-397.414) (-390.456) [-392.096] (-390.240) * [-390.699] (-391.625) (-390.625) (-389.640) -- 0:00:28
      530000 -- (-392.182) [-389.743] (-391.081) (-391.710) * (-389.958) (-394.081) [-389.645] (-391.371) -- 0:00:28

      Average standard deviation of split frequencies: 0.009928

      530500 -- (-389.380) (-394.205) [-392.911] (-391.783) * (-391.687) [-392.287] (-390.330) (-393.201) -- 0:00:29
      531000 -- (-389.812) (-391.945) (-391.122) [-394.149] * (-394.021) [-395.384] (-392.094) (-389.664) -- 0:00:29
      531500 -- (-393.226) (-395.218) [-389.177] (-389.062) * [-390.681] (-391.656) (-392.247) (-390.939) -- 0:00:29
      532000 -- (-392.847) (-390.678) [-389.753] (-391.159) * [-391.021] (-392.129) (-396.128) (-398.061) -- 0:00:29
      532500 -- (-394.507) (-389.575) [-391.565] (-391.655) * [-391.067] (-391.677) (-393.247) (-395.257) -- 0:00:28
      533000 -- (-393.763) (-389.180) [-392.101] (-390.066) * [-393.884] (-391.358) (-389.341) (-391.585) -- 0:00:28
      533500 -- (-394.741) [-390.763] (-391.638) (-390.134) * [-392.358] (-391.086) (-391.640) (-391.879) -- 0:00:28
      534000 -- (-389.792) [-390.104] (-390.266) (-390.835) * (-391.281) [-389.974] (-390.587) (-391.400) -- 0:00:28
      534500 -- (-390.923) (-392.489) [-396.600] (-390.712) * [-390.960] (-390.787) (-391.921) (-391.382) -- 0:00:28
      535000 -- (-390.509) (-390.022) (-391.813) [-393.515] * (-393.429) [-389.460] (-391.151) (-396.221) -- 0:00:28

      Average standard deviation of split frequencies: 0.009364

      535500 -- (-391.067) (-390.350) [-392.784] (-392.304) * (-396.854) (-392.459) (-390.279) [-391.328] -- 0:00:28
      536000 -- (-391.045) (-393.296) [-391.877] (-391.121) * (-392.554) (-392.129) (-391.155) [-390.227] -- 0:00:28
      536500 -- (-390.159) (-393.504) [-388.991] (-393.174) * (-391.979) (-390.401) [-390.300] (-391.360) -- 0:00:28
      537000 -- [-390.567] (-392.214) (-390.920) (-393.255) * (-390.222) [-389.587] (-390.241) (-391.165) -- 0:00:28
      537500 -- (-392.397) [-392.146] (-393.271) (-391.496) * (-391.038) [-390.010] (-391.077) (-390.325) -- 0:00:28
      538000 -- (-389.153) [-391.515] (-391.409) (-390.819) * (-390.533) [-390.646] (-389.986) (-389.348) -- 0:00:28
      538500 -- (-392.620) [-390.013] (-390.831) (-395.437) * (-390.500) (-389.397) [-391.429] (-389.368) -- 0:00:28
      539000 -- (-391.473) (-389.368) (-394.387) [-393.328] * (-391.401) (-391.916) [-391.266] (-391.224) -- 0:00:28
      539500 -- (-392.582) (-390.437) (-395.185) [-389.497] * (-390.107) (-390.169) (-391.109) [-389.858] -- 0:00:28
      540000 -- (-391.274) (-391.287) (-392.534) [-390.698] * [-390.537] (-391.579) (-394.481) (-391.740) -- 0:00:28

      Average standard deviation of split frequencies: 0.009833

      540500 -- (-389.989) [-395.096] (-391.472) (-391.254) * [-390.296] (-391.410) (-393.206) (-394.167) -- 0:00:28
      541000 -- [-393.091] (-390.674) (-389.994) (-391.568) * [-391.465] (-392.284) (-393.411) (-390.059) -- 0:00:27
      541500 -- (-389.896) (-390.717) (-390.814) [-390.315] * (-392.580) (-391.551) (-389.711) [-392.768] -- 0:00:27
      542000 -- (-391.706) (-392.577) (-391.291) [-389.821] * (-391.093) [-391.190] (-389.827) (-393.466) -- 0:00:27
      542500 -- [-394.147] (-392.023) (-391.399) (-393.314) * (-394.644) (-392.813) (-392.147) [-392.640] -- 0:00:27
      543000 -- (-392.880) (-390.534) [-393.461] (-394.398) * (-392.458) (-391.663) [-390.002] (-398.702) -- 0:00:27
      543500 -- (-392.889) (-392.478) [-389.744] (-398.140) * (-394.101) (-390.746) [-390.565] (-392.308) -- 0:00:27
      544000 -- (-389.980) (-396.853) [-390.112] (-394.780) * (-393.673) [-392.013] (-393.619) (-396.147) -- 0:00:27
      544500 -- [-391.280] (-390.857) (-393.527) (-389.951) * (-389.803) (-392.050) [-391.736] (-396.214) -- 0:00:27
      545000 -- [-393.858] (-391.642) (-391.284) (-391.860) * [-391.392] (-390.251) (-393.127) (-391.661) -- 0:00:27

      Average standard deviation of split frequencies: 0.009497

      545500 -- (-395.001) (-389.328) (-390.734) [-391.299] * [-389.068] (-393.306) (-390.519) (-391.386) -- 0:00:27
      546000 -- (-395.716) [-390.561] (-395.314) (-392.039) * [-389.067] (-393.609) (-389.996) (-389.552) -- 0:00:27
      546500 -- (-390.179) [-390.550] (-388.957) (-392.060) * (-389.236) (-392.630) (-392.342) [-389.442] -- 0:00:27
      547000 -- (-390.326) [-389.291] (-392.420) (-392.998) * (-390.338) (-389.935) [-390.599] (-392.360) -- 0:00:27
      547500 -- [-392.115] (-390.097) (-394.270) (-391.208) * (-389.089) (-391.842) (-392.005) [-391.690] -- 0:00:27
      548000 -- [-389.464] (-392.922) (-392.224) (-391.154) * [-389.845] (-389.851) (-391.272) (-392.742) -- 0:00:28
      548500 -- (-390.651) (-393.560) [-390.947] (-390.731) * [-389.822] (-391.607) (-393.918) (-395.116) -- 0:00:27
      549000 -- (-389.569) (-392.113) [-391.423] (-394.280) * [-393.724] (-390.533) (-389.435) (-393.147) -- 0:00:27
      549500 -- (-389.299) (-392.850) [-389.905] (-394.554) * [-397.791] (-389.702) (-395.477) (-394.794) -- 0:00:27
      550000 -- (-391.093) [-393.071] (-390.056) (-392.101) * (-390.766) [-390.583] (-392.474) (-392.804) -- 0:00:27

      Average standard deviation of split frequencies: 0.009417

      550500 -- (-393.501) (-389.504) (-389.826) [-390.834] * (-391.765) (-391.031) (-390.135) [-390.073] -- 0:00:27
      551000 -- (-392.216) (-392.385) (-390.834) [-392.072] * (-392.601) (-389.906) (-392.924) [-389.504] -- 0:00:27
      551500 -- [-389.252] (-394.587) (-390.505) (-396.435) * (-392.772) [-390.225] (-391.330) (-392.369) -- 0:00:27
      552000 -- (-393.633) [-391.798] (-390.779) (-392.339) * (-391.441) (-392.075) [-391.049] (-393.127) -- 0:00:27
      552500 -- [-394.286] (-392.234) (-391.916) (-390.568) * (-391.267) [-389.908] (-392.862) (-396.088) -- 0:00:27
      553000 -- (-391.577) (-391.411) (-390.474) [-390.142] * (-392.048) [-392.514] (-390.680) (-398.252) -- 0:00:27
      553500 -- [-391.339] (-391.835) (-389.847) (-391.382) * [-389.423] (-390.525) (-395.441) (-390.449) -- 0:00:27
      554000 -- (-389.610) (-390.955) [-389.151] (-389.785) * (-392.983) (-394.373) (-390.352) [-391.839] -- 0:00:27
      554500 -- (-395.926) (-390.603) (-389.378) [-390.966] * (-391.897) (-390.815) (-390.037) [-391.688] -- 0:00:27
      555000 -- (-392.513) (-390.614) [-394.211] (-390.260) * (-391.747) [-390.141] (-390.980) (-390.258) -- 0:00:27

      Average standard deviation of split frequencies: 0.008927

      555500 -- (-391.438) (-390.364) [-391.362] (-390.880) * [-390.080] (-392.020) (-393.442) (-389.612) -- 0:00:27
      556000 -- (-391.479) [-391.801] (-391.107) (-392.454) * (-389.074) [-394.656] (-393.397) (-396.750) -- 0:00:27
      556500 -- (-392.195) (-391.690) (-392.599) [-391.008] * (-390.717) (-396.446) (-389.356) [-391.114] -- 0:00:27
      557000 -- (-390.810) (-389.791) (-389.335) [-391.183] * (-390.324) (-392.079) (-390.067) [-392.101] -- 0:00:27
      557500 -- (-389.770) (-389.339) [-390.861] (-392.240) * (-393.862) (-392.635) (-390.113) [-390.672] -- 0:00:26
      558000 -- (-394.365) [-389.752] (-390.006) (-391.136) * (-390.548) (-391.380) [-390.720] (-389.565) -- 0:00:26
      558500 -- (-394.458) (-392.864) (-391.374) [-390.091] * [-391.015] (-391.641) (-391.578) (-390.361) -- 0:00:26
      559000 -- (-391.658) (-390.634) (-393.120) [-391.768] * [-389.564] (-392.685) (-390.225) (-392.670) -- 0:00:26
      559500 -- (-389.840) (-391.372) [-401.356] (-390.480) * [-391.064] (-394.380) (-390.507) (-391.080) -- 0:00:26
      560000 -- (-392.981) [-389.874] (-393.423) (-393.543) * (-391.326) (-392.477) (-390.514) [-391.173] -- 0:00:26

      Average standard deviation of split frequencies: 0.008705

      560500 -- [-391.051] (-390.188) (-390.719) (-400.220) * (-391.335) (-394.748) [-390.447] (-391.568) -- 0:00:26
      561000 -- [-393.886] (-392.277) (-390.569) (-395.100) * (-390.557) (-393.798) [-391.564] (-389.553) -- 0:00:26
      561500 -- (-390.391) (-390.848) (-389.663) [-389.597] * [-389.785] (-389.654) (-391.814) (-392.937) -- 0:00:26
      562000 -- (-390.337) (-391.954) [-390.008] (-391.871) * [-393.466] (-389.256) (-390.853) (-392.013) -- 0:00:26
      562500 -- [-390.627] (-394.977) (-389.975) (-393.026) * (-391.033) [-389.250] (-392.523) (-392.453) -- 0:00:26
      563000 -- (-389.729) (-389.750) [-392.276] (-395.660) * (-394.033) (-390.109) [-392.702] (-399.222) -- 0:00:26
      563500 -- (-391.896) [-390.238] (-394.888) (-390.519) * (-390.822) (-392.439) (-389.982) [-398.587] -- 0:00:26
      564000 -- (-395.999) (-396.150) [-389.568] (-391.891) * [-393.523] (-391.627) (-390.530) (-392.552) -- 0:00:26
      564500 -- (-390.251) [-391.922] (-390.357) (-391.395) * (-392.199) [-390.671] (-392.410) (-390.714) -- 0:00:26
      565000 -- (-392.750) (-392.447) [-390.374] (-390.460) * (-390.159) [-389.979] (-394.302) (-393.988) -- 0:00:26

      Average standard deviation of split frequencies: 0.008721

      565500 -- (-391.371) (-390.701) (-392.286) [-389.501] * (-390.747) (-390.870) (-391.216) [-391.451] -- 0:00:26
      566000 -- [-391.335] (-392.609) (-393.104) (-390.420) * (-389.921) (-390.577) (-392.728) [-392.960] -- 0:00:26
      566500 -- (-391.320) (-389.624) (-391.235) [-390.608] * [-390.838] (-390.273) (-396.029) (-393.890) -- 0:00:26
      567000 -- [-391.067] (-395.939) (-391.635) (-392.270) * (-391.406) [-392.939] (-389.790) (-391.561) -- 0:00:26
      567500 -- (-393.370) [-390.049] (-389.489) (-392.293) * (-391.222) (-389.403) (-392.688) [-392.081] -- 0:00:26
      568000 -- (-390.851) [-393.404] (-389.671) (-392.909) * (-393.025) [-390.369] (-395.122) (-390.891) -- 0:00:26
      568500 -- (-391.988) [-390.171] (-390.795) (-393.190) * (-391.837) (-391.151) [-391.923] (-390.902) -- 0:00:26
      569000 -- (-390.514) [-392.189] (-390.494) (-389.388) * (-392.044) [-389.608] (-390.570) (-394.092) -- 0:00:26
      569500 -- (-393.620) [-395.631] (-390.350) (-392.035) * (-396.118) (-392.520) (-391.793) [-390.501] -- 0:00:26
      570000 -- [-392.957] (-395.576) (-392.347) (-393.510) * (-394.831) (-390.952) [-393.693] (-392.078) -- 0:00:26

      Average standard deviation of split frequencies: 0.009087

      570500 -- (-389.760) (-392.695) [-390.747] (-389.035) * (-390.592) (-389.114) [-390.565] (-389.799) -- 0:00:26
      571000 -- (-392.179) (-389.004) (-391.395) [-390.600] * (-393.106) (-392.612) (-392.635) [-390.896] -- 0:00:26
      571500 -- (-390.091) [-390.123] (-389.456) (-390.770) * [-394.051] (-393.709) (-392.824) (-392.921) -- 0:00:26
      572000 -- (-390.229) [-389.554] (-394.343) (-392.327) * (-391.257) (-391.282) (-392.212) [-392.065] -- 0:00:26
      572500 -- (-391.821) (-389.496) [-392.889] (-391.701) * (-393.556) (-389.590) (-390.678) [-390.756] -- 0:00:26
      573000 -- (-389.917) (-391.259) (-393.199) [-391.076] * (-392.677) (-390.236) (-390.379) [-392.353] -- 0:00:26
      573500 -- (-392.912) (-393.957) (-389.977) [-389.220] * (-393.110) (-391.470) [-389.596] (-390.536) -- 0:00:26
      574000 -- (-397.116) (-391.986) (-391.650) [-390.360] * (-394.772) (-391.676) [-389.344] (-390.036) -- 0:00:25
      574500 -- (-394.293) [-398.031] (-391.378) (-391.632) * (-393.669) (-390.481) [-393.306] (-392.681) -- 0:00:25
      575000 -- (-394.861) [-390.906] (-390.753) (-391.349) * (-395.453) [-390.476] (-391.816) (-397.015) -- 0:00:25

      Average standard deviation of split frequencies: 0.008473

      575500 -- [-391.772] (-393.091) (-391.069) (-394.361) * [-392.034] (-391.846) (-390.536) (-394.120) -- 0:00:25
      576000 -- (-389.875) (-390.787) (-392.698) [-392.623] * (-390.195) [-389.982] (-390.247) (-393.513) -- 0:00:25
      576500 -- (-391.417) [-392.532] (-391.515) (-390.858) * [-390.699] (-390.017) (-391.393) (-391.535) -- 0:00:25
      577000 -- (-392.079) [-396.560] (-391.652) (-390.290) * (-391.425) [-391.484] (-393.210) (-390.843) -- 0:00:25
      577500 -- [-389.744] (-392.184) (-389.614) (-392.875) * (-390.919) (-390.862) (-390.857) [-391.982] -- 0:00:25
      578000 -- (-390.632) (-390.016) [-390.624] (-390.516) * (-390.625) (-392.457) [-391.250] (-393.739) -- 0:00:25
      578500 -- [-390.501] (-390.191) (-390.811) (-390.739) * [-390.357] (-390.549) (-392.469) (-390.479) -- 0:00:25
      579000 -- [-390.527] (-393.268) (-392.154) (-391.730) * (-391.491) (-390.199) (-393.122) [-391.896] -- 0:00:25
      579500 -- (-390.234) (-392.545) (-395.606) [-391.850] * [-391.155] (-390.845) (-390.602) (-391.650) -- 0:00:25
      580000 -- (-392.367) [-389.932] (-391.042) (-391.185) * (-396.990) [-389.868] (-391.192) (-392.352) -- 0:00:25

      Average standard deviation of split frequencies: 0.007712

      580500 -- (-391.231) [-390.585] (-390.918) (-391.070) * (-397.586) [-391.584] (-390.840) (-389.485) -- 0:00:25
      581000 -- (-391.385) (-392.707) [-392.915] (-398.264) * [-393.023] (-390.695) (-394.630) (-390.696) -- 0:00:25
      581500 -- [-390.726] (-392.467) (-389.601) (-391.868) * [-391.304] (-389.114) (-389.836) (-393.668) -- 0:00:25
      582000 -- (-391.620) (-394.191) [-389.367] (-390.029) * (-392.739) (-390.792) (-391.928) [-389.251] -- 0:00:25
      582500 -- (-392.417) (-391.264) (-393.653) [-391.367] * (-393.919) (-393.902) [-394.342] (-390.584) -- 0:00:25
      583000 -- (-390.209) (-392.406) [-392.267] (-389.400) * (-391.875) [-391.440] (-394.021) (-390.917) -- 0:00:25
      583500 -- (-394.402) (-391.437) [-389.892] (-393.686) * (-392.048) (-389.808) [-392.626] (-390.232) -- 0:00:25
      584000 -- (-391.467) [-394.185] (-399.351) (-392.793) * (-394.772) (-393.709) (-395.550) [-391.361] -- 0:00:25
      584500 -- (-390.694) [-392.659] (-390.944) (-389.657) * (-389.757) [-392.252] (-391.675) (-390.696) -- 0:00:25
      585000 -- [-389.980] (-392.513) (-395.060) (-390.187) * (-389.195) (-391.832) (-392.043) [-394.713] -- 0:00:25

      Average standard deviation of split frequencies: 0.007089

      585500 -- (-392.395) [-392.670] (-391.855) (-395.141) * (-390.903) [-389.929] (-391.938) (-392.274) -- 0:00:25
      586000 -- (-391.236) [-391.599] (-393.137) (-398.769) * (-394.699) [-389.760] (-390.191) (-394.042) -- 0:00:25
      586500 -- (-391.372) (-391.214) [-390.646] (-390.066) * [-391.449] (-391.776) (-390.255) (-392.447) -- 0:00:25
      587000 -- (-395.288) (-397.469) [-392.227] (-391.836) * [-390.408] (-393.946) (-389.989) (-394.212) -- 0:00:25
      587500 -- (-394.303) (-396.738) [-389.925] (-391.786) * [-389.857] (-389.552) (-396.012) (-392.758) -- 0:00:25
      588000 -- (-395.598) (-389.637) (-391.468) [-394.407] * (-393.034) (-393.004) [-393.751] (-392.379) -- 0:00:25
      588500 -- [-391.730] (-390.293) (-390.254) (-396.325) * (-392.317) (-395.637) [-391.040] (-390.478) -- 0:00:25
      589000 -- (-391.258) (-390.777) [-392.770] (-390.291) * [-390.410] (-394.650) (-393.493) (-391.738) -- 0:00:25
      589500 -- [-390.792] (-390.840) (-396.648) (-393.232) * (-390.201) (-391.885) [-399.740] (-390.398) -- 0:00:25
      590000 -- (-392.254) (-392.420) (-391.750) [-389.840] * [-391.126] (-390.552) (-394.925) (-390.057) -- 0:00:25

      Average standard deviation of split frequencies: 0.007632

      590500 -- (-391.983) [-390.563] (-392.342) (-389.562) * (-389.826) (-398.248) (-391.816) [-391.849] -- 0:00:24
      591000 -- [-390.463] (-393.777) (-389.886) (-391.636) * [-390.227] (-392.617) (-391.894) (-390.261) -- 0:00:24
      591500 -- (-392.936) (-392.519) (-391.588) [-390.556] * (-391.510) (-391.551) (-392.460) [-396.383] -- 0:00:24
      592000 -- (-389.437) [-390.724] (-391.097) (-390.103) * (-390.768) [-392.741] (-389.544) (-392.440) -- 0:00:24
      592500 -- (-390.222) (-391.659) [-391.478] (-391.558) * [-392.354] (-389.778) (-389.613) (-392.953) -- 0:00:24
      593000 -- [-389.820] (-396.528) (-392.979) (-390.950) * (-389.935) [-390.664] (-390.434) (-391.546) -- 0:00:24
      593500 -- (-392.802) [-391.805] (-394.867) (-393.416) * (-389.203) [-391.754] (-394.303) (-390.031) -- 0:00:24
      594000 -- (-391.413) (-389.738) (-390.448) [-392.603] * [-390.975] (-391.443) (-395.384) (-392.799) -- 0:00:24
      594500 -- (-391.730) (-389.566) (-392.810) [-389.813] * [-390.417] (-390.322) (-391.806) (-394.595) -- 0:00:24
      595000 -- (-398.082) (-393.042) (-390.500) [-389.665] * [-389.248] (-390.427) (-390.494) (-389.141) -- 0:00:24

      Average standard deviation of split frequencies: 0.008503

      595500 -- [-390.042] (-390.832) (-391.027) (-393.311) * (-392.482) (-393.454) (-390.675) [-391.427] -- 0:00:24
      596000 -- (-395.196) (-390.255) [-392.743] (-391.245) * (-392.478) (-391.876) (-389.818) [-389.977] -- 0:00:24
      596500 -- (-394.238) (-389.732) (-392.886) [-392.653] * (-398.247) (-390.942) [-390.663] (-389.841) -- 0:00:24
      597000 -- (-392.956) [-391.727] (-393.086) (-397.670) * (-389.143) (-392.962) (-393.055) [-390.252] -- 0:00:24
      597500 -- (-393.920) [-392.202] (-390.259) (-390.314) * (-390.950) (-396.162) (-392.336) [-389.828] -- 0:00:24
      598000 -- (-392.771) [-390.943] (-391.661) (-392.811) * (-389.526) (-393.294) (-397.848) [-390.732] -- 0:00:24
      598500 -- [-392.740] (-393.760) (-393.212) (-391.336) * [-390.851] (-391.720) (-394.802) (-391.467) -- 0:00:24
      599000 -- [-390.765] (-392.795) (-389.638) (-389.298) * (-392.792) [-389.827] (-391.549) (-392.113) -- 0:00:24
      599500 -- (-390.812) [-389.551] (-396.281) (-394.191) * (-394.242) [-394.996] (-391.727) (-391.425) -- 0:00:24
      600000 -- [-391.697] (-389.211) (-390.597) (-391.915) * [-390.281] (-390.675) (-390.902) (-389.753) -- 0:00:24

      Average standard deviation of split frequencies: 0.008437

      600500 -- (-390.248) (-390.827) [-389.812] (-390.248) * (-390.735) (-389.598) [-389.913] (-391.889) -- 0:00:24
      601000 -- (-390.948) (-396.777) (-393.862) [-389.376] * [-392.569] (-390.310) (-391.256) (-390.553) -- 0:00:24
      601500 -- [-390.952] (-393.843) (-393.429) (-392.958) * (-391.369) (-389.260) [-389.760] (-393.245) -- 0:00:24
      602000 -- (-391.442) [-390.105] (-395.433) (-394.639) * [-390.778] (-389.439) (-393.362) (-389.879) -- 0:00:24
      602500 -- (-389.511) (-389.624) [-390.712] (-395.051) * (-391.871) (-391.962) (-395.135) [-389.824] -- 0:00:24
      603000 -- [-389.906] (-390.058) (-391.637) (-392.428) * [-392.932] (-390.466) (-391.545) (-392.502) -- 0:00:24
      603500 -- (-390.084) (-392.145) [-390.127] (-395.211) * [-393.372] (-395.513) (-390.068) (-390.791) -- 0:00:24
      604000 -- (-391.526) (-391.027) (-390.388) [-391.739] * [-391.629] (-393.681) (-390.247) (-392.021) -- 0:00:24
      604500 -- (-391.500) (-390.477) [-394.380] (-390.530) * (-391.552) (-391.413) (-391.591) [-390.991] -- 0:00:24
      605000 -- (-391.871) (-390.131) (-391.448) [-390.955] * (-390.899) (-390.847) (-392.643) [-390.029] -- 0:00:24

      Average standard deviation of split frequencies: 0.008946

      605500 -- (-395.993) (-391.656) [-389.849] (-393.119) * (-395.448) (-392.174) [-391.169] (-390.927) -- 0:00:24
      606000 -- (-391.481) [-389.944] (-390.562) (-392.455) * (-389.808) (-390.804) [-391.043] (-391.273) -- 0:00:24
      606500 -- (-390.924) [-393.165] (-391.667) (-393.082) * (-392.984) [-390.511] (-390.098) (-390.108) -- 0:00:24
      607000 -- (-393.678) (-391.200) [-390.235] (-390.689) * (-392.570) [-390.540] (-390.419) (-390.091) -- 0:00:23
      607500 -- (-391.085) [-392.092] (-389.940) (-392.277) * [-391.383] (-392.570) (-389.140) (-395.233) -- 0:00:23
      608000 -- [-393.884] (-394.184) (-393.160) (-391.488) * (-392.776) (-394.124) (-392.044) [-392.052] -- 0:00:23
      608500 -- (-392.989) (-394.059) (-393.800) [-391.773] * [-390.461] (-391.418) (-392.064) (-392.562) -- 0:00:23
      609000 -- (-390.102) [-390.815] (-390.700) (-393.513) * (-390.957) (-390.533) [-389.809] (-391.784) -- 0:00:23
      609500 -- [-390.603] (-390.952) (-393.224) (-392.021) * [-389.568] (-389.863) (-389.989) (-393.204) -- 0:00:23
      610000 -- (-389.358) (-391.300) [-394.308] (-391.688) * (-390.679) [-391.239] (-390.733) (-391.467) -- 0:00:23

      Average standard deviation of split frequencies: 0.009263

      610500 -- (-389.495) (-390.486) [-394.193] (-390.503) * [-391.155] (-391.508) (-390.579) (-389.704) -- 0:00:23
      611000 -- (-392.947) (-390.333) [-393.350] (-393.796) * (-390.798) (-392.613) [-390.382] (-391.143) -- 0:00:23
      611500 -- [-391.859] (-391.339) (-394.779) (-390.136) * (-392.183) (-390.794) [-390.384] (-392.153) -- 0:00:23
      612000 -- (-392.203) (-392.220) (-390.724) [-390.256] * [-393.113] (-391.751) (-390.267) (-391.965) -- 0:00:23
      612500 -- (-389.608) (-390.478) [-389.934] (-388.957) * [-392.583] (-389.190) (-389.530) (-390.843) -- 0:00:23
      613000 -- (-392.209) [-389.976] (-390.933) (-389.634) * (-389.870) (-389.388) [-389.959] (-394.085) -- 0:00:23
      613500 -- (-392.499) (-391.439) [-391.063] (-389.873) * (-390.038) (-390.320) [-395.199] (-394.267) -- 0:00:23
      614000 -- [-391.995] (-395.262) (-389.863) (-396.070) * (-393.335) (-390.555) (-390.282) [-389.998] -- 0:00:23
      614500 -- [-391.745] (-393.299) (-391.128) (-392.635) * (-390.173) (-389.953) (-392.649) [-390.625] -- 0:00:23
      615000 -- (-391.800) (-391.276) (-392.360) [-395.731] * (-391.652) (-393.607) [-390.170] (-392.588) -- 0:00:23

      Average standard deviation of split frequencies: 0.009991

      615500 -- (-390.066) (-393.375) (-391.726) [-389.874] * [-389.036] (-393.459) (-391.458) (-390.946) -- 0:00:23
      616000 -- (-393.682) [-390.526] (-389.969) (-389.222) * (-392.555) (-390.693) (-392.710) [-392.478] -- 0:00:23
      616500 -- (-396.867) [-391.181] (-389.448) (-390.169) * (-391.968) [-390.526] (-391.483) (-390.892) -- 0:00:23
      617000 -- (-389.638) (-391.220) (-393.132) [-394.038] * (-391.389) (-393.654) (-389.657) [-390.690] -- 0:00:23
      617500 -- (-391.665) (-390.143) (-393.863) [-389.989] * (-391.153) [-390.751] (-390.492) (-395.129) -- 0:00:23
      618000 -- [-390.553] (-390.087) (-391.232) (-391.819) * (-393.033) (-391.177) [-391.280] (-391.528) -- 0:00:23
      618500 -- [-390.000] (-393.543) (-389.233) (-393.369) * [-390.131] (-393.001) (-389.725) (-392.658) -- 0:00:23
      619000 -- [-393.419] (-392.206) (-391.119) (-389.904) * (-390.738) (-389.741) [-389.982] (-392.026) -- 0:00:23
      619500 -- (-393.074) (-394.758) [-389.817] (-391.063) * (-390.003) [-389.727] (-392.212) (-391.767) -- 0:00:23
      620000 -- (-395.221) (-391.253) (-391.350) [-389.876] * (-390.155) (-389.695) [-392.575] (-391.973) -- 0:00:23

      Average standard deviation of split frequencies: 0.009561

      620500 -- (-396.276) (-390.901) [-390.124] (-390.887) * (-391.557) (-391.861) [-389.296] (-394.502) -- 0:00:23
      621000 -- [-390.475] (-389.597) (-391.769) (-395.297) * [-389.004] (-390.143) (-389.897) (-390.044) -- 0:00:23
      621500 -- (-389.681) (-389.558) [-390.732] (-391.215) * [-391.917] (-394.096) (-391.214) (-392.975) -- 0:00:23
      622000 -- (-389.929) (-390.668) [-390.035] (-390.147) * [-392.374] (-394.471) (-389.414) (-392.593) -- 0:00:23
      622500 -- (-390.760) [-391.592] (-390.438) (-391.706) * [-389.794] (-392.230) (-392.601) (-392.607) -- 0:00:23
      623000 -- (-390.114) [-390.111] (-389.931) (-391.043) * [-392.601] (-390.281) (-391.369) (-394.812) -- 0:00:22
      623500 -- (-393.170) (-390.056) [-391.453] (-389.854) * (-389.588) (-389.916) (-393.629) [-391.574] -- 0:00:22
      624000 -- (-392.687) (-394.688) [-391.666] (-391.746) * (-390.278) [-389.615] (-392.830) (-391.153) -- 0:00:22
      624500 -- (-391.504) (-396.446) [-389.819] (-390.885) * (-391.468) [-392.013] (-392.939) (-390.275) -- 0:00:22
      625000 -- (-391.552) [-390.988] (-390.592) (-391.883) * (-390.111) [-389.390] (-393.991) (-391.668) -- 0:00:22

      Average standard deviation of split frequencies: 0.009169

      625500 -- (-391.709) (-391.128) [-389.921] (-389.902) * (-391.859) (-392.770) [-390.448] (-391.819) -- 0:00:22
      626000 -- (-390.495) (-391.428) [-389.422] (-390.052) * (-391.157) [-390.780] (-391.918) (-392.890) -- 0:00:22
      626500 -- (-394.409) [-392.512] (-394.370) (-390.487) * (-391.339) [-390.203] (-390.412) (-394.916) -- 0:00:22
      627000 -- (-391.733) (-389.818) (-393.908) [-392.540] * (-389.870) [-390.053] (-395.106) (-389.626) -- 0:00:22
      627500 -- (-392.799) (-394.753) (-391.276) [-392.353] * (-390.687) [-389.151] (-391.483) (-389.833) -- 0:00:22
      628000 -- (-389.311) (-391.954) [-389.403] (-389.110) * (-390.735) (-389.255) (-391.374) [-390.222] -- 0:00:22
      628500 -- [-389.874] (-389.975) (-390.978) (-389.765) * [-391.118] (-391.646) (-391.048) (-391.623) -- 0:00:22
      629000 -- (-390.617) (-389.687) [-391.433] (-389.490) * (-390.680) (-390.564) [-392.540] (-391.260) -- 0:00:22
      629500 -- [-390.819] (-392.296) (-394.830) (-390.528) * [-393.258] (-390.726) (-392.782) (-393.713) -- 0:00:22
      630000 -- [-391.143] (-390.993) (-391.590) (-393.948) * [-391.750] (-389.187) (-395.310) (-396.053) -- 0:00:22

      Average standard deviation of split frequencies: 0.009453

      630500 -- (-391.446) (-389.216) (-392.360) [-389.952] * (-391.039) (-389.477) [-391.067] (-392.235) -- 0:00:22
      631000 -- [-390.151] (-391.466) (-392.692) (-395.301) * (-389.589) (-390.978) (-391.654) [-394.448] -- 0:00:22
      631500 -- (-389.519) (-391.718) (-390.625) [-389.951] * [-389.633] (-391.375) (-390.497) (-391.332) -- 0:00:22
      632000 -- [-390.111] (-390.936) (-393.218) (-394.899) * (-392.636) (-389.761) [-394.756] (-389.868) -- 0:00:22
      632500 -- [-391.062] (-391.703) (-390.503) (-394.331) * (-392.614) (-389.988) [-393.213] (-392.400) -- 0:00:22
      633000 -- (-389.498) (-391.080) (-393.712) [-391.233] * (-393.855) (-392.468) [-390.716] (-392.737) -- 0:00:22
      633500 -- (-392.371) (-389.655) [-391.986] (-392.641) * (-390.416) [-393.626] (-393.057) (-391.697) -- 0:00:22
      634000 -- (-394.420) (-391.711) [-391.268] (-391.645) * [-390.102] (-393.615) (-390.121) (-391.038) -- 0:00:22
      634500 -- (-389.672) (-391.080) (-390.591) [-390.844] * (-391.035) (-390.747) [-391.919] (-395.083) -- 0:00:22
      635000 -- (-392.937) (-390.979) (-391.904) [-392.877] * (-390.647) [-390.257] (-390.430) (-393.758) -- 0:00:22

      Average standard deviation of split frequencies: 0.009548

      635500 -- (-391.886) (-392.605) [-390.019] (-392.091) * (-390.908) (-389.603) (-394.812) [-390.102] -- 0:00:22
      636000 -- (-390.276) [-392.518] (-389.877) (-389.919) * (-391.887) (-390.710) [-390.646] (-390.331) -- 0:00:22
      636500 -- [-390.937] (-392.385) (-390.788) (-392.676) * (-389.132) (-390.625) (-390.996) [-390.609] -- 0:00:22
      637000 -- (-395.023) [-392.569] (-390.550) (-390.455) * [-389.482] (-393.214) (-395.357) (-395.331) -- 0:00:22
      637500 -- (-392.705) (-392.865) [-393.988] (-390.305) * (-392.964) [-390.530] (-391.182) (-391.755) -- 0:00:22
      638000 -- (-390.206) (-391.499) (-394.686) [-392.830] * (-390.989) (-389.280) (-392.490) [-389.830] -- 0:00:22
      638500 -- [-390.923] (-389.645) (-390.906) (-394.224) * (-389.841) [-389.630] (-390.478) (-390.077) -- 0:00:22
      639000 -- (-391.506) (-395.207) (-392.100) [-394.618] * [-391.039] (-389.598) (-392.482) (-390.315) -- 0:00:22
      639500 -- (-390.558) (-391.201) [-390.150] (-391.845) * (-390.894) [-391.678] (-392.667) (-391.406) -- 0:00:21
      640000 -- (-395.333) [-391.105] (-389.923) (-392.330) * (-392.792) (-393.862) [-391.000] (-390.488) -- 0:00:21

      Average standard deviation of split frequencies: 0.010128

      640500 -- (-393.263) [-390.238] (-392.349) (-391.979) * (-390.670) (-390.839) [-392.560] (-390.671) -- 0:00:21
      641000 -- (-389.365) (-391.761) (-391.614) [-391.423] * (-390.611) [-390.056] (-390.601) (-393.213) -- 0:00:21
      641500 -- (-389.339) [-391.555] (-391.884) (-392.033) * [-390.910] (-392.153) (-390.420) (-393.029) -- 0:00:21
      642000 -- [-389.419] (-390.936) (-394.159) (-391.687) * [-390.054] (-389.864) (-395.050) (-392.941) -- 0:00:21
      642500 -- (-389.309) (-391.205) [-389.136] (-391.285) * (-390.675) (-390.176) [-392.672] (-394.124) -- 0:00:21
      643000 -- (-390.402) [-390.147] (-391.438) (-393.178) * [-392.231] (-389.952) (-391.070) (-394.804) -- 0:00:21
      643500 -- [-390.336] (-391.038) (-394.253) (-392.317) * (-393.963) (-391.419) [-389.111] (-397.321) -- 0:00:21
      644000 -- (-393.128) [-390.855] (-391.936) (-392.127) * (-390.948) [-390.588] (-394.912) (-392.398) -- 0:00:21
      644500 -- (-390.699) (-390.685) (-392.883) [-390.466] * (-392.534) (-392.894) [-391.661] (-391.246) -- 0:00:21
      645000 -- (-389.765) (-395.496) (-392.395) [-390.901] * (-393.362) (-390.256) (-392.598) [-390.246] -- 0:00:21

      Average standard deviation of split frequencies: 0.010419

      645500 -- (-390.061) (-390.641) (-391.778) [-390.744] * (-392.220) (-391.636) (-392.810) [-392.364] -- 0:00:21
      646000 -- (-392.389) (-390.362) [-391.511] (-402.290) * (-394.364) (-390.265) [-391.502] (-390.168) -- 0:00:21
      646500 -- (-390.357) [-390.702] (-392.956) (-391.018) * [-392.728] (-392.496) (-391.526) (-389.902) -- 0:00:21
      647000 -- (-390.460) (-391.077) (-394.230) [-392.653] * (-392.099) (-391.863) (-393.054) [-389.761] -- 0:00:21
      647500 -- [-395.631] (-392.141) (-390.449) (-392.142) * [-391.974] (-391.126) (-391.018) (-392.082) -- 0:00:21
      648000 -- [-393.060] (-389.593) (-392.407) (-395.596) * [-390.672] (-395.427) (-389.308) (-397.433) -- 0:00:21
      648500 -- (-393.774) (-390.260) (-392.719) [-393.166] * (-392.900) [-390.697] (-389.455) (-390.246) -- 0:00:21
      649000 -- (-392.207) [-392.806] (-392.403) (-391.675) * (-399.007) [-393.303] (-389.184) (-393.683) -- 0:00:21
      649500 -- (-392.613) (-390.592) (-393.455) [-392.642] * (-390.916) [-390.471] (-389.389) (-391.947) -- 0:00:21
      650000 -- (-390.772) (-389.731) (-394.912) [-390.585] * [-393.402] (-391.241) (-394.198) (-392.574) -- 0:00:21

      Average standard deviation of split frequencies: 0.010612

      650500 -- (-390.006) (-390.652) (-394.950) [-390.543] * (-392.996) [-391.434] (-392.022) (-390.539) -- 0:00:21
      651000 -- (-389.323) [-392.618] (-391.127) (-394.207) * (-392.630) [-390.455] (-390.988) (-392.006) -- 0:00:21
      651500 -- (-391.695) (-389.981) [-391.116] (-395.798) * (-391.985) [-390.171] (-391.798) (-389.144) -- 0:00:21
      652000 -- (-391.854) [-389.679] (-389.903) (-394.203) * [-390.861] (-391.645) (-391.354) (-396.278) -- 0:00:21
      652500 -- [-392.188] (-394.275) (-389.741) (-390.808) * (-391.491) (-391.283) [-389.726] (-391.890) -- 0:00:21
      653000 -- (-390.887) (-394.979) (-390.782) [-390.358] * (-390.868) [-393.444] (-390.106) (-390.721) -- 0:00:21
      653500 -- [-395.017] (-391.149) (-397.513) (-396.100) * [-391.267] (-391.595) (-389.461) (-391.055) -- 0:00:21
      654000 -- (-393.737) (-392.415) [-391.221] (-390.288) * (-389.983) [-391.307] (-394.467) (-392.464) -- 0:00:21
      654500 -- [-389.737] (-393.628) (-392.251) (-391.187) * (-391.098) [-390.663] (-392.158) (-389.702) -- 0:00:21
      655000 -- (-392.071) [-390.412] (-392.067) (-394.560) * (-391.856) [-392.654] (-390.025) (-389.303) -- 0:00:21

      Average standard deviation of split frequencies: 0.009297

      655500 -- (-392.823) (-389.849) (-390.018) [-390.907] * (-391.989) (-392.838) [-390.311] (-396.823) -- 0:00:21
      656000 -- (-390.167) [-389.587] (-389.379) (-392.702) * (-389.739) (-389.560) [-394.190] (-393.536) -- 0:00:20
      656500 -- (-389.533) (-391.595) (-392.360) [-391.327] * (-390.701) [-389.728] (-394.091) (-391.592) -- 0:00:20
      657000 -- (-391.616) [-391.025] (-390.411) (-390.420) * (-393.085) (-391.863) [-393.017] (-390.583) -- 0:00:20
      657500 -- [-391.121] (-395.497) (-399.420) (-389.467) * (-391.381) [-389.856] (-392.377) (-391.705) -- 0:00:20
      658000 -- (-389.715) [-391.946] (-392.008) (-393.624) * (-391.457) (-394.131) (-391.155) [-399.262] -- 0:00:20
      658500 -- (-391.189) (-390.446) [-390.011] (-390.863) * (-391.668) (-392.751) [-391.432] (-394.939) -- 0:00:20
      659000 -- (-391.012) (-389.829) [-390.664] (-391.477) * (-391.291) [-392.443] (-391.638) (-390.624) -- 0:00:20
      659500 -- (-393.804) (-391.140) (-389.218) [-393.494] * (-392.232) [-390.241] (-394.476) (-391.408) -- 0:00:20
      660000 -- (-392.016) (-389.986) [-389.637] (-394.250) * (-389.954) [-393.473] (-391.432) (-393.504) -- 0:00:20

      Average standard deviation of split frequencies: 0.009053

      660500 -- (-391.530) (-389.945) [-390.037] (-390.605) * (-392.396) (-390.316) (-402.488) [-397.044] -- 0:00:20
      661000 -- [-391.749] (-389.952) (-392.233) (-391.621) * (-390.903) [-390.142] (-389.876) (-391.751) -- 0:00:20
      661500 -- (-389.977) [-389.861] (-392.980) (-395.974) * [-393.836] (-390.217) (-391.988) (-391.804) -- 0:00:20
      662000 -- (-395.179) [-392.117] (-394.019) (-391.938) * (-391.403) (-392.028) (-390.555) [-391.282] -- 0:00:20
      662500 -- (-392.321) [-392.049] (-393.906) (-390.798) * (-393.650) (-389.511) [-391.656] (-395.951) -- 0:00:20
      663000 -- [-389.975] (-390.948) (-393.632) (-390.734) * (-392.871) (-392.316) [-389.277] (-395.513) -- 0:00:20
      663500 -- (-389.961) (-391.307) [-393.093] (-390.729) * (-389.509) (-395.168) [-390.464] (-389.746) -- 0:00:20
      664000 -- (-392.134) [-390.919] (-392.353) (-390.972) * (-392.043) (-390.308) [-391.173] (-392.723) -- 0:00:20
      664500 -- [-393.567] (-390.534) (-390.776) (-394.842) * (-396.225) [-390.661] (-392.387) (-391.896) -- 0:00:20
      665000 -- (-389.655) [-389.908] (-393.456) (-390.375) * (-390.522) [-392.825] (-390.915) (-390.267) -- 0:00:20

      Average standard deviation of split frequencies: 0.009511

      665500 -- (-392.793) [-389.582] (-391.061) (-390.245) * [-392.814] (-389.518) (-391.762) (-393.202) -- 0:00:20
      666000 -- (-390.347) (-392.130) [-390.646] (-396.172) * (-392.591) [-391.328] (-389.524) (-390.892) -- 0:00:20
      666500 -- [-392.183] (-389.419) (-394.014) (-390.839) * (-393.662) (-390.077) [-389.239] (-392.079) -- 0:00:20
      667000 -- [-391.828] (-393.011) (-389.906) (-391.979) * [-392.631] (-390.287) (-392.716) (-390.062) -- 0:00:20
      667500 -- (-390.300) (-389.859) [-392.642] (-391.094) * [-395.561] (-393.235) (-392.416) (-393.367) -- 0:00:20
      668000 -- (-390.309) (-391.196) (-391.626) [-389.117] * (-391.545) (-391.969) (-391.844) [-391.551] -- 0:00:20
      668500 -- (-391.520) (-392.164) (-389.764) [-389.475] * [-390.275] (-391.404) (-391.835) (-394.881) -- 0:00:20
      669000 -- (-392.059) (-396.967) [-390.365] (-390.836) * (-389.155) (-390.691) [-390.333] (-390.733) -- 0:00:20
      669500 -- [-390.100] (-391.053) (-392.928) (-389.843) * (-389.341) [-391.102] (-390.960) (-390.817) -- 0:00:20
      670000 -- (-390.229) (-390.367) (-396.089) [-391.825] * [-392.267] (-389.130) (-389.522) (-391.968) -- 0:00:20

      Average standard deviation of split frequencies: 0.009401

      670500 -- (-391.180) (-392.713) (-394.912) [-391.090] * (-390.898) (-390.260) (-391.879) [-392.061] -- 0:00:20
      671000 -- [-392.896] (-389.505) (-392.996) (-391.100) * (-390.741) (-390.180) [-391.306] (-390.930) -- 0:00:20
      671500 -- (-390.003) [-392.609] (-393.414) (-391.595) * (-391.442) [-392.203] (-392.656) (-392.023) -- 0:00:20
      672000 -- (-391.746) [-391.020] (-392.280) (-389.246) * (-390.850) (-391.214) [-393.019] (-396.042) -- 0:00:20
      672500 -- [-391.536] (-390.539) (-392.510) (-390.551) * (-396.794) (-390.935) [-391.376] (-391.361) -- 0:00:19
      673000 -- [-393.696] (-393.076) (-389.283) (-390.543) * (-392.572) (-393.303) [-390.657] (-389.782) -- 0:00:19
      673500 -- (-391.319) (-393.718) [-390.680] (-394.992) * (-389.255) (-390.501) (-392.272) [-390.080] -- 0:00:19
      674000 -- [-390.330] (-391.428) (-396.293) (-393.882) * (-391.289) (-395.863) [-391.976] (-390.022) -- 0:00:19
      674500 -- (-392.253) (-394.822) (-390.382) [-389.674] * (-391.425) (-394.524) [-394.752] (-391.080) -- 0:00:19
      675000 -- (-391.449) (-392.070) [-391.220] (-389.937) * (-393.007) (-391.043) (-392.054) [-395.963] -- 0:00:19

      Average standard deviation of split frequencies: 0.008848

      675500 -- (-390.109) [-393.308] (-392.059) (-392.379) * (-394.738) (-396.086) [-392.340] (-398.554) -- 0:00:19
      676000 -- (-390.318) (-394.228) (-392.091) [-394.517] * (-392.909) [-390.208] (-390.266) (-389.879) -- 0:00:19
      676500 -- [-394.197] (-392.139) (-391.260) (-390.737) * (-394.461) (-391.178) (-392.370) [-390.115] -- 0:00:19
      677000 -- (-393.971) (-392.029) [-389.503] (-392.718) * (-396.321) (-391.971) (-392.515) [-393.025] -- 0:00:19
      677500 -- [-390.225] (-392.364) (-389.507) (-391.095) * [-391.863] (-390.686) (-391.232) (-390.958) -- 0:00:19
      678000 -- (-392.946) (-392.516) [-390.225] (-393.715) * (-390.489) [-389.222] (-390.065) (-389.203) -- 0:00:19
      678500 -- (-390.949) (-392.401) [-390.164] (-391.915) * (-395.058) (-389.984) [-392.564] (-390.881) -- 0:00:19
      679000 -- (-393.836) [-390.727] (-390.391) (-394.268) * [-394.075] (-393.965) (-396.767) (-390.588) -- 0:00:19
      679500 -- (-392.669) [-391.078] (-391.918) (-395.869) * (-392.944) (-395.122) (-392.559) [-394.501] -- 0:00:19
      680000 -- (-391.012) [-392.393] (-391.888) (-393.432) * (-391.489) (-391.203) (-390.199) [-393.336] -- 0:00:19

      Average standard deviation of split frequencies: 0.009220

      680500 -- (-391.856) (-390.316) (-390.482) [-390.669] * [-389.897] (-391.271) (-391.456) (-397.757) -- 0:00:19
      681000 -- (-392.237) [-396.117] (-391.982) (-390.019) * (-391.301) (-389.789) [-390.104] (-390.732) -- 0:00:19
      681500 -- [-392.729] (-392.599) (-390.642) (-393.406) * (-391.959) (-390.105) (-390.606) [-391.908] -- 0:00:19
      682000 -- (-392.294) [-392.047] (-391.970) (-393.030) * [-393.854] (-390.016) (-391.355) (-393.011) -- 0:00:19
      682500 -- (-391.546) (-390.725) (-396.330) [-390.896] * (-395.210) (-389.829) [-389.671] (-392.405) -- 0:00:19
      683000 -- (-392.718) [-392.951] (-392.312) (-390.053) * [-391.729] (-391.659) (-391.166) (-391.078) -- 0:00:19
      683500 -- (-392.339) (-390.719) (-394.774) [-389.941] * (-390.071) (-390.338) (-391.398) [-391.371] -- 0:00:18
      684000 -- (-391.779) (-392.452) (-393.672) [-390.371] * (-390.486) (-391.864) (-391.023) [-392.795] -- 0:00:19
      684500 -- (-393.225) (-396.641) [-390.165] (-392.308) * [-392.872] (-392.023) (-391.849) (-391.263) -- 0:00:19
      685000 -- [-396.595] (-390.997) (-390.589) (-391.740) * (-389.778) [-392.234] (-392.291) (-391.680) -- 0:00:19

      Average standard deviation of split frequencies: 0.009105

      685500 -- (-390.186) [-393.069] (-389.995) (-390.930) * [-390.567] (-392.389) (-392.165) (-392.463) -- 0:00:19
      686000 -- [-393.540] (-391.029) (-395.296) (-392.066) * (-390.087) (-390.845) (-389.559) [-390.505] -- 0:00:19
      686500 -- [-389.626] (-390.355) (-391.269) (-392.853) * (-389.530) (-389.765) [-391.231] (-392.935) -- 0:00:19
      687000 -- (-390.011) (-390.305) (-392.052) [-395.824] * [-390.386] (-391.052) (-393.270) (-395.069) -- 0:00:19
      687500 -- (-389.902) (-393.039) [-393.382] (-395.728) * (-390.624) [-392.945] (-391.582) (-393.022) -- 0:00:19
      688000 -- (-389.832) (-391.202) [-390.733] (-393.837) * (-391.397) (-389.315) [-391.193] (-391.460) -- 0:00:19
      688500 -- (-390.755) (-390.456) [-390.607] (-391.494) * (-393.203) [-391.203] (-389.517) (-389.762) -- 0:00:19
      689000 -- (-392.098) (-389.822) [-390.413] (-395.392) * (-393.256) [-393.780] (-399.579) (-391.532) -- 0:00:18
      689500 -- (-391.187) [-395.231] (-395.019) (-395.170) * [-389.514] (-389.818) (-396.111) (-393.291) -- 0:00:18
      690000 -- (-395.380) (-395.816) (-393.846) [-390.625] * (-390.246) (-390.968) [-390.579] (-390.229) -- 0:00:18

      Average standard deviation of split frequencies: 0.008532

      690500 -- (-397.284) (-395.244) (-393.509) [-389.715] * (-389.553) (-391.707) [-394.524] (-389.952) -- 0:00:18
      691000 -- (-393.325) (-393.371) (-392.021) [-389.366] * (-389.337) (-389.881) [-390.592] (-390.634) -- 0:00:18
      691500 -- [-390.582] (-390.674) (-391.830) (-389.812) * (-389.999) [-391.193] (-394.086) (-391.460) -- 0:00:18
      692000 -- (-393.502) [-389.853] (-392.365) (-389.336) * (-391.719) (-390.006) [-390.183] (-392.249) -- 0:00:18
      692500 -- (-394.411) (-389.547) [-390.501] (-389.439) * [-392.748] (-395.806) (-391.735) (-393.415) -- 0:00:18
      693000 -- (-390.366) (-390.373) [-390.326] (-390.749) * [-393.035] (-398.741) (-396.837) (-390.238) -- 0:00:18
      693500 -- (-390.325) [-391.360] (-390.994) (-390.569) * (-390.078) [-391.770] (-395.108) (-389.305) -- 0:00:18
      694000 -- [-392.209] (-390.921) (-394.615) (-393.304) * (-392.290) (-392.704) [-392.150] (-390.476) -- 0:00:18
      694500 -- (-391.951) (-392.819) [-395.476] (-392.496) * (-393.363) [-392.637] (-391.941) (-391.303) -- 0:00:18
      695000 -- [-393.771] (-393.048) (-389.531) (-393.472) * [-390.524] (-391.703) (-391.287) (-393.293) -- 0:00:18

      Average standard deviation of split frequencies: 0.008297

      695500 -- [-395.672] (-391.406) (-392.432) (-391.607) * (-390.804) [-390.394] (-390.065) (-390.822) -- 0:00:18
      696000 -- (-396.744) (-395.130) [-392.011] (-390.308) * (-389.912) [-390.802] (-389.132) (-394.778) -- 0:00:18
      696500 -- (-398.746) [-391.509] (-390.100) (-390.102) * (-389.592) (-393.216) (-393.834) [-390.058] -- 0:00:18
      697000 -- (-394.900) [-392.694] (-391.121) (-395.612) * [-391.717] (-390.239) (-390.939) (-389.568) -- 0:00:18
      697500 -- (-391.821) (-394.625) (-392.284) [-390.993] * (-389.315) (-392.064) (-390.332) [-390.509] -- 0:00:18
      698000 -- (-391.261) [-389.388] (-390.133) (-394.471) * (-392.474) (-392.436) (-390.307) [-392.146] -- 0:00:18
      698500 -- [-392.818] (-389.762) (-390.364) (-392.445) * (-393.517) (-391.298) [-389.410] (-394.703) -- 0:00:18
      699000 -- (-392.720) [-392.581] (-391.036) (-395.157) * (-392.161) (-391.090) (-392.626) [-393.541] -- 0:00:18
      699500 -- (-392.323) [-392.289] (-389.762) (-390.593) * (-391.048) (-390.274) [-392.502] (-390.333) -- 0:00:18
      700000 -- (-393.618) (-392.994) [-389.902] (-392.283) * (-389.362) (-390.834) [-392.211] (-391.772) -- 0:00:18

      Average standard deviation of split frequencies: 0.008031

      700500 -- [-391.368] (-391.179) (-390.688) (-390.888) * (-390.309) [-391.136] (-392.323) (-391.525) -- 0:00:18
      701000 -- (-393.544) [-390.065] (-391.191) (-389.411) * (-389.969) (-390.960) (-391.007) [-389.698] -- 0:00:18
      701500 -- [-390.938] (-390.317) (-392.225) (-392.684) * (-392.057) (-391.894) (-393.803) [-390.777] -- 0:00:18
      702000 -- [-392.688] (-389.626) (-392.048) (-390.810) * (-391.406) [-390.776] (-390.713) (-391.694) -- 0:00:18
      702500 -- (-395.303) (-392.127) [-390.590] (-391.396) * (-391.480) (-392.027) (-390.468) [-390.147] -- 0:00:18
      703000 -- (-392.561) [-389.981] (-391.517) (-394.666) * (-391.219) (-392.655) (-389.690) [-391.781] -- 0:00:18
      703500 -- (-392.170) [-391.416] (-390.703) (-392.212) * (-391.211) [-390.011] (-389.397) (-394.352) -- 0:00:18
      704000 -- (-392.156) [-393.808] (-389.668) (-390.033) * [-389.572] (-390.908) (-390.251) (-391.127) -- 0:00:18
      704500 -- (-395.819) [-390.303] (-392.727) (-392.029) * (-390.432) [-390.534] (-391.034) (-391.289) -- 0:00:18
      705000 -- (-394.130) (-391.427) [-392.468] (-392.607) * [-390.049] (-392.489) (-393.421) (-391.261) -- 0:00:17

      Average standard deviation of split frequencies: 0.008096

      705500 -- (-391.080) (-395.962) (-391.197) [-393.827] * [-389.217] (-392.795) (-389.929) (-390.080) -- 0:00:17
      706000 -- (-389.478) [-393.124] (-393.937) (-390.120) * (-392.585) (-391.123) [-390.568] (-390.921) -- 0:00:17
      706500 -- (-391.643) [-389.431] (-391.288) (-390.229) * (-391.687) [-389.404] (-391.719) (-392.657) -- 0:00:17
      707000 -- (-394.441) (-389.884) (-390.038) [-394.583] * [-392.404] (-390.030) (-392.670) (-390.268) -- 0:00:17
      707500 -- (-393.791) (-389.661) (-392.591) [-390.061] * [-391.244] (-391.160) (-396.440) (-395.436) -- 0:00:17
      708000 -- [-390.871] (-394.682) (-397.473) (-391.414) * (-392.340) (-392.944) [-389.432] (-390.242) -- 0:00:17
      708500 -- [-390.164] (-394.345) (-392.561) (-392.927) * [-391.135] (-393.640) (-394.508) (-390.626) -- 0:00:17
      709000 -- [-389.770] (-393.666) (-399.192) (-391.967) * (-392.022) (-391.761) (-391.925) [-391.810] -- 0:00:17
      709500 -- (-390.232) [-391.769] (-392.371) (-391.552) * (-391.727) (-392.556) [-390.128] (-396.274) -- 0:00:17
      710000 -- (-389.904) [-390.126] (-389.871) (-389.730) * (-394.088) [-393.443] (-392.188) (-396.344) -- 0:00:17

      Average standard deviation of split frequencies: 0.007753

      710500 -- [-390.807] (-389.704) (-391.811) (-391.844) * (-392.171) [-389.978] (-391.923) (-390.392) -- 0:00:17
      711000 -- (-390.729) (-392.905) [-389.847] (-394.606) * (-392.070) [-392.724] (-391.401) (-390.377) -- 0:00:17
      711500 -- (-392.094) (-389.336) [-389.059] (-391.249) * [-392.084] (-390.912) (-390.089) (-390.025) -- 0:00:17
      712000 -- (-392.889) (-392.719) (-391.503) [-393.088] * (-392.696) (-391.598) [-390.786] (-389.734) -- 0:00:17
      712500 -- (-390.425) [-390.635] (-390.905) (-390.564) * [-389.781] (-389.450) (-393.369) (-391.195) -- 0:00:17
      713000 -- (-392.115) (-393.619) (-390.134) [-389.589] * (-391.389) [-389.626] (-390.894) (-389.709) -- 0:00:17
      713500 -- [-393.147] (-395.140) (-389.916) (-389.346) * (-391.246) (-393.008) (-390.401) [-389.395] -- 0:00:17
      714000 -- [-393.482] (-392.200) (-391.635) (-389.867) * (-392.015) (-390.117) [-390.014] (-390.023) -- 0:00:17
      714500 -- (-390.378) (-389.860) (-392.374) [-390.192] * (-392.343) [-390.283] (-390.677) (-394.650) -- 0:00:17
      715000 -- (-394.532) [-391.361] (-390.598) (-389.978) * (-392.187) (-397.468) [-394.973] (-392.352) -- 0:00:17

      Average standard deviation of split frequencies: 0.007448

      715500 -- [-390.038] (-391.770) (-391.756) (-391.159) * (-389.855) (-390.878) [-392.889] (-390.759) -- 0:00:17
      716000 -- (-391.517) (-390.559) [-392.632] (-390.537) * [-391.222] (-394.554) (-393.354) (-390.731) -- 0:00:17
      716500 -- [-391.791] (-392.134) (-393.186) (-389.904) * (-391.453) (-392.475) [-390.131] (-391.313) -- 0:00:17
      717000 -- [-389.779] (-390.711) (-393.520) (-391.437) * (-392.439) [-390.698] (-390.432) (-389.485) -- 0:00:16
      717500 -- (-391.068) [-390.052] (-394.727) (-393.884) * (-389.094) (-391.445) (-390.823) [-392.411] -- 0:00:16
      718000 -- [-390.601] (-392.447) (-391.409) (-392.034) * (-394.360) (-395.523) (-392.580) [-395.154] -- 0:00:17
      718500 -- (-392.048) (-392.378) (-393.278) [-390.558] * [-393.764] (-396.202) (-389.963) (-391.694) -- 0:00:17
      719000 -- (-392.688) [-390.431] (-391.051) (-390.277) * [-392.155] (-392.836) (-390.373) (-394.768) -- 0:00:17
      719500 -- (-394.585) (-391.544) [-391.242] (-390.402) * (-391.231) [-391.848] (-389.747) (-389.681) -- 0:00:17
      720000 -- (-389.498) (-389.758) [-389.653] (-390.241) * [-393.386] (-390.618) (-393.642) (-391.147) -- 0:00:17

      Average standard deviation of split frequencies: 0.007277

      720500 -- (-391.302) [-389.732] (-390.353) (-391.329) * [-390.420] (-389.959) (-391.923) (-390.745) -- 0:00:17
      721000 -- (-393.090) (-390.292) (-392.927) [-390.142] * (-394.519) (-389.481) (-393.103) [-389.938] -- 0:00:17
      721500 -- (-392.928) [-389.349] (-389.631) (-391.026) * (-389.455) [-390.012] (-390.811) (-392.359) -- 0:00:16
      722000 -- (-391.072) (-392.577) [-389.547] (-390.618) * (-392.665) [-390.371] (-392.545) (-395.032) -- 0:00:16
      722500 -- (-390.284) (-390.489) [-389.984] (-390.848) * (-390.809) (-391.149) (-389.978) [-390.643] -- 0:00:16
      723000 -- [-391.604] (-390.789) (-391.556) (-393.252) * (-392.301) [-391.447] (-390.036) (-390.647) -- 0:00:16
      723500 -- (-390.941) (-392.141) (-389.710) [-397.293] * (-394.913) (-391.096) (-393.738) [-390.796] -- 0:00:16
      724000 -- [-389.604] (-390.224) (-389.566) (-394.792) * (-393.774) (-395.452) [-392.121] (-392.111) -- 0:00:16
      724500 -- (-393.522) [-390.480] (-393.535) (-392.583) * (-393.250) (-395.940) (-391.054) [-390.705] -- 0:00:16
      725000 -- (-391.138) (-390.840) [-391.190] (-390.504) * (-395.065) [-393.074] (-389.558) (-393.084) -- 0:00:16

      Average standard deviation of split frequencies: 0.007548

      725500 -- (-392.533) (-390.065) (-390.554) [-394.245] * (-392.595) (-389.706) [-390.465] (-391.209) -- 0:00:16
      726000 -- (-392.908) (-391.369) (-390.612) [-397.297] * (-396.846) [-390.194] (-391.638) (-389.396) -- 0:00:16
      726500 -- (-395.475) (-393.649) (-392.050) [-392.250] * [-391.227] (-391.875) (-390.592) (-389.772) -- 0:00:16
      727000 -- (-393.896) (-391.989) [-390.405] (-390.954) * (-393.246) [-390.898] (-389.554) (-391.985) -- 0:00:16
      727500 -- [-391.670] (-390.616) (-391.042) (-390.780) * (-390.575) [-390.934] (-394.360) (-393.317) -- 0:00:16
      728000 -- (-392.492) [-389.762] (-390.997) (-391.662) * [-389.417] (-394.789) (-392.298) (-391.596) -- 0:00:16
      728500 -- (-390.172) (-391.642) [-393.132] (-394.025) * (-389.589) (-392.308) (-392.238) [-393.458] -- 0:00:16
      729000 -- [-391.634] (-392.270) (-390.922) (-392.945) * (-390.932) (-389.912) [-392.135] (-394.965) -- 0:00:16
      729500 -- [-393.605] (-392.376) (-390.303) (-389.675) * (-392.123) [-391.083] (-391.991) (-393.757) -- 0:00:16
      730000 -- (-401.351) (-393.225) [-389.690] (-390.443) * (-394.186) (-396.823) (-391.499) [-391.322] -- 0:00:16

      Average standard deviation of split frequencies: 0.007863

      730500 -- (-394.176) (-390.382) (-390.547) [-390.194] * (-393.359) [-390.885] (-392.441) (-394.780) -- 0:00:16
      731000 -- (-395.832) (-396.123) (-392.821) [-389.635] * [-391.016] (-389.809) (-389.970) (-391.035) -- 0:00:16
      731500 -- (-395.153) [-390.406] (-391.541) (-390.929) * (-391.602) [-390.169] (-392.731) (-389.889) -- 0:00:16
      732000 -- (-395.477) (-392.225) [-390.903] (-391.978) * [-390.075] (-391.604) (-389.095) (-394.349) -- 0:00:16
      732500 -- (-390.982) [-391.810] (-392.126) (-390.065) * (-392.599) (-390.551) [-391.460] (-392.602) -- 0:00:16
      733000 -- (-389.993) (-390.380) (-393.466) [-390.874] * [-391.887] (-389.913) (-389.476) (-396.166) -- 0:00:16
      733500 -- (-399.453) (-389.942) (-391.031) [-393.391] * (-390.212) (-390.002) [-389.310] (-393.903) -- 0:00:15
      734000 -- (-391.406) (-389.993) (-391.754) [-392.780] * (-390.580) (-389.525) (-393.645) [-390.497] -- 0:00:15
      734500 -- (-392.522) (-392.496) [-391.233] (-392.603) * (-390.359) [-392.132] (-393.452) (-390.415) -- 0:00:15
      735000 -- (-392.209) (-392.839) [-391.213] (-391.956) * (-391.564) (-390.443) (-391.185) [-390.998] -- 0:00:15

      Average standard deviation of split frequencies: 0.007806

      735500 -- [-389.548] (-393.712) (-391.409) (-390.444) * (-389.548) (-390.520) (-394.642) [-389.365] -- 0:00:16
      736000 -- (-392.574) (-389.416) (-393.667) [-391.288] * (-391.186) (-391.373) [-390.746] (-391.289) -- 0:00:16
      736500 -- (-391.528) (-391.331) [-393.315] (-391.069) * [-393.138] (-395.408) (-393.517) (-389.282) -- 0:00:16
      737000 -- (-390.599) (-389.593) [-395.097] (-395.153) * [-390.560] (-396.209) (-389.817) (-391.208) -- 0:00:16
      737500 -- [-391.615] (-391.144) (-393.785) (-391.011) * (-390.658) (-393.232) [-389.092] (-389.895) -- 0:00:16
      738000 -- [-394.223] (-390.142) (-393.485) (-391.127) * (-390.953) (-390.678) (-391.621) [-391.471] -- 0:00:15
      738500 -- (-393.508) [-391.924] (-391.006) (-397.571) * (-393.495) (-391.928) [-390.463] (-390.022) -- 0:00:15
      739000 -- (-391.133) [-395.173] (-392.123) (-391.615) * (-391.617) (-391.345) (-392.869) [-390.306] -- 0:00:15
      739500 -- [-393.327] (-390.228) (-389.636) (-392.604) * (-389.945) [-391.532] (-393.802) (-391.691) -- 0:00:15
      740000 -- (-393.116) (-391.746) [-390.504] (-391.965) * [-392.217] (-393.789) (-392.110) (-390.141) -- 0:00:15

      Average standard deviation of split frequencies: 0.007638

      740500 -- (-391.135) [-392.132] (-390.183) (-394.008) * [-389.381] (-395.535) (-391.225) (-391.228) -- 0:00:15
      741000 -- (-391.324) (-390.437) [-390.251] (-393.667) * [-390.145] (-393.769) (-390.546) (-394.957) -- 0:00:15
      741500 -- (-389.741) (-393.179) (-390.038) [-392.209] * [-392.281] (-393.109) (-390.351) (-391.695) -- 0:00:15
      742000 -- (-390.514) [-391.413] (-391.499) (-393.231) * [-391.993] (-392.239) (-394.580) (-394.252) -- 0:00:15
      742500 -- (-391.408) [-390.672] (-391.586) (-390.843) * (-392.745) (-394.614) (-396.971) [-390.232] -- 0:00:15
      743000 -- (-393.530) [-391.387] (-389.833) (-391.940) * (-392.214) [-395.879] (-390.593) (-389.910) -- 0:00:15
      743500 -- (-394.013) (-390.332) (-391.212) [-392.442] * (-390.369) (-393.880) (-389.981) [-392.070] -- 0:00:15
      744000 -- (-393.962) [-391.054] (-392.102) (-390.890) * (-390.967) (-394.660) (-391.412) [-391.031] -- 0:00:15
      744500 -- (-388.957) (-390.686) (-391.176) [-391.739] * (-393.531) (-392.136) (-390.768) [-390.718] -- 0:00:15
      745000 -- (-389.394) [-391.810] (-391.893) (-393.646) * (-392.923) [-395.180] (-390.503) (-389.787) -- 0:00:15

      Average standard deviation of split frequencies: 0.008257

      745500 -- (-389.253) [-391.880] (-391.666) (-389.071) * [-391.789] (-392.682) (-390.874) (-391.378) -- 0:00:15
      746000 -- (-391.543) [-390.798] (-390.486) (-391.119) * (-392.664) (-391.662) [-392.548] (-390.278) -- 0:00:15
      746500 -- [-392.847] (-390.717) (-392.850) (-389.791) * (-394.217) (-398.894) [-395.331] (-391.940) -- 0:00:15
      747000 -- [-389.842] (-391.304) (-393.814) (-391.046) * (-390.474) [-391.651] (-392.260) (-392.898) -- 0:00:15
      747500 -- (-394.580) (-391.383) (-389.572) [-391.143] * (-390.255) (-390.414) [-393.558] (-393.860) -- 0:00:15
      748000 -- (-392.702) (-392.105) (-392.985) [-392.292] * (-393.199) (-392.779) [-389.875] (-391.769) -- 0:00:15
      748500 -- [-391.532] (-392.300) (-393.363) (-390.517) * (-391.523) (-389.054) [-391.960] (-390.544) -- 0:00:15
      749000 -- [-392.285] (-390.077) (-391.318) (-390.443) * (-390.958) [-394.219] (-390.380) (-390.200) -- 0:00:15
      749500 -- (-391.390) (-391.672) [-389.910] (-389.389) * (-393.070) [-392.327] (-391.752) (-392.802) -- 0:00:15
      750000 -- [-390.729] (-396.371) (-392.816) (-392.264) * (-394.829) (-392.051) [-390.399] (-394.098) -- 0:00:15

      Average standard deviation of split frequencies: 0.008331

      750500 -- (-390.991) (-395.203) (-392.669) [-393.530] * (-391.881) (-391.810) [-390.770] (-394.037) -- 0:00:14
      751000 -- (-392.075) (-392.496) (-391.197) [-391.478] * [-390.125] (-393.232) (-391.958) (-394.642) -- 0:00:14
      751500 -- (-390.998) [-394.918] (-391.249) (-389.608) * (-390.155) [-390.295] (-392.325) (-394.086) -- 0:00:14
      752000 -- (-389.385) (-390.566) (-395.762) [-389.960] * [-390.852] (-393.414) (-391.206) (-392.700) -- 0:00:14
      752500 -- [-389.374] (-393.900) (-390.075) (-391.198) * (-389.173) (-392.295) [-389.821] (-391.402) -- 0:00:15
      753000 -- (-391.627) (-398.449) (-392.438) [-390.366] * (-389.384) (-390.917) [-391.416] (-393.251) -- 0:00:15
      753500 -- [-391.025] (-391.469) (-394.073) (-392.164) * (-389.330) (-393.233) [-392.536] (-392.041) -- 0:00:15
      754000 -- (-390.352) (-395.936) (-398.898) [-389.758] * (-391.425) (-391.291) [-393.230] (-393.848) -- 0:00:15
      754500 -- (-389.687) [-390.520] (-390.630) (-390.451) * (-395.757) [-390.803] (-391.513) (-392.595) -- 0:00:14
      755000 -- (-391.020) (-390.207) [-390.312] (-394.418) * (-392.342) (-391.896) [-389.890] (-390.057) -- 0:00:14

      Average standard deviation of split frequencies: 0.008065

      755500 -- (-391.590) (-390.650) [-391.912] (-390.263) * (-389.580) (-390.342) (-390.560) [-391.018] -- 0:00:14
      756000 -- (-390.513) (-390.824) [-395.000] (-389.935) * [-391.057] (-391.906) (-392.485) (-390.642) -- 0:00:14
      756500 -- (-389.612) (-389.952) (-391.026) [-391.880] * (-394.619) (-394.133) (-392.301) [-389.258] -- 0:00:14
      757000 -- (-390.841) (-391.624) (-391.140) [-390.521] * (-395.567) (-392.795) (-389.865) [-390.233] -- 0:00:14
      757500 -- (-392.106) [-389.745] (-390.985) (-390.280) * (-394.609) (-391.515) [-390.113] (-390.770) -- 0:00:14
      758000 -- (-390.007) (-395.667) (-389.952) [-391.532] * [-396.819] (-391.578) (-390.668) (-390.100) -- 0:00:14
      758500 -- [-395.253] (-391.362) (-389.538) (-391.782) * (-390.276) (-390.884) (-392.384) [-390.391] -- 0:00:14
      759000 -- [-390.475] (-393.219) (-392.454) (-391.926) * (-389.750) (-390.185) (-391.031) [-390.602] -- 0:00:14
      759500 -- [-390.929] (-391.327) (-393.075) (-393.967) * [-392.746] (-390.119) (-390.447) (-389.607) -- 0:00:14
      760000 -- (-394.562) (-391.968) (-389.784) [-392.350] * (-391.357) [-391.885] (-389.255) (-390.786) -- 0:00:14

      Average standard deviation of split frequencies: 0.007602

      760500 -- (-393.479) (-392.552) (-390.182) [-390.067] * (-391.743) [-399.178] (-390.086) (-393.736) -- 0:00:14
      761000 -- (-389.310) (-390.226) [-395.050] (-391.470) * [-390.121] (-392.332) (-389.442) (-390.260) -- 0:00:14
      761500 -- (-391.446) (-391.594) (-391.696) [-390.504] * [-389.748] (-398.170) (-390.874) (-394.806) -- 0:00:14
      762000 -- (-391.419) (-391.506) [-390.533] (-391.521) * (-389.899) (-391.597) [-390.758] (-389.545) -- 0:00:14
      762500 -- (-392.715) (-391.501) [-391.151] (-390.624) * (-390.749) [-389.085] (-389.775) (-390.174) -- 0:00:14
      763000 -- (-393.609) [-391.832] (-391.225) (-392.102) * (-390.788) (-389.170) [-393.607] (-390.380) -- 0:00:14
      763500 -- (-391.769) (-389.749) [-392.148] (-389.758) * (-394.435) (-391.811) [-390.582] (-390.294) -- 0:00:14
      764000 -- (-390.938) (-389.692) (-394.232) [-389.908] * (-394.087) (-389.017) [-393.250] (-390.312) -- 0:00:14
      764500 -- (-391.754) (-391.956) [-391.552] (-396.244) * (-390.241) (-389.765) (-390.373) [-390.597] -- 0:00:14
      765000 -- [-390.864] (-394.210) (-391.957) (-389.788) * (-391.258) [-389.769] (-390.508) (-391.135) -- 0:00:14

      Average standard deviation of split frequencies: 0.007836

      765500 -- [-391.267] (-392.230) (-389.344) (-391.133) * (-395.375) (-390.622) [-390.026] (-392.833) -- 0:00:14
      766000 -- (-390.850) [-390.393] (-392.733) (-391.718) * [-390.811] (-393.241) (-390.614) (-396.595) -- 0:00:14
      766500 -- (-392.245) (-392.417) (-391.167) [-389.432] * [-391.347] (-391.590) (-390.755) (-392.808) -- 0:00:14
      767000 -- (-390.738) [-392.834] (-393.329) (-394.267) * [-396.392] (-392.668) (-391.611) (-389.180) -- 0:00:13
      767500 -- (-391.901) [-393.948] (-392.880) (-392.503) * (-390.957) (-394.273) (-392.055) [-390.444] -- 0:00:13
      768000 -- (-391.270) (-393.544) (-392.560) [-393.753] * (-390.752) [-392.374] (-398.277) (-392.882) -- 0:00:13
      768500 -- (-392.995) (-390.246) (-391.095) [-392.577] * [-391.864] (-391.577) (-390.287) (-391.089) -- 0:00:13
      769000 -- (-391.058) (-390.257) (-389.670) [-391.889] * (-395.479) (-390.290) (-390.560) [-393.302] -- 0:00:13
      769500 -- (-390.398) (-389.778) (-389.662) [-392.072] * [-395.048] (-390.326) (-390.052) (-392.040) -- 0:00:14
      770000 -- [-391.751] (-391.550) (-389.700) (-395.056) * (-390.634) [-392.149] (-390.355) (-389.155) -- 0:00:14

      Average standard deviation of split frequencies: 0.008400

      770500 -- (-395.518) [-394.718] (-390.996) (-390.985) * (-394.378) (-390.962) [-393.265] (-393.597) -- 0:00:13
      771000 -- [-390.407] (-390.806) (-390.779) (-390.912) * [-391.812] (-393.877) (-390.234) (-394.255) -- 0:00:13
      771500 -- (-393.882) [-395.150] (-390.321) (-393.028) * (-391.026) (-389.182) (-392.737) [-392.730] -- 0:00:13
      772000 -- (-392.624) (-391.426) (-390.043) [-389.921] * [-391.373] (-389.660) (-395.954) (-391.483) -- 0:00:13
      772500 -- (-391.284) (-392.648) (-389.948) [-389.468] * (-391.048) [-390.468] (-396.118) (-389.864) -- 0:00:13
      773000 -- (-389.497) [-389.902] (-392.137) (-389.213) * (-393.212) [-394.108] (-391.529) (-391.111) -- 0:00:13
      773500 -- [-391.221] (-390.186) (-391.502) (-389.212) * (-391.115) (-389.741) (-394.683) [-391.434] -- 0:00:13
      774000 -- (-391.263) (-389.804) [-390.863] (-392.098) * (-391.217) (-393.659) [-389.875] (-394.413) -- 0:00:13
      774500 -- (-393.748) [-391.551] (-389.714) (-391.922) * [-391.153] (-392.151) (-391.076) (-391.451) -- 0:00:13
      775000 -- [-395.228] (-391.892) (-389.675) (-392.992) * [-394.642] (-389.703) (-392.176) (-390.957) -- 0:00:13

      Average standard deviation of split frequencies: 0.008788

      775500 -- (-393.038) (-391.978) [-390.010] (-393.804) * (-391.506) [-390.470] (-391.837) (-391.718) -- 0:00:13
      776000 -- (-393.004) (-392.865) [-391.135] (-390.904) * [-391.947] (-391.181) (-390.191) (-390.612) -- 0:00:13
      776500 -- [-392.140] (-392.163) (-391.466) (-390.267) * (-390.505) (-395.241) [-393.746] (-389.733) -- 0:00:13
      777000 -- (-391.676) (-390.763) (-393.895) [-391.150] * (-389.414) [-392.538] (-394.235) (-391.364) -- 0:00:13
      777500 -- (-390.099) (-389.654) [-390.775] (-391.609) * (-390.720) (-392.806) [-394.085] (-389.587) -- 0:00:13
      778000 -- (-390.595) [-391.486] (-393.243) (-390.260) * (-393.769) [-390.410] (-394.636) (-389.440) -- 0:00:13
      778500 -- (-396.878) [-393.801] (-389.640) (-391.680) * (-393.022) (-392.082) [-392.112] (-391.180) -- 0:00:13
      779000 -- (-391.056) (-394.185) [-394.426] (-393.088) * (-392.028) (-391.277) (-391.634) [-389.532] -- 0:00:13
      779500 -- (-390.206) (-390.625) (-392.209) [-390.347] * (-390.689) [-393.032] (-391.875) (-389.239) -- 0:00:13
      780000 -- [-389.314] (-391.125) (-389.671) (-392.219) * (-392.194) [-390.144] (-391.008) (-390.693) -- 0:00:13

      Average standard deviation of split frequencies: 0.008534

      780500 -- [-389.761] (-392.385) (-391.446) (-389.743) * (-391.701) [-389.642] (-394.254) (-390.410) -- 0:00:13
      781000 -- [-392.125] (-390.448) (-392.974) (-391.694) * [-393.586] (-389.913) (-391.479) (-395.072) -- 0:00:13
      781500 -- [-389.603] (-391.821) (-392.705) (-389.948) * (-389.109) (-390.884) [-389.997] (-396.256) -- 0:00:13
      782000 -- [-391.195] (-392.788) (-395.832) (-391.140) * [-393.864] (-389.540) (-391.103) (-392.781) -- 0:00:13
      782500 -- (-392.937) [-389.525] (-392.025) (-389.778) * (-396.455) [-390.619] (-390.148) (-393.407) -- 0:00:13
      783000 -- (-391.940) (-390.380) [-390.358] (-390.440) * (-393.608) (-390.263) (-393.498) [-390.479] -- 0:00:13
      783500 -- (-393.235) (-391.510) (-392.776) [-394.320] * (-393.889) (-392.161) [-389.818] (-393.087) -- 0:00:12
      784000 -- (-390.189) (-391.497) [-389.917] (-392.894) * (-392.217) (-393.386) (-391.155) [-390.534] -- 0:00:12
      784500 -- (-390.766) (-393.826) [-392.513] (-391.264) * (-392.019) (-393.418) [-390.310] (-392.870) -- 0:00:12
      785000 -- (-392.243) (-394.753) (-394.143) [-390.004] * (-392.342) (-393.830) (-391.887) [-389.246] -- 0:00:12

      Average standard deviation of split frequencies: 0.008434

      785500 -- (-389.839) (-390.962) (-391.998) [-390.149] * (-392.930) (-393.844) (-394.214) [-391.108] -- 0:00:12
      786000 -- (-394.480) (-391.414) (-392.613) [-391.715] * (-393.633) (-394.494) [-399.055] (-389.866) -- 0:00:12
      786500 -- [-390.566] (-389.155) (-392.566) (-389.940) * (-395.434) [-389.845] (-391.723) (-389.314) -- 0:00:13
      787000 -- [-391.167] (-394.253) (-394.288) (-390.017) * (-393.260) (-393.097) [-391.516] (-391.247) -- 0:00:12
      787500 -- [-390.078] (-390.167) (-392.487) (-392.594) * [-392.470] (-388.954) (-395.426) (-391.044) -- 0:00:12
      788000 -- (-393.231) (-390.507) (-392.109) [-393.029] * (-393.584) [-389.883] (-394.182) (-392.174) -- 0:00:12
      788500 -- (-398.792) (-391.048) [-392.421] (-391.434) * (-391.588) (-389.796) [-393.699] (-392.829) -- 0:00:12
      789000 -- (-392.234) (-390.197) [-392.874] (-394.219) * [-395.569] (-389.738) (-393.298) (-395.298) -- 0:00:12
      789500 -- (-394.049) (-390.157) (-391.195) [-391.674] * (-392.674) (-394.334) [-401.481] (-394.136) -- 0:00:12
      790000 -- (-402.230) (-390.556) [-390.469] (-389.502) * (-389.191) (-393.520) (-394.520) [-395.388] -- 0:00:12

      Average standard deviation of split frequencies: 0.008347

      790500 -- (-392.284) (-389.860) [-389.852] (-392.824) * (-390.546) (-392.640) [-393.054] (-390.648) -- 0:00:12
      791000 -- (-390.363) (-393.727) [-389.504] (-394.012) * (-390.526) (-392.841) (-390.906) [-392.496] -- 0:00:12
      791500 -- (-392.940) (-394.509) [-391.294] (-390.392) * (-390.531) [-390.895] (-390.932) (-392.890) -- 0:00:12
      792000 -- (-390.744) [-390.869] (-390.851) (-389.943) * (-394.316) (-392.507) [-390.874] (-390.967) -- 0:00:12
      792500 -- (-391.802) (-390.657) (-390.892) [-395.734] * [-393.632] (-390.351) (-390.060) (-390.516) -- 0:00:12
      793000 -- [-392.721] (-392.118) (-393.816) (-391.280) * (-390.993) (-391.449) [-393.309] (-392.760) -- 0:00:12
      793500 -- [-392.571] (-392.381) (-389.763) (-392.723) * [-392.346] (-396.404) (-390.472) (-391.036) -- 0:00:12
      794000 -- [-393.233] (-393.153) (-391.671) (-390.233) * (-390.853) (-390.999) (-390.981) [-389.974] -- 0:00:12
      794500 -- [-390.829] (-392.897) (-394.298) (-395.259) * (-390.710) (-389.949) [-389.589] (-389.722) -- 0:00:12
      795000 -- (-390.326) (-390.051) (-390.069) [-389.892] * (-392.407) (-390.057) (-392.562) [-397.565] -- 0:00:12

      Average standard deviation of split frequencies: 0.008686

      795500 -- (-394.153) (-392.449) (-390.616) [-390.868] * [-391.069] (-390.495) (-390.326) (-389.855) -- 0:00:12
      796000 -- (-393.935) (-390.325) (-391.530) [-391.193] * (-391.330) (-391.265) (-392.427) [-389.179] -- 0:00:12
      796500 -- (-390.388) (-389.948) (-395.010) [-391.267] * (-390.265) (-390.261) (-391.349) [-391.880] -- 0:00:12
      797000 -- (-392.133) [-390.962] (-396.166) (-390.884) * [-389.837] (-392.444) (-392.850) (-390.740) -- 0:00:12
      797500 -- (-393.980) [-392.165] (-394.018) (-394.012) * [-392.238] (-392.966) (-392.628) (-392.050) -- 0:00:12
      798000 -- (-391.307) (-390.849) [-390.496] (-390.822) * [-394.076] (-390.309) (-390.490) (-390.926) -- 0:00:12
      798500 -- (-393.712) (-389.120) [-391.029] (-393.612) * [-393.354] (-390.718) (-394.143) (-390.269) -- 0:00:12
      799000 -- (-391.664) (-389.833) [-391.103] (-393.535) * (-391.099) (-390.972) [-390.745] (-393.