--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:05:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1607/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.62 -394.63
2 -390.60 -395.00
--------------------------------------
TOTAL -390.61 -394.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898012 0.090087 0.366441 1.483847 0.870130 1277.07 1362.65 1.000
r(A<->C){all} 0.163706 0.020485 0.000011 0.461322 0.123866 128.64 191.47 1.003
r(A<->G){all} 0.174655 0.021276 0.000064 0.474495 0.134779 202.12 224.97 1.000
r(A<->T){all} 0.169908 0.021360 0.000077 0.459273 0.131684 222.98 230.92 1.002
r(C<->G){all} 0.164915 0.018676 0.000015 0.442295 0.127004 196.10 199.90 1.006
r(C<->T){all} 0.164712 0.020209 0.000007 0.448557 0.126708 185.66 198.41 1.010
r(G<->T){all} 0.162105 0.018823 0.000007 0.431085 0.124892 188.06 276.22 1.001
pi(A){all} 0.188399 0.000540 0.146031 0.236961 0.187837 1164.96 1278.56 1.000
pi(C){all} 0.226211 0.000585 0.178264 0.271718 0.225784 1283.23 1324.82 1.000
pi(G){all} 0.366239 0.000796 0.313485 0.421524 0.366110 1082.11 1240.89 1.000
pi(T){all} 0.219152 0.000594 0.172697 0.266847 0.219326 1080.27 1178.14 1.001
alpha{1,2} 0.411381 0.221647 0.000129 1.345447 0.245221 1301.82 1332.70 1.000
alpha{3} 0.461645 0.225800 0.000166 1.476337 0.307520 983.51 1054.78 1.000
pinvar{all} 0.994342 0.000045 0.981647 0.999995 0.996460 959.24 1057.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -377.466061
Model 2: PositiveSelection -377.466197
Model 0: one-ratio -377.466229
Model 7: beta -377.466061
Model 8: beta&w>1 -377.466061
Model 0 vs 1 3.359999999474894E-4
Model 2 vs 1 2.7199999999538704E-4
Model 8 vs 7 0.0
>C1
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C2
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C3
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C4
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C5
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C6
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96
C1 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C2 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C3 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C4 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C5 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C6 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
**************************************************
C1 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C2 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C3 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C4 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C5 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C6 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2880]--->[2880]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C2 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C3 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C4 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C5 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
C6 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
**************************************************
C1 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C2 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C3 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C4 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C5 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
C6 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C2 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C3 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C4 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C5 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
C6 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
**************************************************
C1 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C2 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C3 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C4 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C5 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
C6 GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
**************************************************
C1 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C2 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C3 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C4 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C5 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
C6 GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
**************************************************
C1 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C2 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C3 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C4 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C5 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
C6 GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
**************************************************
C1 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C2 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C3 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C4 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C5 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
C6 GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
**************************************************
C1 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C2 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C3 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C4 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C5 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
C6 GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
**************************************
>C1
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C2
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C3
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C4
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C5
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C6
ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA
GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT
GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG
GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT
GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT
GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>C1
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C2
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C3
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C4
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C5
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
>C6
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 288 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856628
Setting output file names to "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 276675435
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5448277417
Seed = 1945043070
Swapseed = 1579856628
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -644.557766 -- -24.965149
Chain 2 -- -644.557804 -- -24.965149
Chain 3 -- -644.557706 -- -24.965149
Chain 4 -- -644.557706 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -644.557804 -- -24.965149
Chain 2 -- -644.557766 -- -24.965149
Chain 3 -- -644.557804 -- -24.965149
Chain 4 -- -644.557804 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558)
500 -- (-403.384) [-395.874] (-404.161) (-412.857) * [-395.007] (-411.332) (-406.449) (-400.486) -- 0:33:19
1000 -- (-404.848) (-400.072) [-399.984] (-406.318) * (-403.736) [-401.128] (-407.497) (-404.779) -- 0:16:39
1500 -- [-396.591] (-407.590) (-401.124) (-401.982) * (-395.750) [-403.902] (-398.997) (-404.317) -- 0:11:05
2000 -- [-402.775] (-403.947) (-397.022) (-398.672) * (-398.383) (-395.186) (-402.179) [-394.756] -- 0:08:19
2500 -- (-399.446) (-398.333) (-398.067) [-394.663] * (-395.697) (-400.892) [-400.886] (-394.906) -- 0:06:39
3000 -- (-398.765) (-397.545) [-400.943] (-416.756) * (-403.968) [-400.297] (-400.828) (-399.074) -- 0:05:32
3500 -- (-399.234) (-398.037) [-395.431] (-399.661) * (-401.980) (-397.626) [-400.630] (-403.152) -- 0:04:44
4000 -- (-397.699) (-399.503) [-398.798] (-400.823) * (-400.706) (-405.461) [-399.286] (-407.341) -- 0:04:09
4500 -- (-412.937) (-395.139) (-401.098) [-404.608] * (-395.791) (-404.884) [-396.759] (-402.342) -- 0:03:41
5000 -- (-404.522) [-397.781] (-401.040) (-403.899) * [-394.175] (-401.032) (-400.692) (-406.821) -- 0:03:19
Average standard deviation of split frequencies: 0.142850
5500 -- (-394.421) (-402.614) (-400.540) [-397.131] * (-404.469) (-406.291) [-400.956] (-400.860) -- 0:03:00
6000 -- (-391.512) (-399.641) (-398.381) [-396.790] * [-400.177] (-402.091) (-407.833) (-400.127) -- 0:02:45
6500 -- [-390.856] (-400.761) (-398.393) (-396.768) * (-405.356) [-396.262] (-398.771) (-402.162) -- 0:02:32
7000 -- [-391.113] (-413.786) (-398.709) (-402.730) * (-403.972) (-396.484) [-398.277] (-404.831) -- 0:02:21
7500 -- (-392.868) (-395.122) (-396.619) [-400.006] * (-407.784) [-398.410] (-402.159) (-403.768) -- 0:02:12
8000 -- (-390.241) (-398.917) (-398.514) [-400.748] * (-406.790) [-404.856] (-398.882) (-404.646) -- 0:02:04
8500 -- (-392.279) [-397.624] (-400.337) (-399.583) * (-417.983) [-396.282] (-410.218) (-400.985) -- 0:01:56
9000 -- (-391.984) (-404.367) (-405.554) [-403.813] * (-401.653) (-398.905) [-403.185] (-389.642) -- 0:01:50
9500 -- (-392.198) (-398.676) (-417.884) [-398.126] * (-392.836) [-398.403] (-400.292) (-389.185) -- 0:01:44
10000 -- [-393.880] (-399.141) (-402.277) (-401.753) * (-390.631) [-399.422] (-397.906) (-393.419) -- 0:01:39
Average standard deviation of split frequencies: 0.081759
10500 -- (-391.003) [-398.714] (-398.290) (-402.153) * [-389.439] (-406.535) (-400.197) (-392.323) -- 0:01:34
11000 -- (-392.758) (-406.154) (-395.170) [-403.618] * (-394.147) [-397.435] (-411.073) (-392.445) -- 0:01:29
11500 -- (-400.978) [-399.407] (-410.088) (-401.692) * (-392.742) [-395.880] (-402.305) (-391.790) -- 0:01:25
12000 -- (-394.747) [-396.777] (-398.766) (-396.529) * (-392.559) (-395.956) (-409.653) [-394.214] -- 0:01:22
12500 -- [-392.715] (-395.287) (-397.099) (-409.340) * [-391.224] (-403.457) (-416.431) (-391.318) -- 0:01:19
13000 -- [-391.813] (-398.649) (-401.966) (-395.644) * (-393.389) [-397.099] (-406.900) (-390.900) -- 0:01:15
13500 -- [-393.216] (-399.907) (-403.523) (-407.877) * [-390.908] (-399.074) (-406.672) (-391.400) -- 0:01:13
14000 -- (-394.821) (-403.814) [-398.536] (-402.078) * (-390.861) (-399.126) (-410.221) [-390.198] -- 0:01:10
14500 -- (-391.606) (-399.792) [-400.763] (-398.453) * (-390.211) (-401.509) (-408.297) [-391.471] -- 0:01:07
15000 -- (-390.092) [-402.077] (-402.162) (-400.682) * (-390.250) [-400.801] (-403.929) (-391.170) -- 0:01:05
Average standard deviation of split frequencies: 0.065128
15500 -- (-392.155) (-395.107) (-401.256) [-402.684] * (-391.083) (-398.663) [-395.432] (-391.461) -- 0:01:03
16000 -- (-393.304) (-410.736) [-404.824] (-405.695) * (-390.669) (-398.632) [-391.683] (-391.440) -- 0:01:01
16500 -- (-392.988) (-399.068) (-406.703) [-400.794] * (-389.995) (-398.542) (-391.865) [-390.858] -- 0:01:59
17000 -- (-391.492) (-396.681) (-406.886) [-398.607] * [-391.694] (-403.481) (-398.407) (-390.537) -- 0:01:55
17500 -- (-389.846) (-389.590) [-398.292] (-403.845) * (-394.542) (-406.728) (-398.850) [-392.320] -- 0:01:52
18000 -- (-390.371) (-390.778) [-396.365] (-416.791) * (-396.908) (-396.389) (-393.690) [-391.899] -- 0:01:49
18500 -- [-391.567] (-393.879) (-406.400) (-411.003) * (-393.129) (-400.290) (-391.955) [-391.357] -- 0:01:46
19000 -- [-394.577] (-392.748) (-401.788) (-402.740) * (-389.690) [-396.634] (-394.639) (-389.489) -- 0:01:43
19500 -- (-389.628) (-396.700) (-399.553) [-392.925] * [-391.562] (-397.639) (-393.794) (-391.515) -- 0:01:40
20000 -- (-397.946) (-392.318) [-396.342] (-389.358) * (-393.346) (-393.530) (-393.883) [-393.428] -- 0:01:38
Average standard deviation of split frequencies: 0.058450
20500 -- (-393.715) (-392.565) (-404.186) [-389.137] * (-389.915) (-405.310) (-397.679) [-392.766] -- 0:01:35
21000 -- (-391.633) (-390.603) [-402.878] (-393.008) * (-389.467) (-395.851) (-395.766) [-392.763] -- 0:01:33
21500 -- (-390.597) (-390.259) (-405.732) [-391.896] * (-393.972) [-400.173] (-392.439) (-392.740) -- 0:01:31
22000 -- (-397.692) (-389.419) [-395.138] (-390.345) * (-390.586) [-398.048] (-391.743) (-397.230) -- 0:01:28
22500 -- (-390.509) (-392.100) [-395.428] (-394.385) * (-390.530) [-404.859] (-394.351) (-392.564) -- 0:01:26
23000 -- (-392.131) (-395.506) (-407.005) [-395.833] * (-393.192) [-406.950] (-391.662) (-390.192) -- 0:01:24
23500 -- (-394.296) (-392.202) [-397.426] (-392.388) * (-391.391) (-399.877) (-390.763) [-392.540] -- 0:01:23
24000 -- [-391.925] (-390.818) (-400.818) (-389.891) * (-396.876) [-402.041] (-392.262) (-392.059) -- 0:01:21
24500 -- (-390.321) (-389.961) [-405.524] (-393.680) * (-394.506) [-402.325] (-391.544) (-389.657) -- 0:01:19
25000 -- [-390.092] (-389.939) (-402.348) (-390.596) * (-394.542) (-408.260) (-391.123) [-393.575] -- 0:01:18
Average standard deviation of split frequencies: 0.045759
25500 -- (-392.221) (-390.676) [-397.163] (-390.569) * [-392.125] (-395.212) (-390.685) (-392.364) -- 0:01:16
26000 -- [-391.110] (-389.232) (-407.521) (-389.496) * (-389.692) [-400.789] (-390.589) (-392.140) -- 0:01:14
26500 -- (-393.011) (-391.603) (-414.724) [-392.726] * (-389.812) (-400.194) [-392.995] (-390.682) -- 0:01:13
27000 -- (-393.525) [-392.926] (-414.994) (-389.182) * [-389.421] (-397.684) (-391.560) (-391.159) -- 0:01:12
27500 -- [-389.783] (-393.365) (-410.289) (-389.888) * (-391.203) [-404.193] (-392.889) (-391.649) -- 0:01:10
28000 -- (-392.486) (-389.167) (-401.860) [-390.151] * (-390.440) [-398.988] (-389.866) (-389.653) -- 0:01:09
28500 -- (-393.202) (-397.012) (-392.362) [-391.533] * [-392.313] (-398.545) (-391.418) (-395.154) -- 0:01:08
29000 -- (-392.109) [-391.326] (-397.623) (-391.648) * [-390.890] (-399.643) (-392.414) (-390.809) -- 0:01:06
29500 -- [-390.373] (-394.414) (-391.144) (-393.248) * (-392.841) [-397.247] (-392.881) (-390.438) -- 0:01:05
30000 -- (-390.915) (-391.712) (-389.811) [-389.903] * (-392.206) [-398.049] (-391.719) (-391.231) -- 0:01:04
Average standard deviation of split frequencies: 0.034160
30500 -- (-390.449) [-390.967] (-391.369) (-389.340) * (-392.220) (-409.279) (-390.479) [-393.529] -- 0:01:03
31000 -- (-390.805) [-389.781] (-389.685) (-389.471) * (-394.860) (-408.401) [-390.942] (-392.766) -- 0:01:02
31500 -- (-392.163) (-390.719) (-392.271) [-395.777] * (-391.690) [-399.424] (-390.790) (-393.320) -- 0:01:01
32000 -- [-392.215] (-393.290) (-390.489) (-390.534) * (-390.205) (-398.574) (-390.851) [-390.011] -- 0:01:00
32500 -- (-389.184) (-397.321) [-390.668] (-391.874) * (-391.093) (-401.305) (-390.808) [-390.452] -- 0:00:59
33000 -- [-394.203] (-390.917) (-391.505) (-393.091) * [-390.507] (-402.983) (-390.894) (-391.588) -- 0:01:27
33500 -- (-391.815) [-391.431] (-389.822) (-391.212) * (-392.249) (-404.979) [-390.614] (-394.071) -- 0:01:26
34000 -- (-389.659) (-392.804) (-389.962) [-394.729] * (-390.457) (-405.453) [-390.271] (-391.288) -- 0:01:25
34500 -- (-391.370) (-391.323) [-393.447] (-389.861) * (-390.128) (-411.574) (-392.132) [-390.424] -- 0:01:23
35000 -- (-391.489) (-390.583) [-391.548] (-393.400) * [-391.065] (-401.670) (-389.854) (-391.960) -- 0:01:22
Average standard deviation of split frequencies: 0.024552
35500 -- (-391.970) [-392.821] (-391.430) (-392.271) * (-395.791) [-404.748] (-392.480) (-395.400) -- 0:01:21
36000 -- [-393.064] (-389.705) (-389.931) (-389.433) * (-392.043) (-403.210) (-392.616) [-389.068] -- 0:01:20
36500 -- [-390.673] (-393.186) (-392.012) (-389.968) * (-390.944) (-402.506) (-392.774) [-395.394] -- 0:01:19
37000 -- [-393.809] (-391.534) (-391.573) (-390.032) * (-390.723) (-401.441) (-391.698) [-393.796] -- 0:01:18
37500 -- (-392.236) (-389.241) [-391.348] (-391.409) * [-389.714] (-399.309) (-394.570) (-390.013) -- 0:01:17
38000 -- [-394.721] (-393.043) (-390.597) (-394.261) * (-392.655) [-396.121] (-390.244) (-389.267) -- 0:01:15
38500 -- (-389.948) (-395.047) [-391.178] (-391.640) * (-394.637) (-398.175) (-389.847) [-392.815] -- 0:01:14
39000 -- (-389.491) (-391.769) (-392.089) [-391.394] * (-397.685) (-399.018) (-391.093) [-390.302] -- 0:01:13
39500 -- (-390.065) (-390.093) [-393.390] (-393.074) * (-394.684) [-412.094] (-391.032) (-391.078) -- 0:01:12
40000 -- (-389.524) [-389.443] (-390.470) (-392.958) * (-390.231) (-402.663) (-391.264) [-391.062] -- 0:01:12
Average standard deviation of split frequencies: 0.023866
40500 -- (-391.168) [-389.935] (-394.558) (-394.499) * [-390.068] (-400.081) (-391.089) (-390.366) -- 0:01:11
41000 -- (-391.063) (-392.506) (-399.367) [-389.446] * (-390.847) (-398.153) (-392.589) [-394.545] -- 0:01:10
41500 -- [-391.044] (-390.087) (-395.372) (-390.255) * (-394.084) [-397.594] (-389.546) (-394.191) -- 0:01:09
42000 -- [-390.554] (-390.554) (-391.909) (-391.121) * [-391.115] (-400.055) (-390.159) (-391.176) -- 0:01:08
42500 -- (-392.481) (-389.541) [-391.876] (-390.761) * (-393.495) (-397.996) [-390.436] (-390.656) -- 0:01:07
43000 -- (-393.914) (-395.926) [-390.518] (-393.491) * (-389.756) (-400.532) (-391.785) [-392.552] -- 0:01:06
43500 -- [-393.792] (-392.838) (-390.188) (-392.474) * (-390.155) [-397.503] (-392.742) (-390.840) -- 0:01:05
44000 -- (-394.780) [-393.081] (-393.409) (-390.113) * [-389.805] (-398.366) (-390.114) (-395.088) -- 0:01:05
44500 -- (-393.384) (-393.064) [-391.355] (-392.191) * (-390.733) [-399.483] (-390.031) (-390.039) -- 0:01:04
45000 -- [-390.131] (-391.598) (-390.286) (-390.649) * (-390.963) (-401.865) (-389.546) [-390.810] -- 0:01:03
Average standard deviation of split frequencies: 0.025889
45500 -- (-395.603) (-391.815) [-394.777] (-392.932) * (-390.364) (-398.995) (-390.609) [-390.910] -- 0:01:02
46000 -- (-391.213) [-389.974] (-393.615) (-390.537) * (-394.502) (-392.414) (-393.713) [-391.908] -- 0:01:02
46500 -- (-391.065) (-390.391) [-391.482] (-390.915) * (-391.114) (-390.201) [-391.237] (-392.044) -- 0:01:01
47000 -- (-391.600) (-391.779) (-389.497) [-391.171] * (-391.847) (-390.931) (-393.339) [-390.077] -- 0:01:00
47500 -- (-390.217) (-390.444) [-390.599] (-398.809) * (-391.458) (-394.705) (-390.742) [-392.238] -- 0:01:00
48000 -- (-390.857) (-390.909) (-392.469) [-390.900] * [-389.948] (-390.688) (-392.077) (-390.368) -- 0:00:59
48500 -- (-391.714) (-390.296) (-389.867) [-393.965] * (-391.302) (-389.361) (-394.006) [-389.931] -- 0:01:18
49000 -- (-393.767) (-391.208) [-390.010] (-391.532) * (-389.388) (-391.077) (-399.231) [-391.627] -- 0:01:17
49500 -- (-395.198) (-390.194) (-391.392) [-392.357] * [-390.275] (-392.522) (-391.867) (-393.139) -- 0:01:16
50000 -- (-393.931) (-390.422) [-391.478] (-392.411) * [-390.702] (-391.071) (-390.733) (-389.200) -- 0:01:16
Average standard deviation of split frequencies: 0.032564
50500 -- (-391.615) (-396.571) [-392.962] (-392.360) * (-391.014) (-390.414) [-391.971] (-391.315) -- 0:01:15
51000 -- (-393.549) [-391.058] (-390.609) (-392.043) * [-390.767] (-391.872) (-394.411) (-392.127) -- 0:01:14
51500 -- (-391.234) (-393.274) (-397.855) [-390.559] * (-389.984) (-393.139) (-392.777) [-391.253] -- 0:01:13
52000 -- (-391.305) [-391.827] (-393.737) (-393.424) * (-390.424) (-391.270) [-390.296] (-389.945) -- 0:01:12
52500 -- (-392.203) (-392.524) [-391.146] (-392.645) * (-389.510) (-393.268) (-389.507) [-390.096] -- 0:01:12
53000 -- (-390.492) [-394.301] (-397.068) (-392.594) * [-390.171] (-391.416) (-391.365) (-393.150) -- 0:01:11
53500 -- (-395.100) (-393.996) (-394.837) [-390.176] * (-391.622) (-390.851) [-389.661] (-390.722) -- 0:01:10
54000 -- (-391.389) [-394.966] (-391.797) (-390.691) * (-390.958) (-390.781) (-392.533) [-390.375] -- 0:01:10
54500 -- [-389.637] (-392.811) (-394.137) (-393.686) * (-390.994) [-390.865] (-392.501) (-394.750) -- 0:01:09
55000 -- (-389.524) (-392.951) [-392.753] (-394.906) * [-393.445] (-391.269) (-394.075) (-390.733) -- 0:01:08
Average standard deviation of split frequencies: 0.030398
55500 -- (-396.132) (-391.255) [-389.741] (-391.268) * (-389.043) [-389.836] (-394.967) (-393.625) -- 0:01:08
56000 -- [-391.893] (-390.152) (-390.128) (-393.645) * [-389.540] (-389.457) (-394.095) (-392.313) -- 0:01:07
56500 -- [-392.097] (-391.245) (-389.132) (-390.971) * (-390.867) (-389.164) [-391.203] (-391.704) -- 0:01:06
57000 -- (-391.820) (-390.640) (-389.950) [-390.757] * (-390.043) (-389.297) [-391.272] (-391.655) -- 0:01:06
57500 -- (-392.761) (-390.447) [-390.497] (-391.934) * (-389.530) (-391.300) [-391.435] (-391.366) -- 0:01:05
58000 -- (-393.346) (-394.235) (-389.242) [-390.641] * (-390.914) (-391.412) (-389.469) [-393.295] -- 0:01:04
58500 -- (-391.823) [-389.968] (-390.797) (-395.424) * (-392.372) [-392.458] (-394.984) (-391.500) -- 0:01:04
59000 -- (-391.730) (-390.667) [-390.098] (-395.405) * (-390.123) (-389.995) (-391.357) [-395.644] -- 0:01:03
59500 -- (-390.556) (-390.665) (-397.711) [-390.231] * (-392.812) (-393.504) [-391.004] (-393.393) -- 0:01:03
60000 -- (-392.069) (-391.805) (-389.759) [-390.320] * [-392.695] (-398.950) (-389.976) (-391.113) -- 0:01:02
Average standard deviation of split frequencies: 0.030218
60500 -- (-393.018) (-390.671) (-390.236) [-390.248] * [-392.376] (-394.821) (-396.563) (-390.144) -- 0:01:02
61000 -- (-392.776) (-390.602) [-393.257] (-391.537) * (-392.489) [-393.746] (-394.275) (-391.068) -- 0:01:01
61500 -- [-391.167] (-390.172) (-389.903) (-389.697) * (-392.774) (-391.573) [-389.805] (-390.821) -- 0:01:01
62000 -- [-390.434] (-390.724) (-392.770) (-390.914) * [-390.495] (-390.251) (-392.661) (-390.496) -- 0:01:00
62500 -- (-390.346) (-394.201) [-392.168] (-389.492) * [-389.916] (-393.505) (-394.290) (-393.895) -- 0:01:00
63000 -- (-390.993) (-392.074) (-392.516) [-391.613] * [-389.879] (-399.063) (-392.629) (-393.715) -- 0:00:59
63500 -- (-390.345) (-389.664) (-391.812) [-390.975] * (-390.813) [-391.054] (-390.325) (-390.998) -- 0:01:13
64000 -- (-393.126) (-390.902) (-392.902) [-389.734] * [-391.205] (-391.417) (-392.990) (-392.101) -- 0:01:13
64500 -- (-391.017) (-390.628) [-392.589] (-390.590) * (-389.532) [-389.466] (-391.949) (-393.348) -- 0:01:12
65000 -- [-390.684] (-392.076) (-393.917) (-390.968) * (-391.137) (-391.212) [-392.213] (-391.775) -- 0:01:11
Average standard deviation of split frequencies: 0.034209
65500 -- [-391.856] (-391.618) (-390.018) (-390.385) * (-393.898) [-392.181] (-391.337) (-392.072) -- 0:01:11
66000 -- [-391.431] (-390.823) (-391.117) (-390.617) * (-390.722) (-394.825) [-389.735] (-389.979) -- 0:01:10
66500 -- (-392.737) (-392.895) (-392.182) [-390.085] * [-390.756] (-389.853) (-392.508) (-389.725) -- 0:01:10
67000 -- (-390.189) (-390.142) (-391.675) [-391.981] * (-389.136) (-392.659) [-391.239] (-390.005) -- 0:01:09
67500 -- [-396.992] (-391.729) (-391.271) (-390.297) * [-392.168] (-395.545) (-389.937) (-392.041) -- 0:01:09
68000 -- (-392.426) (-389.589) [-390.465] (-391.491) * (-390.962) (-389.891) [-390.505] (-390.267) -- 0:01:08
68500 -- (-390.295) [-389.749] (-389.735) (-392.480) * [-391.320] (-390.980) (-394.565) (-391.423) -- 0:01:07
69000 -- (-389.912) [-391.637] (-390.042) (-392.774) * (-390.536) (-392.952) (-390.396) [-391.452] -- 0:01:07
69500 -- [-395.076] (-391.960) (-395.651) (-394.820) * (-391.788) (-394.577) [-392.450] (-390.959) -- 0:01:06
70000 -- (-391.699) [-389.454] (-391.003) (-393.966) * (-394.430) (-391.356) (-391.438) [-392.124] -- 0:01:06
Average standard deviation of split frequencies: 0.031686
70500 -- (-392.356) (-392.541) [-389.445] (-394.778) * [-390.134] (-389.368) (-389.607) (-390.056) -- 0:01:05
71000 -- (-391.481) (-391.691) (-390.793) [-393.151] * (-390.571) (-392.235) (-389.744) [-390.748] -- 0:01:05
71500 -- (-390.703) (-390.793) [-393.191] (-390.360) * (-392.991) (-390.999) [-389.544] (-391.658) -- 0:01:04
72000 -- (-390.063) (-390.512) [-390.648] (-390.335) * (-390.039) (-390.557) (-394.167) [-393.252] -- 0:01:04
72500 -- (-391.025) (-391.631) (-391.124) [-389.594] * [-392.202] (-391.649) (-392.507) (-394.052) -- 0:01:03
73000 -- [-390.829] (-391.595) (-390.270) (-390.851) * (-390.257) (-397.117) (-392.000) [-393.020] -- 0:01:03
73500 -- (-392.029) (-394.066) (-390.538) [-393.069] * (-391.851) (-392.733) [-391.532] (-392.021) -- 0:01:03
74000 -- (-395.532) (-393.143) (-391.880) [-392.063] * [-390.875] (-391.961) (-389.869) (-391.046) -- 0:01:02
74500 -- (-391.594) [-391.987] (-390.055) (-391.159) * (-390.913) (-391.302) [-389.888] (-390.759) -- 0:01:02
75000 -- (-391.885) (-394.531) [-390.167] (-389.357) * [-391.657] (-392.023) (-389.071) (-389.650) -- 0:01:01
Average standard deviation of split frequencies: 0.031013
75500 -- (-391.172) [-389.225] (-393.449) (-393.841) * (-391.426) (-389.879) [-389.561] (-390.760) -- 0:01:01
76000 -- (-391.318) [-391.085] (-392.740) (-391.414) * (-390.842) [-392.522] (-389.983) (-392.563) -- 0:01:00
76500 -- (-389.775) (-392.508) (-392.092) [-390.161] * [-391.336] (-392.390) (-391.092) (-390.735) -- 0:01:00
77000 -- (-390.647) [-389.912] (-392.974) (-391.581) * [-390.533] (-390.900) (-390.455) (-393.455) -- 0:00:59
77500 -- (-393.728) (-390.510) [-391.148] (-389.838) * (-389.947) (-390.370) [-390.030] (-399.988) -- 0:00:59
78000 -- (-390.576) (-389.257) (-392.877) [-391.299] * [-390.334] (-390.137) (-390.387) (-393.679) -- 0:00:59
78500 -- (-391.787) [-391.714] (-392.505) (-393.669) * [-389.910] (-390.573) (-393.902) (-390.273) -- 0:00:58
79000 -- (-391.889) (-391.157) (-390.013) [-390.234] * (-390.955) (-390.780) [-390.066] (-393.971) -- 0:01:09
79500 -- (-391.134) (-390.584) [-390.795] (-391.107) * (-390.514) (-389.834) [-391.211] (-393.213) -- 0:01:09
80000 -- (-389.593) [-389.554] (-392.687) (-391.370) * (-390.864) (-393.672) [-393.587] (-392.628) -- 0:01:09
Average standard deviation of split frequencies: 0.035063
80500 -- (-391.473) (-390.020) (-391.710) [-391.246] * (-390.350) [-391.026] (-393.660) (-389.775) -- 0:01:08
81000 -- [-391.373] (-391.954) (-392.599) (-389.986) * (-390.509) (-390.639) (-392.776) [-390.459] -- 0:01:08
81500 -- (-390.477) (-391.618) (-391.799) [-393.176] * (-390.707) [-389.061] (-390.682) (-390.535) -- 0:01:07
82000 -- (-389.746) (-390.262) (-392.996) [-390.417] * (-391.315) [-390.125] (-393.372) (-392.696) -- 0:01:07
82500 -- (-389.740) (-392.369) [-390.607] (-391.051) * (-389.796) [-391.156] (-390.682) (-389.173) -- 0:01:06
83000 -- (-389.878) [-391.716] (-389.638) (-390.076) * (-390.480) [-391.361] (-390.655) (-390.615) -- 0:01:06
83500 -- [-391.965] (-391.447) (-390.427) (-392.536) * (-391.865) (-392.492) (-391.385) [-390.167] -- 0:01:05
84000 -- [-390.746] (-390.983) (-390.673) (-393.428) * (-392.502) [-392.249] (-391.534) (-391.368) -- 0:01:05
84500 -- (-389.953) (-395.454) (-390.985) [-389.963] * (-393.051) (-392.716) [-389.920] (-392.193) -- 0:01:05
85000 -- [-391.761] (-390.367) (-392.386) (-391.335) * (-392.202) [-391.479] (-391.208) (-392.348) -- 0:01:04
Average standard deviation of split frequencies: 0.030148
85500 -- (-393.534) (-393.412) (-392.762) [-390.411] * (-393.780) (-389.289) (-391.264) [-389.323] -- 0:01:04
86000 -- [-390.879] (-392.119) (-390.725) (-392.187) * (-393.108) [-394.673] (-391.257) (-389.798) -- 0:01:03
86500 -- [-390.078] (-395.879) (-391.211) (-390.576) * [-391.752] (-390.965) (-390.484) (-391.974) -- 0:01:03
87000 -- [-390.464] (-394.252) (-391.303) (-394.884) * [-393.024] (-392.114) (-390.402) (-389.725) -- 0:01:02
87500 -- (-389.762) (-395.053) [-390.757] (-390.184) * (-395.067) (-392.279) [-389.212] (-390.643) -- 0:01:02
88000 -- (-391.487) (-391.535) [-390.855] (-389.651) * (-391.124) (-390.127) [-391.245] (-391.943) -- 0:01:02
88500 -- (-390.374) [-390.194] (-392.592) (-391.857) * (-391.927) (-392.013) [-392.470] (-391.409) -- 0:01:01
89000 -- (-391.912) [-389.801] (-394.024) (-390.323) * [-390.534] (-392.821) (-395.385) (-390.066) -- 0:01:01
89500 -- (-390.855) [-389.623] (-394.838) (-390.454) * (-390.492) [-394.535] (-391.206) (-389.228) -- 0:01:01
90000 -- (-390.426) (-390.591) [-392.043] (-392.479) * (-389.935) (-393.065) (-395.877) [-389.900] -- 0:01:00
Average standard deviation of split frequencies: 0.031470
90500 -- (-389.707) (-395.243) [-391.642] (-389.830) * (-389.929) [-389.320] (-393.621) (-395.367) -- 0:01:00
91000 -- (-390.894) (-391.238) [-389.539] (-391.251) * (-394.159) [-391.739] (-394.377) (-391.193) -- 0:00:59
91500 -- (-394.720) (-394.759) [-389.810] (-395.679) * (-390.825) (-393.619) [-391.638] (-390.731) -- 0:00:59
92000 -- [-389.434] (-390.838) (-390.849) (-395.767) * (-393.730) [-391.047] (-393.014) (-390.234) -- 0:00:59
92500 -- (-390.427) (-393.484) (-391.551) [-391.700] * [-390.551] (-399.800) (-390.294) (-391.029) -- 0:00:58
93000 -- [-389.660] (-392.027) (-391.146) (-390.097) * (-391.628) (-391.172) (-394.707) [-389.671] -- 0:01:08
93500 -- (-391.870) (-391.704) (-391.668) [-391.570] * [-390.679] (-389.616) (-392.175) (-393.580) -- 0:01:07
94000 -- (-394.471) (-389.689) [-390.036] (-394.831) * (-392.946) [-390.488] (-391.811) (-391.752) -- 0:01:07
94500 -- [-389.137] (-395.471) (-392.147) (-391.312) * (-398.646) [-390.869] (-390.057) (-391.460) -- 0:01:07
95000 -- (-391.335) (-394.044) (-391.839) [-392.553] * (-393.704) (-391.926) [-391.503] (-391.127) -- 0:01:06
Average standard deviation of split frequencies: 0.030690
95500 -- [-393.602] (-390.542) (-391.096) (-389.860) * (-391.848) (-395.267) (-392.448) [-395.124] -- 0:01:06
96000 -- (-394.215) [-394.440] (-390.656) (-392.198) * (-391.459) (-393.867) (-390.342) [-391.942] -- 0:01:05
96500 -- (-394.266) [-390.624] (-391.181) (-389.723) * (-392.037) (-390.396) [-393.146] (-390.605) -- 0:01:05
97000 -- [-392.414] (-392.771) (-392.480) (-391.644) * (-392.072) (-391.023) (-393.339) [-391.169] -- 0:01:05
97500 -- (-393.715) (-391.332) (-391.361) [-394.651] * (-390.440) (-390.473) [-392.613] (-392.426) -- 0:01:04
98000 -- (-391.941) [-389.368] (-389.599) (-390.908) * (-390.193) [-389.100] (-396.349) (-391.531) -- 0:01:04
98500 -- (-392.558) (-390.739) (-390.696) [-391.401] * (-391.401) [-392.198] (-393.291) (-390.699) -- 0:01:04
99000 -- (-390.551) [-390.388] (-391.913) (-392.252) * [-391.049] (-389.226) (-390.440) (-395.093) -- 0:01:03
99500 -- (-391.252) (-392.951) [-392.894] (-392.649) * (-392.730) (-391.915) [-391.294] (-389.775) -- 0:01:03
100000 -- (-391.864) (-393.186) (-391.292) [-392.306] * (-393.437) [-390.469] (-391.428) (-390.039) -- 0:01:02
Average standard deviation of split frequencies: 0.029268
100500 -- (-395.400) (-390.345) [-391.198] (-391.805) * (-391.963) [-389.670] (-389.705) (-390.159) -- 0:01:02
101000 -- [-390.753] (-393.664) (-390.228) (-396.289) * (-393.014) (-389.706) (-390.339) [-390.908] -- 0:01:02
101500 -- (-390.693) (-389.535) (-390.562) [-394.747] * (-391.054) (-390.308) [-389.785] (-391.232) -- 0:01:01
102000 -- (-392.117) (-392.552) [-390.619] (-397.642) * (-392.872) [-390.441] (-389.139) (-392.993) -- 0:01:01
102500 -- [-389.615] (-389.803) (-391.010) (-397.110) * (-391.354) [-389.940] (-392.893) (-393.104) -- 0:01:01
103000 -- (-389.225) (-389.732) (-392.909) [-392.433] * (-391.745) (-389.052) (-390.143) [-391.867] -- 0:01:00
103500 -- (-390.045) (-389.539) (-394.176) [-389.602] * [-389.989] (-390.670) (-389.010) (-390.044) -- 0:01:00
104000 -- [-390.116] (-389.689) (-393.140) (-389.343) * (-390.384) [-393.204] (-390.617) (-394.218) -- 0:01:00
104500 -- [-389.373] (-390.876) (-391.515) (-389.851) * (-391.337) (-390.021) (-390.298) [-391.222] -- 0:00:59
105000 -- (-389.806) (-393.905) [-390.573] (-389.709) * (-391.359) (-390.955) (-391.087) [-390.394] -- 0:00:59
Average standard deviation of split frequencies: 0.028801
105500 -- (-389.794) (-391.000) (-390.638) [-391.367] * (-393.281) [-390.362] (-391.641) (-390.832) -- 0:00:59
106000 -- [-391.230] (-391.039) (-391.056) (-391.633) * (-393.776) (-391.167) [-391.050] (-389.763) -- 0:00:59
106500 -- (-390.601) (-391.828) [-390.553] (-392.401) * (-389.869) (-393.597) [-391.284] (-389.779) -- 0:00:58
107000 -- [-391.666] (-392.124) (-391.337) (-396.327) * (-389.539) [-391.464] (-391.825) (-389.759) -- 0:00:58
107500 -- (-391.020) [-391.754] (-390.705) (-391.139) * (-392.081) [-389.970] (-391.673) (-390.439) -- 0:00:58
108000 -- [-393.262] (-395.999) (-393.622) (-390.149) * (-392.558) (-391.403) (-391.000) [-389.717] -- 0:00:57
108500 -- [-389.501] (-393.690) (-390.379) (-391.500) * (-391.965) (-390.479) (-395.050) [-389.534] -- 0:00:57
109000 -- (-389.616) (-390.040) [-391.075] (-400.224) * (-391.148) [-390.507] (-391.392) (-392.847) -- 0:00:57
109500 -- (-391.553) (-391.913) (-389.949) [-393.702] * [-394.720] (-392.521) (-389.766) (-392.051) -- 0:01:05
110000 -- (-392.907) [-390.291] (-391.585) (-390.808) * (-392.864) (-393.672) (-389.564) [-392.289] -- 0:01:04
Average standard deviation of split frequencies: 0.025771
110500 -- (-392.302) [-389.661] (-393.969) (-394.371) * [-392.443] (-394.591) (-390.274) (-391.910) -- 0:01:04
111000 -- [-390.768] (-391.049) (-393.529) (-395.485) * (-393.744) (-394.782) (-392.629) [-389.541] -- 0:01:04
111500 -- (-390.559) (-389.762) [-389.921] (-391.735) * (-390.302) (-391.254) [-390.499] (-389.376) -- 0:01:03
112000 -- (-391.340) (-393.754) [-391.568] (-389.672) * (-390.574) (-391.862) [-390.164] (-389.060) -- 0:01:03
112500 -- (-389.703) (-389.043) [-390.842] (-393.971) * (-391.967) (-391.121) (-393.790) [-389.300] -- 0:01:03
113000 -- (-390.824) (-390.969) [-389.267] (-392.296) * (-393.582) (-393.649) (-389.246) [-390.106] -- 0:01:02
113500 -- [-390.741] (-391.288) (-390.254) (-391.556) * [-395.617] (-398.988) (-389.774) (-390.498) -- 0:01:02
114000 -- (-391.243) [-390.481] (-393.102) (-392.136) * [-390.969] (-392.750) (-389.569) (-391.859) -- 0:01:02
114500 -- (-390.411) [-389.985] (-393.582) (-394.535) * (-390.098) (-390.250) [-390.196] (-391.469) -- 0:01:01
115000 -- (-390.981) (-394.091) [-391.031] (-393.732) * [-392.817] (-388.982) (-391.308) (-389.372) -- 0:01:01
Average standard deviation of split frequencies: 0.029088
115500 -- (-390.093) [-391.400] (-392.790) (-391.126) * (-392.119) (-389.220) [-392.782] (-391.255) -- 0:01:01
116000 -- (-393.315) (-392.882) (-390.500) [-390.724] * [-391.391] (-392.369) (-392.929) (-390.060) -- 0:01:00
116500 -- (-390.273) (-391.541) (-393.925) [-392.203] * (-391.040) (-391.679) (-392.728) [-389.202] -- 0:01:00
117000 -- (-394.176) (-390.704) [-393.522] (-391.426) * (-391.027) [-391.592] (-390.318) (-389.313) -- 0:01:00
117500 -- (-392.420) (-391.559) (-393.949) [-391.785] * (-392.579) [-391.873] (-392.831) (-391.430) -- 0:01:00
118000 -- (-391.331) (-397.189) (-390.813) [-391.513] * (-392.998) (-391.080) (-392.835) [-389.491] -- 0:00:59
118500 -- (-402.904) (-393.480) [-391.759] (-389.414) * (-390.273) [-391.040] (-389.754) (-390.309) -- 0:00:59
119000 -- (-393.139) (-391.758) [-389.366] (-389.727) * [-394.219] (-391.065) (-390.372) (-392.020) -- 0:00:59
119500 -- [-390.330] (-390.288) (-391.008) (-389.443) * (-392.232) [-393.047] (-392.287) (-394.937) -- 0:00:58
120000 -- (-393.101) [-390.272] (-391.104) (-393.895) * [-390.469] (-390.902) (-393.638) (-390.665) -- 0:00:58
Average standard deviation of split frequencies: 0.031036
120500 -- [-394.553] (-390.200) (-390.426) (-393.358) * (-390.497) (-391.468) [-390.163] (-390.197) -- 0:00:58
121000 -- [-393.713] (-392.729) (-390.713) (-389.986) * (-391.906) [-393.086] (-392.858) (-392.055) -- 0:00:58
121500 -- [-390.126] (-389.895) (-389.641) (-389.637) * (-390.160) [-391.229] (-391.187) (-394.187) -- 0:00:57
122000 -- [-392.169] (-389.657) (-390.298) (-391.419) * (-389.146) (-393.077) (-392.121) [-395.018] -- 0:00:57
122500 -- [-392.484] (-392.269) (-393.060) (-392.354) * (-390.790) [-392.236] (-391.341) (-392.597) -- 0:00:57
123000 -- [-389.449] (-391.537) (-392.525) (-392.556) * (-392.913) (-395.793) (-393.211) [-391.840] -- 0:00:57
123500 -- [-391.112] (-390.346) (-391.190) (-390.748) * (-389.654) (-395.808) [-390.140] (-391.149) -- 0:00:56
124000 -- (-394.122) [-389.387] (-391.376) (-391.077) * (-392.178) (-394.095) (-391.175) [-392.148] -- 0:00:56
124500 -- [-391.006] (-392.240) (-396.388) (-390.959) * (-389.541) (-392.596) [-392.724] (-391.662) -- 0:00:56
125000 -- (-390.501) (-395.857) [-391.900] (-394.713) * (-392.759) (-391.956) [-391.036] (-390.669) -- 0:00:56
Average standard deviation of split frequencies: 0.029143
125500 -- (-390.094) [-390.668] (-391.264) (-389.990) * [-390.325] (-390.654) (-389.698) (-391.511) -- 0:00:55
126000 -- (-390.273) (-390.002) (-389.951) [-391.260] * [-389.110] (-391.950) (-390.052) (-390.687) -- 0:00:55
126500 -- [-393.260] (-392.104) (-391.205) (-392.796) * (-389.763) (-392.805) (-390.835) [-390.862] -- 0:01:02
127000 -- (-390.149) (-391.055) [-390.017] (-391.120) * (-394.013) [-391.134] (-393.097) (-390.320) -- 0:01:01
127500 -- (-392.168) (-390.074) (-391.704) [-393.246] * (-397.042) (-390.166) (-391.918) [-389.378] -- 0:01:01
128000 -- [-390.738] (-390.224) (-394.113) (-391.042) * [-391.014] (-397.276) (-390.558) (-390.551) -- 0:01:01
128500 -- (-391.034) (-390.644) [-392.402] (-392.158) * [-390.847] (-397.936) (-390.405) (-389.325) -- 0:01:01
129000 -- (-390.269) (-391.502) [-390.680] (-394.790) * (-390.026) [-389.267] (-391.597) (-390.969) -- 0:01:00
129500 -- [-392.128] (-392.058) (-392.632) (-393.176) * (-393.383) (-389.450) (-390.485) [-389.419] -- 0:01:00
130000 -- (-394.786) [-391.335] (-389.819) (-395.960) * (-393.511) (-389.601) (-392.704) [-393.941] -- 0:01:00
Average standard deviation of split frequencies: 0.026963
130500 -- (-390.871) (-391.874) [-389.698] (-390.188) * (-391.026) (-390.943) [-391.723] (-391.219) -- 0:00:59
131000 -- (-392.213) [-394.326] (-391.375) (-390.198) * (-394.780) (-390.828) (-391.556) [-392.497] -- 0:00:59
131500 -- (-391.479) (-391.936) [-393.730] (-390.359) * (-390.778) [-393.871] (-394.577) (-392.216) -- 0:00:59
132000 -- (-390.521) [-390.467] (-391.094) (-389.938) * (-390.071) (-391.077) [-395.263] (-391.231) -- 0:00:59
132500 -- [-389.527] (-393.314) (-392.033) (-395.181) * [-389.460] (-391.560) (-390.425) (-390.048) -- 0:00:58
133000 -- (-392.020) [-390.875] (-390.687) (-393.191) * (-391.955) (-392.865) (-389.720) [-395.714] -- 0:00:58
133500 -- (-392.822) [-391.078] (-390.202) (-392.092) * (-392.874) (-390.732) [-390.181] (-393.823) -- 0:00:58
134000 -- (-393.135) (-390.659) [-391.304] (-391.322) * (-392.602) [-392.660] (-392.494) (-395.585) -- 0:00:58
134500 -- [-391.750] (-390.893) (-392.002) (-390.464) * (-390.398) (-390.451) [-390.862] (-389.728) -- 0:00:57
135000 -- (-392.822) (-389.576) (-393.277) [-391.431] * (-390.764) (-391.535) (-389.703) [-390.899] -- 0:00:57
Average standard deviation of split frequencies: 0.024783
135500 -- (-391.408) [-390.111] (-392.491) (-391.811) * (-389.450) (-390.509) [-394.574] (-393.130) -- 0:00:57
136000 -- [-391.973] (-394.022) (-396.647) (-393.637) * (-391.433) [-390.663] (-390.930) (-392.071) -- 0:00:57
136500 -- [-391.236] (-398.027) (-393.120) (-392.710) * (-390.067) (-390.854) [-391.554] (-391.288) -- 0:00:56
137000 -- (-390.331) (-394.783) [-392.490] (-392.590) * (-391.795) [-389.262] (-392.187) (-389.881) -- 0:00:56
137500 -- (-392.930) [-391.800] (-390.388) (-395.198) * (-391.914) [-390.933] (-391.510) (-389.300) -- 0:00:56
138000 -- (-391.277) (-390.809) [-391.328] (-393.687) * [-389.466] (-390.637) (-392.433) (-392.784) -- 0:00:56
138500 -- (-391.072) (-392.793) (-390.408) [-391.265] * (-392.191) (-391.450) (-392.517) [-390.119] -- 0:00:55
139000 -- [-391.012] (-391.943) (-391.814) (-389.983) * (-390.084) (-391.952) (-392.776) [-392.823] -- 0:00:55
139500 -- (-391.945) (-389.849) (-391.347) [-393.968] * (-390.328) (-390.718) (-391.071) [-389.750] -- 0:00:55
140000 -- (-390.911) (-389.742) [-389.902] (-390.988) * (-391.487) [-390.561] (-391.041) (-392.106) -- 0:00:55
Average standard deviation of split frequencies: 0.024164
140500 -- (-389.541) [-389.518] (-389.580) (-393.898) * (-389.407) (-390.519) (-391.360) [-389.943] -- 0:00:55
141000 -- (-389.346) (-390.019) (-389.449) [-392.760] * (-391.097) (-394.566) [-391.590] (-390.186) -- 0:00:54
141500 -- (-391.793) (-392.608) [-390.190] (-391.183) * (-389.612) (-390.109) (-391.463) [-393.265] -- 0:00:54
142000 -- [-390.828] (-394.376) (-390.397) (-394.206) * (-390.269) (-389.938) [-390.007] (-395.836) -- 0:00:54
142500 -- (-389.906) [-390.997] (-393.122) (-394.860) * (-391.197) (-391.132) [-392.438] (-395.518) -- 0:00:54
143000 -- (-389.781) (-389.786) (-389.612) [-391.599] * (-392.337) (-389.953) [-391.223] (-397.899) -- 0:00:53
143500 -- (-392.218) (-395.222) (-392.915) [-398.725] * (-392.085) (-389.392) (-389.913) [-390.283] -- 0:00:59
144000 -- (-393.042) [-391.077] (-390.830) (-392.974) * (-389.555) (-391.302) [-391.614] (-393.943) -- 0:00:59
144500 -- [-391.890] (-390.672) (-391.120) (-391.643) * (-390.815) (-391.236) (-390.176) [-391.138] -- 0:00:59
145000 -- [-390.205] (-389.939) (-390.107) (-390.903) * (-390.213) [-391.437] (-390.711) (-391.301) -- 0:00:58
Average standard deviation of split frequencies: 0.022602
145500 -- [-391.294] (-389.712) (-390.232) (-390.627) * (-391.210) [-390.969] (-390.165) (-392.387) -- 0:00:58
146000 -- (-392.130) [-391.599] (-391.868) (-392.762) * (-390.387) (-391.105) [-390.522] (-390.438) -- 0:00:58
146500 -- (-391.771) (-395.681) (-390.270) [-391.852] * [-391.233] (-389.725) (-389.968) (-391.418) -- 0:00:58
147000 -- [-389.324] (-389.638) (-391.716) (-390.142) * [-390.673] (-390.068) (-391.985) (-392.029) -- 0:00:58
147500 -- (-389.803) (-390.506) (-389.927) [-389.545] * (-389.346) [-392.800] (-393.633) (-391.325) -- 0:00:57
148000 -- (-389.966) (-390.105) (-393.859) [-391.332] * (-390.526) (-389.685) [-395.546] (-392.731) -- 0:00:57
148500 -- (-391.979) (-393.217) [-390.464] (-389.965) * (-391.442) (-390.160) [-389.565] (-390.378) -- 0:00:57
149000 -- (-391.714) (-392.641) [-392.849] (-391.327) * (-390.148) (-391.625) [-392.365] (-394.627) -- 0:00:57
149500 -- (-391.508) (-391.666) [-391.789] (-391.399) * (-392.704) [-392.933] (-389.349) (-392.537) -- 0:00:56
150000 -- [-393.837] (-391.993) (-393.366) (-392.834) * (-394.212) (-394.890) (-390.045) [-389.423] -- 0:00:56
Average standard deviation of split frequencies: 0.019925
150500 -- (-391.925) (-390.626) [-389.892] (-391.021) * (-395.348) [-393.794] (-391.912) (-390.745) -- 0:00:56
151000 -- (-395.869) (-390.369) [-389.798] (-392.697) * (-390.378) (-390.978) [-391.730] (-392.487) -- 0:00:56
151500 -- (-390.135) (-390.297) (-390.061) [-391.317] * [-393.372] (-394.661) (-390.794) (-390.973) -- 0:00:56
152000 -- [-390.795] (-393.309) (-389.458) (-391.283) * [-392.090] (-389.566) (-398.594) (-393.554) -- 0:00:55
152500 -- (-391.454) (-389.649) (-390.574) [-391.460] * (-394.324) (-393.848) (-390.255) [-391.716] -- 0:00:55
153000 -- (-392.150) (-390.089) (-390.880) [-390.483] * (-393.439) (-392.295) (-391.050) [-390.397] -- 0:00:55
153500 -- (-397.804) (-391.023) [-390.219] (-392.387) * (-393.010) [-392.162] (-392.639) (-390.650) -- 0:00:55
154000 -- (-396.151) (-393.292) [-391.743] (-391.158) * (-389.873) (-392.741) [-390.049] (-391.179) -- 0:00:54
154500 -- (-389.890) [-389.131] (-389.689) (-390.046) * [-389.744] (-392.684) (-390.221) (-389.901) -- 0:00:54
155000 -- [-390.266] (-392.008) (-392.487) (-393.573) * (-389.993) (-390.389) (-389.407) [-391.172] -- 0:00:54
Average standard deviation of split frequencies: 0.019138
155500 -- (-393.830) (-391.415) [-391.692] (-394.171) * (-391.496) [-391.569] (-390.210) (-393.306) -- 0:00:54
156000 -- (-391.080) (-391.441) (-392.313) [-390.450] * (-393.109) (-394.938) [-390.067] (-390.027) -- 0:00:54
156500 -- (-392.049) [-389.415] (-390.688) (-390.964) * [-393.264] (-389.922) (-391.708) (-392.248) -- 0:00:53
157000 -- (-395.469) (-391.974) [-390.713] (-391.518) * [-391.937] (-389.814) (-391.581) (-394.831) -- 0:00:53
157500 -- (-390.953) [-389.952] (-394.196) (-390.212) * [-390.666] (-394.654) (-390.770) (-390.825) -- 0:00:53
158000 -- (-389.665) (-394.651) [-392.049] (-392.811) * (-389.739) (-390.206) [-389.996] (-390.283) -- 0:00:53
158500 -- [-389.501] (-390.056) (-390.300) (-391.430) * (-393.063) [-390.224] (-389.388) (-390.270) -- 0:00:53
159000 -- [-391.992] (-392.065) (-389.773) (-392.852) * (-391.169) [-391.060] (-391.776) (-390.354) -- 0:00:52
159500 -- (-391.555) [-392.092] (-392.670) (-394.264) * (-394.266) [-390.713] (-396.337) (-390.570) -- 0:00:52
160000 -- (-392.105) [-394.226] (-389.415) (-391.994) * (-391.272) [-390.874] (-394.563) (-390.896) -- 0:00:52
Average standard deviation of split frequencies: 0.019805
160500 -- (-389.756) (-391.611) (-390.787) [-390.151] * (-390.870) [-391.321] (-391.404) (-392.406) -- 0:00:57
161000 -- (-388.914) (-394.352) [-390.280] (-391.773) * (-390.445) (-394.039) (-391.153) [-390.898] -- 0:00:57
161500 -- (-389.243) [-392.039] (-391.477) (-393.011) * (-390.128) [-392.620] (-394.527) (-392.259) -- 0:00:57
162000 -- [-389.315] (-390.076) (-391.220) (-393.165) * (-389.792) (-392.033) (-397.894) [-391.743] -- 0:00:56
162500 -- (-392.443) (-389.845) [-390.378] (-391.038) * (-389.322) (-391.104) [-390.032] (-392.839) -- 0:00:56
163000 -- [-393.630] (-390.340) (-389.303) (-388.958) * (-389.837) (-392.588) (-389.367) [-391.895] -- 0:00:56
163500 -- (-390.371) (-389.799) [-390.373] (-389.687) * (-389.744) [-389.733] (-394.705) (-391.832) -- 0:00:56
164000 -- (-390.368) (-389.732) [-390.434] (-396.192) * [-393.080] (-391.801) (-391.505) (-394.193) -- 0:00:56
164500 -- (-392.448) (-390.935) [-391.117] (-390.391) * (-391.784) [-392.065] (-393.851) (-390.993) -- 0:00:55
165000 -- (-391.537) [-390.358] (-391.144) (-394.025) * [-389.125] (-392.080) (-390.269) (-389.367) -- 0:00:55
Average standard deviation of split frequencies: 0.020304
165500 -- [-390.630] (-392.173) (-395.123) (-393.742) * [-393.901] (-395.220) (-389.942) (-390.358) -- 0:00:55
166000 -- (-391.064) (-392.439) [-390.499] (-397.837) * (-396.740) (-389.306) (-392.071) [-392.273] -- 0:00:55
166500 -- [-391.851] (-390.914) (-390.102) (-393.782) * (-390.271) (-389.502) (-390.668) [-390.538] -- 0:00:55
167000 -- (-393.573) (-389.276) (-392.597) [-392.531] * (-390.739) (-390.614) [-390.037] (-392.260) -- 0:00:54
167500 -- [-391.543] (-389.560) (-392.038) (-391.908) * (-390.093) (-395.030) (-390.386) [-391.028] -- 0:00:54
168000 -- (-389.572) [-389.480] (-391.629) (-389.775) * (-391.308) (-390.265) [-390.846] (-389.536) -- 0:00:54
168500 -- [-395.146] (-389.414) (-390.327) (-394.017) * (-390.665) (-393.578) [-390.084] (-390.766) -- 0:00:54
169000 -- (-395.504) [-389.425] (-390.911) (-390.948) * (-390.358) [-393.464] (-389.645) (-394.315) -- 0:00:54
169500 -- (-390.615) [-390.388] (-390.036) (-390.413) * (-392.253) (-395.750) [-389.780] (-392.565) -- 0:00:53
170000 -- (-390.403) [-392.367] (-389.921) (-390.631) * (-392.552) (-391.738) [-394.547] (-392.709) -- 0:00:53
Average standard deviation of split frequencies: 0.019586
170500 -- [-389.496] (-389.639) (-391.368) (-389.076) * (-393.546) (-390.486) [-390.378] (-392.269) -- 0:00:53
171000 -- (-392.387) (-390.419) [-392.552] (-389.816) * (-390.904) [-390.196] (-391.570) (-395.343) -- 0:00:53
171500 -- [-391.080] (-391.992) (-394.176) (-390.573) * (-390.808) [-390.145] (-396.395) (-390.038) -- 0:00:53
172000 -- (-390.612) [-391.769] (-390.183) (-391.391) * (-393.191) (-392.043) (-397.037) [-394.204] -- 0:00:52
172500 -- [-391.292] (-391.934) (-391.399) (-390.369) * (-391.487) (-390.038) [-392.168] (-397.326) -- 0:00:52
173000 -- (-392.194) (-390.308) (-393.602) [-391.354] * (-391.614) (-391.017) [-394.108] (-394.734) -- 0:00:52
173500 -- [-395.430] (-390.123) (-394.053) (-392.522) * (-392.728) (-390.643) (-391.811) [-390.600] -- 0:00:52
174000 -- [-389.602] (-389.926) (-389.861) (-390.275) * (-392.188) (-391.693) [-390.071] (-389.289) -- 0:00:52
174500 -- (-390.320) (-390.725) [-391.191] (-390.771) * (-389.925) (-394.453) [-390.434] (-389.388) -- 0:00:52
175000 -- (-392.362) (-390.702) [-395.859] (-392.862) * (-390.040) (-391.879) (-397.417) [-390.435] -- 0:00:51
Average standard deviation of split frequencies: 0.020356
175500 -- (-392.274) (-391.085) [-396.315] (-391.530) * (-390.078) [-390.617] (-394.541) (-390.446) -- 0:00:51
176000 -- (-391.617) (-391.679) (-392.255) [-392.079] * [-391.626] (-392.810) (-389.826) (-392.547) -- 0:00:51
176500 -- (-389.271) [-390.456] (-391.123) (-392.616) * (-389.577) (-392.069) [-389.373] (-391.731) -- 0:00:51
177000 -- (-391.884) [-391.213] (-394.318) (-392.930) * [-390.600] (-391.933) (-393.992) (-391.976) -- 0:00:51
177500 -- (-391.676) [-392.281] (-393.151) (-394.465) * (-394.187) [-391.437] (-390.916) (-394.817) -- 0:00:55
178000 -- (-391.911) (-391.591) [-392.931] (-395.468) * [-395.794] (-392.553) (-389.672) (-390.596) -- 0:00:55
178500 -- (-391.125) (-389.794) (-390.164) [-399.361] * (-391.800) [-390.996] (-390.015) (-392.987) -- 0:00:55
179000 -- (-390.015) (-391.455) [-397.050] (-391.040) * (-389.916) [-391.082] (-391.424) (-396.431) -- 0:00:55
179500 -- (-391.699) [-389.274] (-394.101) (-391.479) * (-390.757) (-389.771) [-393.146] (-393.501) -- 0:00:54
180000 -- (-391.444) [-389.698] (-391.197) (-390.607) * [-393.652] (-391.609) (-391.666) (-392.826) -- 0:00:54
Average standard deviation of split frequencies: 0.021454
180500 -- (-393.055) (-390.348) (-392.544) [-390.262] * (-390.434) (-393.909) (-391.984) [-393.303] -- 0:00:54
181000 -- (-391.305) (-390.180) [-390.970] (-392.039) * (-389.478) (-393.091) (-390.096) [-390.563] -- 0:00:54
181500 -- (-390.871) (-389.899) [-393.311] (-390.809) * (-391.860) [-391.113] (-392.696) (-391.219) -- 0:00:54
182000 -- (-394.376) (-391.626) (-390.663) [-391.740] * (-390.735) (-390.493) [-390.333] (-391.029) -- 0:00:53
182500 -- (-390.734) (-394.931) [-390.605] (-393.024) * (-392.522) [-390.107] (-391.491) (-393.497) -- 0:00:53
183000 -- (-392.940) [-393.451] (-389.228) (-391.520) * (-390.862) [-389.879] (-390.073) (-393.141) -- 0:00:53
183500 -- [-390.802] (-394.771) (-391.062) (-391.930) * (-390.857) (-391.709) [-389.822] (-390.840) -- 0:00:53
184000 -- (-391.858) (-389.178) (-390.888) [-390.805] * (-391.893) [-391.728] (-390.622) (-389.071) -- 0:00:53
184500 -- [-392.912] (-389.908) (-389.828) (-393.839) * (-391.408) [-390.601] (-392.507) (-389.556) -- 0:00:53
185000 -- (-391.216) [-389.612] (-390.492) (-389.801) * (-391.751) [-390.580] (-391.364) (-392.517) -- 0:00:52
Average standard deviation of split frequencies: 0.018755
185500 -- [-390.473] (-389.410) (-394.453) (-389.977) * (-391.550) (-390.326) [-390.498] (-390.199) -- 0:00:52
186000 -- (-391.275) (-389.216) [-390.559] (-396.315) * (-391.010) (-389.402) [-391.181] (-390.634) -- 0:00:52
186500 -- (-393.742) (-389.527) [-390.505] (-394.273) * [-393.432] (-391.475) (-395.291) (-389.821) -- 0:00:52
187000 -- (-395.873) [-392.781] (-391.033) (-390.930) * (-390.220) (-393.485) [-393.457] (-396.093) -- 0:00:52
187500 -- [-391.837] (-392.318) (-391.218) (-389.273) * [-389.541] (-394.379) (-390.556) (-393.746) -- 0:00:52
188000 -- (-392.383) [-391.000] (-390.027) (-389.438) * (-389.583) [-392.406] (-391.298) (-391.409) -- 0:00:51
188500 -- (-391.696) (-390.929) [-390.378] (-390.349) * (-390.041) [-390.640] (-390.778) (-389.836) -- 0:00:51
189000 -- (-390.354) (-391.191) (-390.822) [-390.063] * (-393.083) (-391.853) (-391.965) [-395.988] -- 0:00:51
189500 -- [-391.687] (-390.229) (-390.757) (-390.114) * [-394.727] (-390.912) (-395.228) (-390.920) -- 0:00:51
190000 -- [-389.903] (-391.145) (-390.643) (-392.471) * (-391.757) (-389.078) [-391.853] (-389.697) -- 0:00:51
Average standard deviation of split frequencies: 0.017060
190500 -- [-390.310] (-390.338) (-390.782) (-391.249) * [-392.764] (-389.668) (-389.761) (-390.046) -- 0:00:50
191000 -- [-394.507] (-390.814) (-389.691) (-390.336) * (-394.728) [-391.597] (-391.698) (-389.340) -- 0:00:50
191500 -- (-390.075) (-391.451) (-390.264) [-394.133] * [-391.619] (-392.576) (-391.389) (-393.705) -- 0:00:50
192000 -- (-390.837) (-393.503) [-392.079] (-390.951) * (-391.585) (-391.630) [-390.459] (-394.163) -- 0:00:50
192500 -- [-390.199] (-393.020) (-391.014) (-390.503) * [-390.743] (-390.841) (-389.388) (-395.507) -- 0:00:50
193000 -- [-393.267] (-390.775) (-391.556) (-392.298) * (-394.958) (-391.873) (-394.490) [-391.342] -- 0:00:50
193500 -- (-392.391) (-390.508) [-389.734] (-395.769) * [-394.805] (-390.746) (-392.657) (-395.359) -- 0:00:50
194000 -- (-393.050) (-389.992) [-389.685] (-391.159) * (-389.622) (-391.129) (-395.056) [-391.345] -- 0:00:49
194500 -- (-389.196) [-390.938] (-391.477) (-393.507) * (-391.478) (-390.916) (-396.835) [-391.127] -- 0:00:53
195000 -- (-389.488) [-390.628] (-392.062) (-391.099) * (-392.198) [-392.011] (-393.460) (-393.188) -- 0:00:53
Average standard deviation of split frequencies: 0.015633
195500 -- (-394.315) (-391.640) [-391.465] (-389.979) * (-394.094) (-395.822) [-390.187] (-394.940) -- 0:00:53
196000 -- (-392.720) (-389.899) [-392.725] (-390.493) * (-390.207) [-390.746] (-392.833) (-394.672) -- 0:00:53
196500 -- (-391.028) (-389.406) [-391.393] (-389.216) * (-391.080) [-390.666] (-390.558) (-391.033) -- 0:00:53
197000 -- (-390.279) (-390.621) (-389.573) [-391.312] * (-390.082) [-391.785] (-391.480) (-392.610) -- 0:00:52
197500 -- (-391.442) (-390.260) [-390.208] (-391.732) * [-392.178] (-389.545) (-390.668) (-392.273) -- 0:00:52
198000 -- (-390.953) (-390.613) [-390.143] (-390.134) * (-390.629) [-393.592] (-391.038) (-390.171) -- 0:00:52
198500 -- (-390.313) [-390.956] (-389.827) (-390.750) * (-393.775) (-391.171) (-389.766) [-390.866] -- 0:00:52
199000 -- [-390.475] (-389.160) (-389.321) (-391.378) * (-395.061) (-392.687) (-394.742) [-390.961] -- 0:00:52
199500 -- (-392.606) (-394.507) (-397.866) [-391.141] * [-394.033] (-390.507) (-391.837) (-391.955) -- 0:00:52
200000 -- (-391.725) (-393.481) (-392.668) [-391.145] * (-389.872) (-392.339) [-393.227] (-393.766) -- 0:00:51
Average standard deviation of split frequencies: 0.015201
200500 -- [-390.903] (-393.107) (-390.995) (-392.527) * (-389.928) (-392.633) (-392.239) [-391.759] -- 0:00:51
201000 -- (-390.009) (-392.317) [-390.623] (-392.152) * (-392.959) (-392.909) (-393.106) [-390.209] -- 0:00:51
201500 -- (-390.879) (-396.273) [-391.276] (-391.182) * [-392.669] (-390.188) (-392.849) (-395.164) -- 0:00:51
202000 -- (-390.468) (-395.397) (-392.482) [-392.287] * (-390.856) (-393.078) [-389.100] (-393.428) -- 0:00:51
202500 -- (-389.549) (-391.324) (-392.327) [-391.596] * (-389.446) [-390.705] (-390.072) (-391.580) -- 0:00:51
203000 -- (-390.052) [-390.409] (-394.397) (-391.749) * [-389.113] (-390.725) (-393.414) (-391.301) -- 0:00:51
203500 -- (-391.741) (-390.013) [-393.098] (-390.735) * (-389.492) [-392.393] (-390.796) (-392.640) -- 0:00:50
204000 -- (-395.595) [-392.565] (-391.203) (-391.881) * [-391.037] (-390.738) (-390.703) (-391.493) -- 0:00:50
204500 -- (-390.403) (-396.097) (-392.831) [-391.106] * [-389.173] (-389.920) (-392.195) (-393.099) -- 0:00:50
205000 -- (-392.391) (-396.153) [-390.541] (-391.427) * (-390.698) [-391.955] (-391.119) (-394.679) -- 0:00:50
Average standard deviation of split frequencies: 0.014453
205500 -- (-391.854) [-392.024] (-391.025) (-392.499) * (-389.822) (-392.409) (-391.405) [-390.266] -- 0:00:50
206000 -- [-393.935] (-392.518) (-391.285) (-391.783) * (-389.783) (-391.163) [-390.558] (-399.095) -- 0:00:50
206500 -- (-395.797) (-391.990) (-391.477) [-394.174] * [-390.215] (-391.264) (-391.092) (-393.000) -- 0:00:49
207000 -- (-390.733) [-390.412] (-389.699) (-394.074) * (-390.849) (-396.640) [-391.333] (-389.789) -- 0:00:49
207500 -- (-390.215) (-395.962) [-390.687] (-389.286) * (-393.835) (-394.253) [-392.338] (-391.000) -- 0:00:49
208000 -- [-389.771] (-389.903) (-393.413) (-389.587) * (-390.395) (-393.955) [-389.556] (-394.973) -- 0:00:49
208500 -- [-390.828] (-390.187) (-392.405) (-391.718) * [-389.303] (-392.428) (-390.971) (-392.304) -- 0:00:49
209000 -- (-390.697) [-390.836] (-391.008) (-392.904) * (-389.567) (-394.408) (-390.989) [-390.559] -- 0:00:49
209500 -- (-392.403) (-389.670) (-393.302) [-391.066] * (-390.205) [-389.485] (-391.378) (-390.581) -- 0:00:49
210000 -- (-389.950) [-391.737] (-391.078) (-391.767) * [-392.472] (-390.040) (-393.129) (-394.261) -- 0:00:48
Average standard deviation of split frequencies: 0.013426
210500 -- [-391.084] (-391.574) (-397.358) (-390.596) * [-392.184] (-394.022) (-391.956) (-392.206) -- 0:00:48
211000 -- (-389.960) (-395.745) (-391.625) [-391.262] * [-389.624] (-391.174) (-389.800) (-390.412) -- 0:00:48
211500 -- [-395.065] (-391.134) (-390.218) (-393.989) * [-389.813] (-390.464) (-392.182) (-389.362) -- 0:00:48
212000 -- (-390.358) (-391.382) (-389.289) [-394.331] * (-390.909) [-389.674] (-392.081) (-389.647) -- 0:00:52
212500 -- (-391.702) (-390.247) [-393.248] (-392.319) * (-392.060) [-392.051] (-391.108) (-390.353) -- 0:00:51
213000 -- (-393.815) (-392.517) (-392.005) [-392.624] * (-391.741) (-390.929) [-395.336] (-391.388) -- 0:00:51
213500 -- (-393.126) [-390.918] (-392.135) (-394.079) * [-393.018] (-389.952) (-389.542) (-392.635) -- 0:00:51
214000 -- (-392.110) (-391.521) [-390.072] (-389.834) * [-390.362] (-389.918) (-393.351) (-389.135) -- 0:00:51
214500 -- (-389.949) (-392.677) (-391.090) [-389.468] * (-393.132) (-392.380) [-389.804] (-391.430) -- 0:00:51
215000 -- [-391.647] (-391.491) (-392.625) (-391.296) * (-390.709) [-392.305] (-391.419) (-397.895) -- 0:00:51
Average standard deviation of split frequencies: 0.013865
215500 -- (-392.177) [-389.453] (-391.970) (-393.201) * (-392.276) (-391.334) [-392.494] (-390.441) -- 0:00:50
216000 -- (-391.124) [-391.881] (-389.650) (-396.892) * (-390.466) (-393.219) [-391.251] (-389.776) -- 0:00:50
216500 -- (-396.389) (-391.001) [-390.319] (-392.033) * (-392.514) (-396.435) [-392.285] (-389.252) -- 0:00:50
217000 -- (-390.080) [-392.224] (-390.263) (-394.669) * (-389.554) [-394.592] (-391.190) (-389.420) -- 0:00:50
217500 -- (-392.435) (-390.247) [-389.979] (-390.293) * (-389.637) (-402.028) [-389.989] (-389.808) -- 0:00:50
218000 -- [-390.328] (-394.168) (-391.990) (-389.818) * (-390.321) (-390.305) [-390.726] (-391.876) -- 0:00:50
218500 -- [-392.074] (-393.616) (-390.806) (-389.415) * [-390.490] (-391.631) (-393.710) (-390.703) -- 0:00:50
219000 -- (-395.303) (-390.720) [-390.070] (-390.303) * (-391.286) [-390.198] (-389.782) (-395.265) -- 0:00:49
219500 -- (-396.662) [-389.876] (-396.898) (-390.062) * [-390.235] (-392.719) (-390.599) (-391.506) -- 0:00:49
220000 -- (-391.893) (-402.495) [-391.083] (-389.910) * (-391.809) (-391.353) (-391.394) [-392.368] -- 0:00:49
Average standard deviation of split frequencies: 0.014326
220500 -- [-393.595] (-396.105) (-390.572) (-392.081) * (-390.561) (-392.159) [-391.795] (-393.620) -- 0:00:49
221000 -- (-391.744) (-394.005) (-391.762) [-390.248] * [-391.284] (-390.306) (-390.875) (-391.437) -- 0:00:49
221500 -- (-393.835) (-392.209) [-391.811] (-392.017) * (-393.850) [-392.885] (-392.113) (-390.220) -- 0:00:49
222000 -- (-391.030) [-393.644] (-394.478) (-389.929) * (-392.369) (-401.388) [-394.146] (-391.437) -- 0:00:49
222500 -- (-391.802) [-390.239] (-390.973) (-391.469) * [-390.395] (-399.712) (-391.911) (-390.576) -- 0:00:48
223000 -- (-392.092) (-390.815) [-391.537] (-392.423) * [-391.119] (-391.967) (-390.335) (-389.810) -- 0:00:48
223500 -- (-392.409) [-391.961] (-391.362) (-394.634) * [-391.130] (-390.588) (-389.375) (-396.284) -- 0:00:48
224000 -- (-392.197) [-390.178] (-391.041) (-394.369) * (-392.345) (-392.703) [-390.026] (-391.557) -- 0:00:48
224500 -- [-391.136] (-390.571) (-396.348) (-389.585) * (-391.118) (-390.505) [-391.517] (-392.452) -- 0:00:48
225000 -- (-389.931) (-389.754) [-389.635] (-393.883) * (-390.528) (-390.090) [-390.737] (-391.807) -- 0:00:48
Average standard deviation of split frequencies: 0.012979
225500 -- (-389.725) (-391.933) [-389.912] (-389.681) * (-390.746) (-391.683) (-389.364) [-391.068] -- 0:00:48
226000 -- (-391.581) (-392.012) [-394.235] (-393.884) * (-389.111) (-390.929) [-392.770] (-394.594) -- 0:00:47
226500 -- (-392.354) (-390.775) [-391.029] (-391.808) * (-391.203) [-390.702] (-394.837) (-392.923) -- 0:00:47
227000 -- [-393.153] (-389.587) (-391.518) (-393.279) * [-390.459] (-389.448) (-390.428) (-391.137) -- 0:00:47
227500 -- (-395.422) (-390.534) [-391.256] (-392.864) * (-390.760) [-391.068] (-392.455) (-393.284) -- 0:00:47
228000 -- (-392.672) (-391.295) [-392.251] (-391.548) * (-390.975) (-390.828) (-391.216) [-391.072] -- 0:00:47
228500 -- (-391.219) [-393.457] (-389.635) (-393.032) * [-389.433] (-394.357) (-396.083) (-390.566) -- 0:00:50
229000 -- (-389.895) (-391.330) [-392.899] (-393.510) * (-391.229) [-390.227] (-393.944) (-391.562) -- 0:00:50
229500 -- [-389.568] (-389.974) (-393.778) (-392.041) * (-392.444) [-391.375] (-391.215) (-393.653) -- 0:00:50
230000 -- (-392.888) (-390.089) (-391.133) [-392.005] * [-395.474] (-389.856) (-391.566) (-391.749) -- 0:00:50
Average standard deviation of split frequencies: 0.011808
230500 -- (-392.249) (-390.543) (-394.589) [-393.158] * (-396.414) [-389.814] (-395.667) (-392.576) -- 0:00:50
231000 -- (-391.534) (-393.295) [-392.602] (-391.455) * (-399.603) (-390.213) (-392.654) [-391.369] -- 0:00:49
231500 -- [-390.950] (-391.240) (-389.746) (-392.311) * [-392.303] (-392.965) (-390.185) (-391.144) -- 0:00:49
232000 -- (-395.176) [-390.719] (-390.704) (-389.205) * (-390.594) [-391.976] (-392.559) (-395.343) -- 0:00:49
232500 -- [-390.061] (-392.754) (-390.981) (-391.445) * [-392.000] (-390.769) (-392.054) (-393.704) -- 0:00:49
233000 -- [-390.558] (-397.239) (-391.924) (-393.415) * [-390.021] (-391.017) (-390.487) (-393.798) -- 0:00:49
233500 -- (-393.699) [-390.611] (-391.466) (-390.991) * (-389.406) (-392.557) (-390.101) [-391.827] -- 0:00:49
234000 -- (-393.128) (-389.745) (-390.773) [-390.215] * (-392.009) (-390.810) (-391.608) [-390.925] -- 0:00:49
234500 -- [-392.866] (-389.670) (-390.678) (-390.501) * (-394.075) [-389.500] (-393.195) (-390.670) -- 0:00:48
235000 -- (-389.950) (-390.188) [-389.051] (-390.601) * (-392.184) [-390.193] (-392.418) (-391.613) -- 0:00:48
Average standard deviation of split frequencies: 0.010653
235500 -- (-393.583) (-391.503) [-391.270] (-389.359) * (-389.630) (-392.984) (-389.913) [-390.450] -- 0:00:48
236000 -- [-391.444] (-395.088) (-391.677) (-393.110) * [-390.587] (-397.247) (-392.045) (-389.823) -- 0:00:48
236500 -- [-390.446] (-390.105) (-391.978) (-390.567) * (-390.182) (-395.660) (-390.667) [-389.897] -- 0:00:48
237000 -- [-393.422] (-390.917) (-389.795) (-391.166) * (-390.203) [-394.092] (-390.498) (-391.179) -- 0:00:48
237500 -- (-392.961) (-391.822) (-390.040) [-390.980] * (-390.449) (-396.690) (-391.869) [-391.697] -- 0:00:48
238000 -- (-391.004) (-392.035) [-389.172] (-391.896) * (-395.749) (-391.315) [-390.120] (-391.601) -- 0:00:48
238500 -- (-393.983) [-391.469] (-390.338) (-392.277) * [-392.597] (-391.258) (-392.629) (-390.118) -- 0:00:47
239000 -- (-395.151) (-389.586) [-391.894] (-390.351) * [-391.421] (-393.192) (-391.859) (-389.463) -- 0:00:47
239500 -- [-391.369] (-391.538) (-392.574) (-391.462) * (-391.018) [-397.250] (-393.160) (-394.182) -- 0:00:47
240000 -- (-391.358) [-393.062] (-389.969) (-390.220) * (-390.981) (-392.033) (-390.302) [-390.825] -- 0:00:47
Average standard deviation of split frequencies: 0.012559
240500 -- [-390.574] (-394.212) (-391.474) (-390.611) * (-390.621) (-389.760) (-389.822) [-390.611] -- 0:00:47
241000 -- (-393.449) (-392.428) [-392.886] (-390.119) * [-390.991] (-389.276) (-390.597) (-390.966) -- 0:00:47
241500 -- (-392.044) [-390.808] (-389.967) (-389.696) * [-389.686] (-392.222) (-389.672) (-392.458) -- 0:00:47
242000 -- (-389.310) (-391.580) [-389.662] (-392.910) * [-391.337] (-389.299) (-391.969) (-392.176) -- 0:00:46
242500 -- (-392.264) [-392.123] (-390.750) (-392.413) * (-391.413) (-389.591) (-396.023) [-393.829] -- 0:00:46
243000 -- (-391.906) (-390.705) (-389.959) [-390.057] * [-392.218] (-389.596) (-397.280) (-391.465) -- 0:00:46
243500 -- [-390.638] (-390.040) (-391.039) (-389.711) * (-389.817) (-389.235) (-400.043) [-392.115] -- 0:00:46
244000 -- [-390.236] (-392.921) (-391.624) (-392.107) * (-390.724) [-395.947] (-396.938) (-389.448) -- 0:00:46
244500 -- [-390.311] (-389.646) (-390.884) (-390.883) * (-390.047) (-390.469) (-393.630) [-389.356] -- 0:00:46
245000 -- (-397.593) (-393.811) [-391.207] (-394.107) * (-390.091) (-391.896) (-391.913) [-389.852] -- 0:00:46
Average standard deviation of split frequencies: 0.013212
245500 -- (-394.785) (-391.140) (-389.768) [-395.448] * [-390.523] (-391.545) (-392.928) (-390.671) -- 0:00:46
246000 -- [-391.717] (-393.452) (-398.366) (-392.106) * [-390.852] (-392.115) (-398.847) (-389.551) -- 0:00:49
246500 -- [-389.587] (-390.546) (-390.716) (-394.527) * [-391.720] (-391.803) (-391.369) (-393.606) -- 0:00:48
247000 -- (-389.121) [-394.004] (-390.931) (-391.186) * (-391.042) (-391.152) [-389.601] (-390.645) -- 0:00:48
247500 -- (-389.413) (-394.283) (-390.699) [-390.689] * (-391.029) [-389.958] (-389.461) (-394.989) -- 0:00:48
248000 -- (-389.541) (-394.850) (-393.811) [-390.275] * (-395.011) [-390.085] (-392.079) (-394.872) -- 0:00:48
248500 -- (-390.484) (-395.362) [-392.106] (-394.866) * (-389.398) (-391.185) (-391.632) [-392.572] -- 0:00:48
249000 -- (-393.904) [-390.009] (-390.970) (-394.373) * [-391.870] (-391.418) (-391.463) (-392.867) -- 0:00:48
249500 -- (-389.931) (-390.017) (-391.063) [-390.242] * (-394.575) (-390.307) [-392.448] (-392.093) -- 0:00:48
250000 -- (-393.974) (-392.425) [-390.139] (-390.288) * (-393.925) (-393.662) (-390.449) [-392.576] -- 0:00:48
Average standard deviation of split frequencies: 0.014253
250500 -- (-392.109) (-392.376) [-391.168] (-392.925) * (-389.527) (-394.563) (-392.162) [-391.017] -- 0:00:47
251000 -- [-392.020] (-391.744) (-391.029) (-391.983) * [-389.732] (-389.842) (-396.044) (-390.414) -- 0:00:47
251500 -- (-393.855) (-390.952) [-390.539] (-393.842) * (-390.949) [-389.763] (-394.457) (-394.773) -- 0:00:47
252000 -- [-392.227] (-392.091) (-390.579) (-389.582) * [-389.709] (-389.329) (-389.594) (-391.536) -- 0:00:47
252500 -- (-392.819) (-394.365) (-392.207) [-390.476] * (-389.256) (-390.357) (-390.103) [-391.228] -- 0:00:47
253000 -- [-389.806] (-392.546) (-390.222) (-389.911) * (-390.688) [-393.540] (-391.171) (-389.442) -- 0:00:47
253500 -- (-390.122) (-392.291) (-391.153) [-390.463] * (-396.727) (-394.606) [-390.369] (-389.639) -- 0:00:47
254000 -- (-391.975) (-392.103) (-394.129) [-391.861] * [-393.628] (-391.215) (-395.060) (-393.355) -- 0:00:46
254500 -- [-392.012] (-389.724) (-394.983) (-396.356) * (-393.361) [-390.329] (-395.646) (-389.803) -- 0:00:46
255000 -- (-391.614) (-389.798) [-390.837] (-392.488) * (-390.858) (-391.871) (-391.181) [-392.148] -- 0:00:46
Average standard deviation of split frequencies: 0.012696
255500 -- (-391.501) [-390.807] (-393.357) (-391.637) * (-390.486) [-390.150] (-393.351) (-393.499) -- 0:00:46
256000 -- (-391.443) (-391.201) (-392.520) [-397.185] * (-391.136) [-392.329] (-389.208) (-392.941) -- 0:00:46
256500 -- [-390.955] (-391.734) (-391.976) (-395.030) * (-390.146) (-391.873) [-389.725] (-393.168) -- 0:00:46
257000 -- (-392.085) (-389.728) [-390.014] (-394.504) * (-392.110) [-390.546] (-391.784) (-391.595) -- 0:00:46
257500 -- (-392.362) (-389.577) (-391.388) [-392.122] * (-391.087) (-390.478) [-391.154] (-396.308) -- 0:00:46
258000 -- (-393.342) (-395.176) [-390.412] (-392.991) * [-390.902] (-390.674) (-390.936) (-392.473) -- 0:00:46
258500 -- (-396.055) (-390.972) [-390.861] (-395.526) * (-396.970) (-391.508) (-392.264) [-390.510] -- 0:00:45
259000 -- [-395.161] (-390.005) (-391.161) (-394.526) * (-392.898) (-390.416) (-391.532) [-391.598] -- 0:00:45
259500 -- (-398.465) (-390.456) [-391.143] (-391.764) * [-393.239] (-390.815) (-393.146) (-390.804) -- 0:00:45
260000 -- [-390.428] (-389.517) (-396.073) (-390.782) * [-390.881] (-393.343) (-392.288) (-390.621) -- 0:00:45
Average standard deviation of split frequencies: 0.011041
260500 -- (-391.276) (-390.300) [-393.653] (-389.747) * (-391.034) (-394.466) (-392.499) [-389.608] -- 0:00:45
261000 -- (-390.310) (-405.077) [-389.573] (-390.480) * (-393.290) (-393.011) (-389.474) [-391.198] -- 0:00:45
261500 -- (-391.738) (-402.860) (-390.375) [-390.979] * (-391.588) [-392.231] (-391.824) (-391.483) -- 0:00:45
262000 -- (-390.391) (-402.094) (-392.366) [-389.880] * (-392.298) (-392.518) [-391.720] (-391.461) -- 0:00:45
262500 -- (-390.277) [-391.389] (-392.390) (-393.930) * [-391.352] (-390.526) (-393.906) (-392.563) -- 0:00:44
263000 -- (-389.895) [-389.786] (-389.106) (-390.857) * [-390.176] (-392.822) (-392.405) (-390.008) -- 0:00:47
263500 -- [-391.352] (-390.839) (-394.170) (-389.657) * [-392.794] (-392.617) (-395.701) (-391.554) -- 0:00:47
264000 -- [-390.404] (-390.179) (-392.778) (-391.257) * (-391.717) [-393.829] (-391.606) (-391.749) -- 0:00:47
264500 -- (-390.303) (-392.314) (-389.953) [-389.276] * (-394.508) [-393.377] (-389.242) (-392.117) -- 0:00:47
265000 -- (-391.819) [-390.115] (-391.004) (-393.331) * [-389.705] (-397.174) (-391.411) (-393.797) -- 0:00:47
Average standard deviation of split frequencies: 0.012312
265500 -- [-391.479] (-389.542) (-389.762) (-390.186) * (-390.755) (-391.506) [-392.384] (-393.478) -- 0:00:47
266000 -- [-391.976] (-390.277) (-390.233) (-393.181) * (-391.920) (-392.710) [-389.532] (-391.567) -- 0:00:46
266500 -- (-392.170) (-390.739) (-392.494) [-390.083] * (-392.626) (-390.265) [-391.090] (-390.833) -- 0:00:46
267000 -- (-394.048) (-391.129) [-389.534] (-391.556) * (-390.444) (-391.321) (-389.970) [-389.293] -- 0:00:46
267500 -- (-392.631) [-392.790] (-388.928) (-392.851) * (-393.385) (-392.431) [-394.391] (-390.025) -- 0:00:46
268000 -- (-390.150) [-390.889] (-389.877) (-389.767) * [-393.101] (-392.805) (-392.007) (-391.841) -- 0:00:46
268500 -- (-393.501) (-389.858) (-395.534) [-389.957] * (-392.839) (-389.078) [-392.732] (-392.712) -- 0:00:46
269000 -- (-391.453) [-390.393] (-392.178) (-389.976) * (-393.112) [-389.750] (-392.164) (-390.657) -- 0:00:46
269500 -- (-391.758) (-393.896) [-392.807] (-391.048) * (-391.948) (-391.387) (-390.656) [-395.248] -- 0:00:46
270000 -- (-390.975) (-391.014) [-391.165] (-390.157) * (-389.572) (-389.539) [-390.779] (-390.777) -- 0:00:45
Average standard deviation of split frequencies: 0.012466
270500 -- [-389.909] (-391.637) (-394.727) (-390.302) * [-390.842] (-392.650) (-392.447) (-391.851) -- 0:00:45
271000 -- (-390.593) (-390.859) (-392.071) [-389.223] * (-392.375) [-390.860] (-390.297) (-394.073) -- 0:00:45
271500 -- (-391.473) (-391.207) [-390.842] (-390.755) * [-394.348] (-389.540) (-389.952) (-390.492) -- 0:00:45
272000 -- (-389.333) (-390.392) [-392.557] (-391.592) * [-390.187] (-390.782) (-392.228) (-391.040) -- 0:00:45
272500 -- (-393.828) (-392.271) (-393.576) [-391.653] * [-389.183] (-390.940) (-393.567) (-390.306) -- 0:00:45
273000 -- [-390.964] (-392.138) (-389.618) (-395.137) * (-390.902) (-390.250) (-389.228) [-390.533] -- 0:00:45
273500 -- (-392.293) [-389.379] (-392.481) (-393.019) * (-394.669) (-389.946) [-389.866] (-389.698) -- 0:00:45
274000 -- (-390.943) [-390.939] (-391.987) (-393.403) * (-391.150) (-398.926) [-389.252] (-391.135) -- 0:00:45
274500 -- [-389.666] (-390.043) (-393.745) (-389.728) * [-391.211] (-391.113) (-390.098) (-390.467) -- 0:00:44
275000 -- (-389.355) [-390.299] (-390.077) (-389.197) * (-394.021) (-391.005) (-389.481) [-391.754] -- 0:00:44
Average standard deviation of split frequencies: 0.011956
275500 -- (-391.547) [-390.508] (-393.475) (-390.937) * [-394.068] (-389.612) (-398.152) (-389.291) -- 0:00:44
276000 -- (-392.623) (-389.311) (-390.883) [-392.270] * (-391.880) (-392.135) [-392.983] (-392.031) -- 0:00:44
276500 -- [-390.027] (-394.154) (-391.710) (-394.360) * (-390.544) (-389.766) (-391.311) [-390.362] -- 0:00:44
277000 -- (-390.766) [-390.160] (-390.732) (-391.587) * (-390.277) (-393.026) [-391.039] (-389.758) -- 0:00:44
277500 -- (-393.162) [-391.658] (-391.842) (-390.829) * (-389.416) (-393.437) [-389.736] (-394.641) -- 0:00:44
278000 -- (-391.560) (-395.800) [-391.201] (-393.986) * [-389.668] (-394.558) (-390.040) (-390.183) -- 0:00:44
278500 -- (-392.490) [-390.004] (-391.026) (-393.695) * (-390.680) (-390.880) (-389.391) [-390.307] -- 0:00:44
279000 -- (-392.292) (-390.665) (-395.853) [-390.255] * (-389.865) [-390.657] (-390.024) (-393.859) -- 0:00:43
279500 -- (-392.198) [-390.396] (-391.320) (-389.253) * (-389.316) (-389.402) (-389.360) [-392.167] -- 0:00:43
280000 -- (-392.474) (-390.004) (-391.617) [-391.005] * (-390.474) [-389.706] (-394.486) (-391.096) -- 0:00:46
Average standard deviation of split frequencies: 0.011580
280500 -- (-391.042) [-390.270] (-390.673) (-390.340) * (-391.711) (-389.495) [-391.825] (-390.037) -- 0:00:46
281000 -- (-390.489) [-391.470] (-389.856) (-394.066) * [-391.030] (-396.552) (-391.390) (-390.762) -- 0:00:46
281500 -- (-391.755) [-390.159] (-390.011) (-389.875) * (-395.052) (-394.801) [-390.969] (-392.062) -- 0:00:45
282000 -- (-389.951) [-390.293] (-390.413) (-392.421) * (-392.031) (-390.247) (-391.905) [-390.694] -- 0:00:45
282500 -- (-390.554) (-391.114) (-391.910) [-389.426] * (-393.816) (-390.863) [-389.399] (-391.333) -- 0:00:45
283000 -- (-395.318) (-390.643) (-399.745) [-391.380] * [-392.504] (-389.854) (-389.685) (-394.847) -- 0:00:45
283500 -- (-393.229) (-395.916) (-392.972) [-391.395] * (-394.683) (-393.235) (-393.739) [-391.961] -- 0:00:45
284000 -- [-390.892] (-393.612) (-391.077) (-390.811) * (-393.700) (-391.735) (-391.315) [-390.483] -- 0:00:45
284500 -- (-393.212) (-394.252) [-390.792] (-390.835) * (-390.026) (-390.276) [-391.677] (-392.111) -- 0:00:45
285000 -- (-390.220) [-389.279] (-391.895) (-390.217) * [-390.707] (-392.491) (-397.643) (-391.042) -- 0:00:45
Average standard deviation of split frequencies: 0.009706
285500 -- [-393.208] (-392.328) (-394.249) (-389.477) * (-392.802) (-391.496) (-392.744) [-390.063] -- 0:00:45
286000 -- [-392.090] (-392.182) (-392.093) (-390.164) * (-394.571) [-390.325] (-390.859) (-390.052) -- 0:00:44
286500 -- [-393.015] (-396.427) (-389.633) (-394.493) * (-392.520) [-390.805] (-390.422) (-390.009) -- 0:00:44
287000 -- (-392.970) (-397.129) (-390.769) [-391.481] * (-391.151) [-393.571] (-391.325) (-392.333) -- 0:00:44
287500 -- (-393.263) (-394.840) [-389.604] (-395.218) * (-392.083) [-390.160] (-392.543) (-391.624) -- 0:00:44
288000 -- (-397.091) [-391.417] (-395.500) (-393.513) * (-390.599) [-390.264] (-390.372) (-391.374) -- 0:00:44
288500 -- [-393.011] (-390.702) (-391.866) (-390.718) * [-391.535] (-390.398) (-389.971) (-389.983) -- 0:00:44
289000 -- (-391.290) [-390.805] (-390.164) (-393.611) * (-391.497) (-394.541) [-390.262] (-389.453) -- 0:00:44
289500 -- (-390.605) (-390.828) (-393.991) [-390.463] * [-389.878] (-395.560) (-390.567) (-390.199) -- 0:00:44
290000 -- (-391.893) [-392.652] (-390.070) (-390.533) * (-391.117) (-390.076) (-392.863) [-391.821] -- 0:00:44
Average standard deviation of split frequencies: 0.008830
290500 -- (-389.757) (-391.702) [-392.022] (-394.632) * (-389.889) (-390.448) [-391.357] (-392.971) -- 0:00:43
291000 -- (-391.284) (-391.542) (-392.875) [-391.402] * (-390.479) (-389.928) [-390.539] (-389.763) -- 0:00:43
291500 -- (-391.416) [-392.043] (-391.065) (-391.381) * (-392.276) (-392.137) [-391.889] (-391.016) -- 0:00:43
292000 -- [-394.842] (-390.546) (-390.150) (-391.704) * (-391.684) [-393.149] (-390.912) (-391.662) -- 0:00:43
292500 -- [-393.323] (-389.783) (-394.471) (-394.611) * (-391.968) [-392.370] (-390.577) (-394.069) -- 0:00:43
293000 -- (-390.815) [-394.020] (-389.434) (-392.230) * [-390.526] (-394.867) (-391.778) (-391.855) -- 0:00:43
293500 -- (-390.889) (-389.995) (-389.588) [-392.785] * (-389.496) [-395.026] (-390.615) (-392.309) -- 0:00:43
294000 -- (-391.964) (-395.115) [-390.228] (-394.978) * (-390.802) [-394.617] (-394.802) (-392.380) -- 0:00:43
294500 -- (-390.579) [-391.330] (-391.924) (-391.452) * (-389.594) (-391.523) [-390.902] (-392.630) -- 0:00:43
295000 -- (-391.738) [-391.200] (-392.219) (-391.774) * (-390.364) (-392.856) (-391.695) [-389.368] -- 0:00:43
Average standard deviation of split frequencies: 0.008494
295500 -- (-391.840) (-389.761) [-392.703] (-391.326) * (-391.081) [-391.961] (-390.959) (-390.452) -- 0:00:42
296000 -- (-391.045) (-391.368) [-390.296] (-391.598) * [-391.052] (-395.441) (-394.262) (-390.272) -- 0:00:42
296500 -- (-389.502) (-393.483) (-394.114) [-390.553] * (-391.997) (-392.099) [-393.450] (-393.092) -- 0:00:42
297000 -- (-390.912) [-393.354] (-392.375) (-394.207) * (-392.059) [-392.436] (-392.468) (-392.249) -- 0:00:42
297500 -- (-391.241) (-393.813) [-390.790] (-390.617) * (-391.329) (-389.881) (-396.812) [-389.630] -- 0:00:44
298000 -- (-392.567) (-389.892) [-389.855] (-398.074) * (-390.576) (-390.127) (-390.595) [-390.702] -- 0:00:44
298500 -- (-396.412) (-390.694) [-389.627] (-390.471) * (-391.552) [-391.137] (-390.897) (-399.066) -- 0:00:44
299000 -- (-393.429) [-390.410] (-392.623) (-393.596) * (-389.679) [-394.191] (-393.906) (-391.034) -- 0:00:44
299500 -- (-393.659) (-389.966) [-391.308] (-390.613) * [-391.490] (-392.386) (-391.099) (-389.648) -- 0:00:44
300000 -- (-390.389) (-390.759) [-389.836] (-389.027) * (-391.719) [-393.512] (-394.117) (-392.415) -- 0:00:44
Average standard deviation of split frequencies: 0.009320
300500 -- (-391.719) [-391.533] (-390.914) (-391.571) * (-391.958) (-389.699) [-392.265] (-390.258) -- 0:00:44
301000 -- (-396.672) [-391.129] (-391.114) (-393.142) * (-392.665) [-390.002] (-391.119) (-389.907) -- 0:00:44
301500 -- [-390.590] (-392.564) (-389.891) (-390.736) * (-396.213) (-394.574) (-394.910) [-390.637] -- 0:00:44
302000 -- (-392.017) [-391.162] (-389.852) (-389.931) * (-390.527) [-393.209] (-393.848) (-390.769) -- 0:00:43
302500 -- (-390.013) (-393.014) [-391.112] (-389.201) * (-391.991) (-391.091) [-389.410] (-391.597) -- 0:00:43
303000 -- (-391.863) [-392.073] (-391.003) (-390.037) * (-395.124) (-392.957) (-389.674) [-389.344] -- 0:00:43
303500 -- (-389.718) [-392.130] (-394.944) (-390.237) * [-389.558] (-393.066) (-389.540) (-391.141) -- 0:00:43
304000 -- (-390.290) [-391.446] (-392.947) (-392.128) * (-390.733) [-389.942] (-392.336) (-392.640) -- 0:00:43
304500 -- (-390.625) [-390.031] (-393.473) (-391.706) * (-392.208) (-389.398) (-390.191) [-390.020] -- 0:00:43
305000 -- (-391.310) (-390.056) [-389.132] (-392.189) * (-389.824) (-390.287) (-394.089) [-391.042] -- 0:00:43
Average standard deviation of split frequencies: 0.010541
305500 -- (-392.985) [-390.198] (-389.240) (-393.146) * (-392.855) [-389.306] (-391.202) (-398.206) -- 0:00:43
306000 -- (-391.700) (-390.826) [-388.953] (-393.016) * (-392.374) (-390.980) [-391.684] (-394.630) -- 0:00:43
306500 -- (-390.070) (-391.153) [-389.672] (-393.715) * [-390.488] (-389.771) (-395.871) (-392.488) -- 0:00:42
307000 -- (-391.131) (-394.121) [-390.831] (-392.217) * [-390.996] (-392.443) (-390.292) (-393.129) -- 0:00:42
307500 -- (-392.707) (-390.563) (-390.870) [-391.658] * (-394.645) (-391.762) (-390.570) [-391.537] -- 0:00:42
308000 -- [-390.868] (-392.431) (-394.694) (-389.449) * (-392.683) (-394.276) [-395.249] (-389.531) -- 0:00:42
308500 -- (-392.100) (-391.942) (-390.540) [-390.986] * (-394.328) (-393.114) (-390.191) [-391.239] -- 0:00:42
309000 -- [-390.082] (-393.243) (-391.920) (-390.903) * (-391.631) (-394.242) (-390.174) [-391.252] -- 0:00:42
309500 -- (-392.375) (-390.534) [-394.076] (-392.665) * (-393.181) (-390.805) (-391.612) [-392.099] -- 0:00:42
310000 -- (-391.772) (-390.376) [-392.080] (-392.974) * (-391.585) (-390.408) (-392.335) [-392.733] -- 0:00:42
Average standard deviation of split frequencies: 0.011181
310500 -- (-390.026) [-389.828] (-392.661) (-395.595) * [-391.202] (-390.072) (-392.903) (-392.434) -- 0:00:42
311000 -- [-390.311] (-390.045) (-396.040) (-393.501) * (-396.787) [-389.640] (-391.254) (-389.348) -- 0:00:42
311500 -- (-392.103) (-390.612) (-390.155) [-391.555] * (-392.013) [-391.102] (-391.470) (-395.081) -- 0:00:41
312000 -- [-391.241] (-393.150) (-390.296) (-393.192) * (-394.678) (-389.254) (-391.605) [-392.810] -- 0:00:41
312500 -- (-393.430) [-389.903] (-391.047) (-389.390) * [-391.050] (-390.348) (-389.598) (-391.343) -- 0:00:41
313000 -- (-389.722) (-390.538) [-391.197] (-392.470) * [-390.995] (-392.651) (-389.489) (-392.699) -- 0:00:41
313500 -- [-390.128] (-391.928) (-389.232) (-392.515) * [-390.964] (-393.219) (-391.509) (-391.233) -- 0:00:41
314000 -- (-389.997) [-389.736] (-390.772) (-392.785) * (-392.503) [-390.171] (-393.171) (-392.784) -- 0:00:41
314500 -- (-391.293) (-393.251) (-391.006) [-390.977] * [-389.392] (-391.146) (-392.118) (-390.823) -- 0:00:43
315000 -- (-392.854) [-392.966] (-391.926) (-392.385) * (-391.849) (-390.001) [-390.110] (-391.308) -- 0:00:43
Average standard deviation of split frequencies: 0.010360
315500 -- (-392.403) (-390.639) (-389.303) [-391.835] * [-394.043] (-394.068) (-391.964) (-389.174) -- 0:00:43
316000 -- [-392.290] (-389.918) (-391.118) (-391.380) * (-390.776) [-391.613] (-389.828) (-396.383) -- 0:00:43
316500 -- (-392.780) (-392.331) [-392.083] (-392.839) * (-390.463) (-392.603) (-389.851) [-391.630] -- 0:00:43
317000 -- (-392.950) [-390.118] (-395.020) (-396.901) * [-390.680] (-391.233) (-390.613) (-396.086) -- 0:00:43
317500 -- (-397.708) [-391.185] (-392.078) (-392.186) * (-392.120) (-392.519) (-393.489) [-391.184] -- 0:00:42
318000 -- (-389.993) (-392.592) [-389.645] (-389.931) * (-393.550) [-391.708] (-391.671) (-392.955) -- 0:00:42
318500 -- [-390.829] (-390.605) (-394.935) (-390.012) * (-390.399) [-390.987] (-389.208) (-398.790) -- 0:00:42
319000 -- (-393.494) (-390.757) (-391.122) [-392.338] * (-390.977) (-390.928) [-390.863] (-391.162) -- 0:00:42
319500 -- (-394.311) (-389.212) (-391.311) [-391.032] * [-390.152] (-389.562) (-390.183) (-391.188) -- 0:00:42
320000 -- [-390.798] (-391.240) (-390.707) (-391.210) * (-393.475) [-389.203] (-394.775) (-390.889) -- 0:00:42
Average standard deviation of split frequencies: 0.010372
320500 -- [-390.548] (-390.721) (-389.677) (-392.363) * (-391.962) (-391.455) [-391.487] (-390.822) -- 0:00:42
321000 -- (-392.525) [-390.024] (-393.963) (-389.862) * (-391.461) [-394.039] (-392.463) (-390.496) -- 0:00:42
321500 -- [-390.634] (-392.006) (-391.051) (-393.084) * (-389.599) (-392.362) (-392.820) [-389.593] -- 0:00:42
322000 -- (-395.673) (-393.267) (-389.413) [-393.625] * (-393.506) [-390.631] (-395.299) (-393.475) -- 0:00:42
322500 -- (-392.403) (-392.038) [-389.520] (-400.796) * (-391.632) (-389.464) (-392.271) [-389.797] -- 0:00:42
323000 -- [-399.061] (-391.465) (-389.778) (-393.750) * [-392.158] (-389.742) (-394.037) (-390.902) -- 0:00:41
323500 -- (-391.514) (-389.661) (-395.130) [-395.857] * (-392.272) [-389.844] (-394.544) (-390.812) -- 0:00:41
324000 -- (-392.604) (-390.093) (-394.657) [-393.420] * [-392.062] (-390.617) (-392.901) (-390.949) -- 0:00:41
324500 -- [-390.825] (-392.134) (-389.927) (-391.462) * (-392.617) [-391.272] (-390.635) (-392.746) -- 0:00:41
325000 -- (-392.732) [-392.250] (-392.371) (-392.790) * [-390.046] (-390.107) (-394.197) (-391.904) -- 0:00:41
Average standard deviation of split frequencies: 0.011006
325500 -- (-391.228) [-391.324] (-390.918) (-390.324) * (-390.838) [-391.726] (-389.908) (-390.388) -- 0:00:41
326000 -- (-390.248) (-389.380) (-392.245) [-390.907] * (-390.220) (-391.214) [-391.788] (-390.452) -- 0:00:41
326500 -- [-391.785] (-389.640) (-392.305) (-391.727) * (-390.449) (-393.355) [-389.598] (-390.931) -- 0:00:41
327000 -- (-390.482) [-390.807] (-393.777) (-391.804) * (-390.849) (-390.219) (-390.019) [-390.340] -- 0:00:41
327500 -- [-392.261] (-391.417) (-392.242) (-393.628) * (-391.169) (-394.317) (-393.594) [-390.152] -- 0:00:41
328000 -- (-392.957) [-391.059] (-390.626) (-389.192) * (-389.899) (-396.517) (-391.117) [-389.561] -- 0:00:40
328500 -- (-392.911) [-390.184] (-392.094) (-394.542) * (-392.075) (-389.893) (-389.867) [-393.545] -- 0:00:40
329000 -- (-392.552) [-389.240] (-396.640) (-391.207) * (-397.753) (-392.386) [-389.121] (-389.692) -- 0:00:40
329500 -- [-391.142] (-392.219) (-392.036) (-390.041) * [-394.328] (-391.316) (-390.538) (-392.340) -- 0:00:40
330000 -- (-393.159) [-392.978] (-389.162) (-393.625) * (-392.536) (-390.336) [-391.548] (-391.476) -- 0:00:42
Average standard deviation of split frequencies: 0.010505
330500 -- [-391.248] (-393.812) (-393.271) (-393.460) * (-397.002) [-389.436] (-393.437) (-389.500) -- 0:00:42
331000 -- [-391.508] (-394.148) (-393.971) (-392.200) * (-393.245) [-389.885] (-390.424) (-391.512) -- 0:00:42
331500 -- (-390.504) (-392.340) [-392.177] (-390.612) * (-391.023) [-389.426] (-393.768) (-391.529) -- 0:00:42
332000 -- [-392.130] (-391.195) (-391.697) (-393.148) * [-392.115] (-389.899) (-392.493) (-390.103) -- 0:00:42
332500 -- (-390.621) [-389.926] (-389.794) (-390.905) * (-396.372) [-389.353] (-391.146) (-389.475) -- 0:00:42
333000 -- (-391.299) (-393.715) [-393.974] (-390.021) * (-393.297) (-390.652) [-390.589] (-392.663) -- 0:00:42
333500 -- [-389.845] (-389.490) (-393.262) (-389.847) * (-391.349) [-389.376] (-392.488) (-396.808) -- 0:00:41
334000 -- (-390.232) (-389.454) (-392.962) [-389.303] * (-391.323) (-393.312) (-391.486) [-390.133] -- 0:00:41
334500 -- (-390.375) [-391.262] (-391.814) (-393.016) * (-393.830) (-391.930) [-391.444] (-390.642) -- 0:00:41
335000 -- (-392.023) (-391.068) (-390.230) [-390.201] * (-393.662) (-391.343) (-391.237) [-391.323] -- 0:00:41
Average standard deviation of split frequencies: 0.009673
335500 -- (-394.769) (-391.335) [-391.603] (-394.386) * [-389.638] (-392.355) (-391.082) (-391.161) -- 0:00:41
336000 -- (-390.864) [-390.856] (-390.001) (-391.034) * [-392.439] (-394.045) (-390.292) (-390.890) -- 0:00:41
336500 -- (-390.326) (-391.474) [-394.848] (-391.751) * (-391.379) [-393.516] (-392.922) (-392.407) -- 0:00:41
337000 -- [-389.152] (-392.219) (-390.337) (-393.354) * (-393.742) (-391.626) (-390.354) [-390.947] -- 0:00:41
337500 -- [-392.031] (-390.864) (-391.703) (-390.377) * (-394.998) (-394.123) (-389.534) [-389.124] -- 0:00:41
338000 -- (-390.872) (-390.693) (-389.495) [-389.019] * [-390.738] (-399.126) (-390.457) (-389.502) -- 0:00:41
338500 -- [-392.363] (-392.341) (-390.917) (-390.457) * [-393.726] (-390.471) (-390.443) (-391.700) -- 0:00:41
339000 -- (-391.732) (-390.857) (-394.523) [-390.326] * (-392.348) (-393.160) [-391.898] (-390.859) -- 0:00:40
339500 -- [-391.441] (-394.296) (-393.955) (-390.709) * (-390.800) (-391.423) (-391.787) [-390.447] -- 0:00:40
340000 -- (-393.146) [-392.013] (-397.470) (-391.392) * (-389.667) (-390.234) (-391.668) [-389.788] -- 0:00:40
Average standard deviation of split frequencies: 0.010488
340500 -- (-391.265) (-392.868) (-392.356) [-395.243] * [-389.765] (-392.095) (-392.548) (-391.902) -- 0:00:40
341000 -- [-394.952] (-392.772) (-391.368) (-390.340) * (-391.165) (-390.488) [-391.943] (-391.851) -- 0:00:40
341500 -- (-390.642) (-390.223) (-390.677) [-389.809] * (-392.874) (-389.987) (-390.888) [-389.777] -- 0:00:40
342000 -- (-389.933) [-394.650] (-390.874) (-394.187) * (-390.808) (-391.243) (-391.143) [-390.017] -- 0:00:40
342500 -- [-391.349] (-392.399) (-390.392) (-393.454) * (-389.554) (-391.054) (-392.125) [-389.230] -- 0:00:40
343000 -- (-389.648) (-395.369) [-392.012] (-392.636) * (-391.254) (-391.708) [-389.626] (-390.732) -- 0:00:40
343500 -- (-389.598) (-392.310) (-394.435) [-391.943] * [-393.101] (-390.178) (-390.062) (-394.100) -- 0:00:40
344000 -- (-393.817) (-393.235) [-390.824] (-396.590) * (-392.755) (-392.465) [-392.797] (-391.401) -- 0:00:40
344500 -- [-392.733] (-392.526) (-392.120) (-393.410) * (-390.073) (-394.944) [-391.994] (-391.630) -- 0:00:39
345000 -- [-390.950] (-391.197) (-393.051) (-393.012) * [-391.124] (-393.996) (-390.032) (-390.584) -- 0:00:39
Average standard deviation of split frequencies: 0.009896
345500 -- (-395.776) (-391.622) (-392.425) [-389.937] * [-390.938] (-390.903) (-391.637) (-393.450) -- 0:00:41
346000 -- (-390.116) (-392.074) [-392.344] (-390.102) * (-395.446) (-391.040) [-391.969] (-392.200) -- 0:00:41
346500 -- (-391.118) (-390.854) [-390.218] (-391.013) * (-394.897) [-391.312] (-391.010) (-389.837) -- 0:00:41
347000 -- (-392.425) (-394.080) [-389.861] (-390.598) * (-393.779) [-390.380] (-390.635) (-390.746) -- 0:00:41
347500 -- (-393.010) (-396.156) [-392.968] (-394.305) * [-391.531] (-389.959) (-392.644) (-392.389) -- 0:00:41
348000 -- [-392.372] (-392.463) (-390.000) (-393.397) * [-390.293] (-390.194) (-390.957) (-390.085) -- 0:00:41
348500 -- (-394.483) (-393.749) [-398.916] (-395.085) * (-392.670) [-389.911] (-392.899) (-391.517) -- 0:00:41
349000 -- (-392.245) [-392.655] (-390.739) (-391.197) * (-390.585) [-392.183] (-397.366) (-393.472) -- 0:00:41
349500 -- (-391.005) [-392.107] (-391.621) (-390.887) * (-390.939) [-392.584] (-391.439) (-395.478) -- 0:00:40
350000 -- [-390.136] (-391.987) (-390.989) (-391.320) * (-390.922) (-391.334) (-391.326) [-391.140] -- 0:00:40
Average standard deviation of split frequencies: 0.009858
350500 -- [-390.622] (-390.578) (-390.118) (-395.362) * (-390.000) (-390.206) [-391.425] (-389.748) -- 0:00:40
351000 -- (-393.955) [-391.195] (-393.271) (-397.374) * (-389.709) [-390.763] (-395.692) (-390.270) -- 0:00:40
351500 -- (-391.018) [-390.027] (-391.231) (-391.496) * (-391.812) [-389.624] (-397.895) (-392.589) -- 0:00:40
352000 -- (-392.362) (-390.242) [-391.645] (-390.772) * [-391.721] (-393.031) (-395.978) (-391.401) -- 0:00:40
352500 -- (-394.419) (-392.576) [-392.558] (-389.052) * [-390.234] (-391.512) (-392.984) (-393.168) -- 0:00:40
353000 -- (-392.516) (-394.425) (-392.862) [-392.006] * [-392.426] (-393.036) (-389.099) (-391.104) -- 0:00:40
353500 -- [-390.258] (-396.382) (-390.762) (-390.293) * (-391.136) [-390.441] (-391.714) (-390.777) -- 0:00:40
354000 -- (-391.030) (-393.408) (-391.960) [-389.052] * [-392.607] (-390.090) (-394.914) (-391.660) -- 0:00:40
354500 -- (-389.811) (-393.123) (-393.244) [-392.516] * (-390.062) (-390.132) (-394.121) [-390.432] -- 0:00:40
355000 -- (-389.331) [-390.499] (-390.481) (-395.793) * [-395.417] (-389.485) (-394.035) (-393.831) -- 0:00:39
Average standard deviation of split frequencies: 0.008828
355500 -- (-389.510) [-389.893] (-389.853) (-397.004) * (-389.747) (-392.597) (-391.981) [-391.573] -- 0:00:39
356000 -- (-389.982) (-389.493) (-390.505) [-392.812] * [-391.388] (-391.252) (-391.632) (-392.044) -- 0:00:39
356500 -- (-396.305) [-389.641] (-394.357) (-389.765) * (-390.023) (-398.096) [-390.619] (-392.328) -- 0:00:39
357000 -- [-390.182] (-389.936) (-390.730) (-391.371) * [-390.209] (-390.633) (-390.160) (-391.538) -- 0:00:39
357500 -- (-391.604) (-391.522) [-390.219] (-390.902) * (-390.149) (-389.659) [-390.375] (-390.274) -- 0:00:39
358000 -- (-393.637) (-391.377) [-392.793] (-391.604) * (-392.072) (-392.187) [-391.109] (-391.134) -- 0:00:39
358500 -- (-389.994) [-391.577] (-391.507) (-391.415) * (-393.452) (-391.697) [-392.530] (-392.337) -- 0:00:39
359000 -- [-391.568] (-393.001) (-393.298) (-392.441) * [-390.899] (-391.006) (-394.531) (-394.643) -- 0:00:39
359500 -- [-391.559] (-393.234) (-391.897) (-395.854) * (-390.300) [-391.295] (-393.139) (-391.483) -- 0:00:39
360000 -- [-392.658] (-392.066) (-389.118) (-390.774) * (-390.763) [-391.332] (-389.278) (-393.355) -- 0:00:39
Average standard deviation of split frequencies: 0.008786
360500 -- (-390.129) [-392.636] (-389.895) (-392.049) * [-389.610] (-391.550) (-389.923) (-392.156) -- 0:00:39
361000 -- (-389.608) [-392.392] (-392.752) (-397.297) * (-389.723) (-389.728) (-390.091) [-392.423] -- 0:00:40
361500 -- (-391.549) (-393.444) [-391.674] (-392.943) * [-389.564] (-390.749) (-392.838) (-394.647) -- 0:00:40
362000 -- [-390.436] (-391.310) (-390.861) (-393.047) * [-392.060] (-394.363) (-390.624) (-390.759) -- 0:00:40
362500 -- (-390.469) [-391.281] (-391.310) (-391.740) * (-394.519) [-392.161] (-392.271) (-390.281) -- 0:00:40
363000 -- [-392.998] (-394.333) (-392.443) (-391.445) * (-390.893) [-394.123] (-391.175) (-389.536) -- 0:00:40
363500 -- (-393.314) (-391.826) (-396.576) [-389.816] * (-392.724) (-392.455) [-390.857] (-393.351) -- 0:00:40
364000 -- (-392.109) (-390.674) [-392.574] (-391.564) * (-390.951) [-391.579] (-389.668) (-391.479) -- 0:00:40
364500 -- [-391.007] (-390.448) (-390.300) (-390.623) * (-391.739) (-390.676) [-392.320] (-389.931) -- 0:00:40
365000 -- (-391.215) (-390.268) [-390.837] (-393.273) * [-390.405] (-391.703) (-392.362) (-392.513) -- 0:00:40
Average standard deviation of split frequencies: 0.009789
365500 -- [-390.628] (-389.026) (-392.483) (-394.080) * (-392.366) (-392.264) (-391.880) [-389.899] -- 0:00:39
366000 -- (-392.987) (-392.027) (-391.641) [-391.557] * (-391.956) (-390.079) (-390.238) [-393.113] -- 0:00:39
366500 -- [-389.943] (-390.846) (-392.939) (-395.151) * (-391.132) (-391.240) [-396.717] (-392.253) -- 0:00:39
367000 -- [-389.956] (-392.107) (-388.972) (-389.510) * [-395.100] (-390.141) (-391.757) (-393.693) -- 0:00:39
367500 -- (-390.397) [-390.324] (-389.837) (-392.317) * (-395.278) (-390.090) (-391.562) [-390.859] -- 0:00:39
368000 -- (-392.360) [-391.222] (-390.742) (-391.533) * (-394.924) [-390.914] (-393.302) (-392.354) -- 0:00:39
368500 -- (-392.528) (-390.222) [-391.794] (-392.157) * (-390.181) (-393.219) (-390.501) [-392.706] -- 0:00:39
369000 -- (-397.485) (-390.163) [-390.986] (-390.454) * (-391.367) (-394.045) [-391.715] (-390.847) -- 0:00:39
369500 -- (-394.904) (-390.454) [-392.082] (-393.293) * [-391.966] (-390.590) (-390.665) (-393.785) -- 0:00:39
370000 -- (-394.316) (-392.040) (-393.359) [-390.797] * [-390.916] (-392.037) (-390.775) (-395.320) -- 0:00:39
Average standard deviation of split frequencies: 0.009639
370500 -- (-392.906) (-391.235) (-392.442) [-391.086] * (-389.938) (-394.285) [-389.452] (-391.229) -- 0:00:39
371000 -- [-390.481] (-391.776) (-390.197) (-391.146) * [-390.324] (-390.908) (-392.437) (-391.490) -- 0:00:38
371500 -- [-390.452] (-394.243) (-395.663) (-390.880) * (-392.651) (-392.878) (-392.856) [-390.648] -- 0:00:38
372000 -- (-390.325) [-390.425] (-391.276) (-390.324) * [-392.259] (-391.299) (-394.976) (-390.563) -- 0:00:38
372500 -- (-390.863) (-389.803) (-390.535) [-391.451] * (-390.635) [-391.019] (-391.137) (-401.532) -- 0:00:38
373000 -- (-389.768) [-390.744] (-395.236) (-389.785) * (-390.130) (-392.470) [-392.529] (-390.949) -- 0:00:38
373500 -- (-392.173) (-390.479) (-390.538) [-392.320] * (-391.457) [-391.792] (-394.123) (-391.335) -- 0:00:38
374000 -- (-391.311) [-391.392] (-389.292) (-393.091) * (-390.967) (-390.193) [-390.989] (-391.460) -- 0:00:38
374500 -- (-391.478) [-390.069] (-392.664) (-389.944) * (-391.625) (-391.991) (-393.694) [-393.333] -- 0:00:38
375000 -- (-393.019) (-392.775) [-390.506] (-391.462) * (-392.065) [-392.106] (-392.817) (-390.433) -- 0:00:38
Average standard deviation of split frequencies: 0.009634
375500 -- [-394.060] (-398.560) (-390.172) (-392.917) * [-390.626] (-391.518) (-395.075) (-389.696) -- 0:00:38
376000 -- (-393.109) (-393.871) [-390.270] (-392.426) * (-390.179) (-394.271) [-394.428] (-390.868) -- 0:00:38
376500 -- (-392.901) (-390.806) (-389.098) [-390.312] * [-391.257] (-389.736) (-397.833) (-392.496) -- 0:00:38
377000 -- (-396.745) (-396.685) (-390.675) [-391.402] * (-395.407) [-392.455] (-398.800) (-392.885) -- 0:00:38
377500 -- (-392.331) (-393.581) [-391.264] (-392.606) * (-390.785) (-390.556) (-394.409) [-389.623] -- 0:00:37
378000 -- (-390.955) [-394.468] (-390.754) (-389.540) * (-391.107) [-391.805] (-390.252) (-391.770) -- 0:00:39
378500 -- (-391.698) (-391.113) [-389.732] (-390.627) * [-392.277] (-390.390) (-392.679) (-392.007) -- 0:00:39
379000 -- (-390.004) (-391.946) (-392.203) [-391.896] * [-390.117] (-392.770) (-395.024) (-390.807) -- 0:00:39
379500 -- [-389.765] (-390.647) (-391.348) (-391.208) * (-395.952) (-391.108) [-391.292] (-390.870) -- 0:00:39
380000 -- (-389.125) (-390.508) [-391.517] (-394.010) * [-392.553] (-389.984) (-392.129) (-390.629) -- 0:00:39
Average standard deviation of split frequencies: 0.009972
380500 -- (-390.643) (-393.636) [-394.232] (-394.910) * (-389.188) [-391.013] (-390.791) (-390.629) -- 0:00:39
381000 -- (-389.245) (-391.987) [-393.244] (-393.893) * [-389.983] (-389.417) (-389.040) (-390.155) -- 0:00:38
381500 -- (-395.849) (-390.553) (-390.357) [-394.073] * (-390.588) [-390.998] (-389.040) (-390.427) -- 0:00:38
382000 -- (-392.396) (-390.689) (-389.403) [-397.940] * (-392.367) (-396.753) [-393.091] (-391.570) -- 0:00:38
382500 -- (-392.121) (-390.234) (-389.436) [-390.473] * [-391.571] (-398.479) (-392.041) (-393.447) -- 0:00:38
383000 -- (-392.874) (-390.254) (-392.130) [-389.563] * (-392.384) [-398.197] (-390.380) (-393.114) -- 0:00:38
383500 -- (-392.378) (-390.245) (-389.788) [-390.309] * (-389.794) (-396.603) (-393.591) [-391.246] -- 0:00:38
384000 -- (-396.784) [-391.887] (-391.895) (-394.890) * (-389.491) [-390.995] (-394.031) (-396.634) -- 0:00:38
384500 -- [-389.481] (-390.171) (-390.136) (-393.333) * (-389.876) (-391.206) (-395.047) [-394.119] -- 0:00:38
385000 -- [-396.321] (-389.602) (-391.606) (-394.802) * (-392.052) (-393.664) (-392.481) [-390.564] -- 0:00:38
Average standard deviation of split frequencies: 0.010284
385500 -- (-399.169) (-393.217) [-391.397] (-390.161) * (-389.728) [-391.127] (-390.168) (-391.756) -- 0:00:38
386000 -- (-395.410) (-390.692) (-392.657) [-391.352] * (-389.900) (-391.844) [-391.290] (-394.349) -- 0:00:38
386500 -- (-393.079) (-392.102) (-392.779) [-395.945] * [-390.545] (-392.126) (-390.640) (-394.485) -- 0:00:38
387000 -- [-391.904] (-390.380) (-391.511) (-392.619) * [-392.193] (-394.437) (-391.284) (-391.013) -- 0:00:38
387500 -- (-391.912) [-389.415] (-392.486) (-391.732) * (-390.198) (-394.406) [-392.727] (-390.394) -- 0:00:37
388000 -- (-393.390) [-389.892] (-392.768) (-392.025) * (-392.448) [-390.746] (-391.107) (-396.238) -- 0:00:37
388500 -- (-392.117) [-390.416] (-390.123) (-395.216) * (-390.765) (-393.352) (-390.819) [-393.185] -- 0:00:37
389000 -- (-390.622) [-390.564] (-391.032) (-392.984) * (-392.143) (-391.749) [-391.490] (-390.576) -- 0:00:37
389500 -- [-391.812] (-390.690) (-393.984) (-397.256) * [-391.626] (-390.600) (-392.839) (-391.834) -- 0:00:37
390000 -- (-393.330) [-390.089] (-394.015) (-394.019) * [-389.447] (-392.025) (-392.500) (-392.022) -- 0:00:37
Average standard deviation of split frequencies: 0.009586
390500 -- [-390.444] (-390.579) (-393.817) (-390.908) * (-390.535) (-397.471) (-394.770) [-390.272] -- 0:00:37
391000 -- (-391.128) (-391.366) (-390.358) [-392.364] * [-392.851] (-389.886) (-392.639) (-390.497) -- 0:00:37
391500 -- (-392.630) [-391.410] (-391.242) (-395.815) * [-389.693] (-391.602) (-390.093) (-390.982) -- 0:00:37
392000 -- [-390.105] (-391.029) (-391.459) (-394.943) * [-394.404] (-394.621) (-390.467) (-390.252) -- 0:00:37
392500 -- (-390.726) [-392.783] (-390.047) (-397.836) * (-391.242) (-390.383) [-392.601] (-392.171) -- 0:00:37
393000 -- (-390.656) (-395.534) (-390.913) [-397.999] * [-393.557] (-391.070) (-390.343) (-390.044) -- 0:00:37
393500 -- (-391.207) [-390.168] (-395.294) (-391.479) * (-391.333) [-390.195] (-389.793) (-391.858) -- 0:00:36
394000 -- [-391.958] (-389.294) (-393.651) (-393.315) * (-390.137) (-389.858) [-391.115] (-394.375) -- 0:00:36
394500 -- (-392.908) (-390.910) [-392.486] (-393.681) * (-390.715) (-389.352) (-392.491) [-397.998] -- 0:00:36
395000 -- (-392.454) [-390.055] (-389.449) (-393.224) * (-392.645) (-389.247) (-392.496) [-394.635] -- 0:00:36
Average standard deviation of split frequencies: 0.010383
395500 -- (-394.418) (-390.790) [-391.467] (-390.982) * (-391.494) [-390.374] (-389.749) (-390.212) -- 0:00:38
396000 -- [-395.495] (-391.071) (-392.691) (-391.098) * (-392.592) (-389.687) [-390.193] (-389.624) -- 0:00:38
396500 -- (-392.063) [-391.748] (-396.093) (-389.896) * [-392.215] (-392.213) (-391.378) (-391.604) -- 0:00:38
397000 -- [-391.164] (-393.343) (-391.499) (-391.648) * (-392.604) (-390.103) (-392.258) [-390.844] -- 0:00:37
397500 -- (-390.848) (-393.393) [-396.006] (-390.108) * [-391.876] (-391.495) (-389.930) (-389.246) -- 0:00:37
398000 -- (-390.759) (-391.998) (-391.037) [-390.862] * (-392.176) [-391.927] (-393.536) (-391.067) -- 0:00:37
398500 -- [-392.434] (-391.071) (-391.155) (-393.420) * (-393.775) (-391.373) (-389.088) [-393.404] -- 0:00:37
399000 -- (-392.142) (-389.038) (-393.066) [-389.841] * (-394.959) (-393.079) [-393.548] (-390.058) -- 0:00:37
399500 -- (-392.489) (-390.666) [-393.162] (-389.483) * (-390.158) (-391.357) [-389.257] (-391.736) -- 0:00:37
400000 -- (-394.726) (-390.018) [-389.164] (-395.068) * (-390.815) (-391.386) [-390.665] (-391.032) -- 0:00:37
Average standard deviation of split frequencies: 0.010393
400500 -- (-390.881) (-391.063) [-391.492] (-391.222) * [-391.021] (-392.102) (-390.514) (-395.040) -- 0:00:37
401000 -- (-389.413) (-390.584) [-392.012] (-393.533) * (-394.307) (-392.081) (-390.543) [-392.669] -- 0:00:37
401500 -- [-394.190] (-396.461) (-395.364) (-390.218) * [-391.583] (-391.229) (-391.121) (-391.496) -- 0:00:37
402000 -- (-389.692) (-391.624) [-395.825] (-395.127) * (-391.171) [-391.513] (-389.266) (-390.740) -- 0:00:37
402500 -- (-393.669) (-390.578) [-395.583] (-394.715) * [-390.863] (-390.943) (-390.342) (-391.084) -- 0:00:37
403000 -- [-392.509] (-390.183) (-393.204) (-394.840) * (-394.266) (-393.263) [-392.608] (-392.383) -- 0:00:37
403500 -- [-391.107] (-389.053) (-391.587) (-390.437) * [-390.117] (-391.319) (-390.606) (-389.431) -- 0:00:36
404000 -- (-392.484) (-390.904) [-391.224] (-391.339) * (-390.617) (-390.195) (-392.259) [-391.958] -- 0:00:36
404500 -- (-390.484) (-390.198) (-395.042) [-392.029] * (-389.323) [-391.503] (-391.969) (-393.880) -- 0:00:36
405000 -- (-390.902) (-392.941) (-389.716) [-392.240] * (-395.351) (-390.307) (-393.986) [-391.084] -- 0:00:36
Average standard deviation of split frequencies: 0.010256
405500 -- [-389.789] (-392.954) (-393.283) (-397.318) * (-392.260) (-393.232) (-393.796) [-395.044] -- 0:00:36
406000 -- [-390.051] (-390.931) (-391.773) (-390.296) * [-392.637] (-390.496) (-390.881) (-390.020) -- 0:00:36
406500 -- (-389.636) [-390.287] (-392.590) (-391.887) * (-390.718) (-395.833) (-390.604) [-392.602] -- 0:00:36
407000 -- (-391.322) [-389.264] (-390.750) (-393.456) * (-392.368) (-391.468) (-393.220) [-391.525] -- 0:00:36
407500 -- (-390.623) (-390.179) [-389.496] (-390.988) * (-393.042) (-394.688) [-391.789] (-391.216) -- 0:00:36
408000 -- (-390.965) [-393.509] (-390.633) (-389.649) * (-392.821) [-390.251] (-391.460) (-392.042) -- 0:00:36
408500 -- [-390.317] (-392.216) (-392.410) (-390.351) * (-391.131) (-393.502) (-389.488) [-390.957] -- 0:00:36
409000 -- (-394.303) (-390.734) (-389.661) [-392.939] * (-391.375) (-390.219) [-393.944] (-391.564) -- 0:00:36
409500 -- [-391.912] (-394.124) (-392.961) (-389.848) * [-389.272] (-390.514) (-394.510) (-392.086) -- 0:00:36
410000 -- (-391.574) (-391.080) [-394.236] (-389.946) * (-389.466) (-391.943) [-391.761] (-390.874) -- 0:00:35
Average standard deviation of split frequencies: 0.010331
410500 -- (-398.120) [-398.958] (-394.399) (-390.488) * [-390.374] (-390.531) (-391.945) (-391.503) -- 0:00:35
411000 -- (-396.123) (-392.125) (-393.706) [-391.188] * [-393.139] (-391.093) (-391.558) (-391.455) -- 0:00:35
411500 -- (-393.331) [-389.277] (-392.055) (-390.483) * (-392.774) (-390.674) [-391.100] (-389.869) -- 0:00:37
412000 -- (-392.262) (-392.291) [-390.741] (-391.154) * (-394.834) (-393.403) [-390.770] (-393.044) -- 0:00:37
412500 -- (-391.519) (-390.989) (-395.176) [-391.194] * (-392.815) [-393.663] (-390.506) (-390.986) -- 0:00:37
413000 -- (-391.719) [-390.200] (-390.324) (-391.713) * (-391.995) (-390.785) [-392.050] (-390.464) -- 0:00:36
413500 -- (-390.733) [-390.872] (-390.616) (-392.818) * (-391.407) (-390.088) (-390.183) [-389.999] -- 0:00:36
414000 -- (-393.559) [-392.136] (-393.324) (-393.009) * (-393.745) (-389.772) [-391.743] (-389.647) -- 0:00:36
414500 -- (-393.100) (-390.728) (-393.949) [-394.114] * (-393.339) (-392.332) (-391.049) [-390.989] -- 0:00:36
415000 -- (-393.807) (-390.402) (-390.741) [-390.356] * (-389.622) (-390.496) [-390.968] (-392.679) -- 0:00:36
Average standard deviation of split frequencies: 0.010325
415500 -- [-391.707] (-392.555) (-390.817) (-392.234) * (-394.529) [-390.333] (-391.466) (-392.896) -- 0:00:36
416000 -- (-390.412) (-390.038) (-390.156) [-394.542] * (-396.573) (-390.834) (-391.582) [-391.088] -- 0:00:36
416500 -- (-389.399) [-390.312] (-389.550) (-393.644) * (-394.832) (-390.190) (-391.856) [-391.594] -- 0:00:36
417000 -- (-392.006) [-392.108] (-394.482) (-392.140) * (-390.871) (-390.153) [-390.834] (-392.642) -- 0:00:36
417500 -- [-391.338] (-391.905) (-398.089) (-391.663) * (-390.009) (-393.483) (-389.558) [-390.915] -- 0:00:36
418000 -- (-391.269) [-394.070] (-395.308) (-392.017) * (-395.449) [-389.924] (-391.712) (-391.490) -- 0:00:36
418500 -- (-389.922) (-391.651) [-392.525] (-391.105) * [-392.673] (-390.745) (-390.697) (-390.270) -- 0:00:36
419000 -- (-390.761) (-392.919) (-392.055) [-392.031] * (-391.424) (-391.039) [-390.653] (-390.458) -- 0:00:36
419500 -- (-394.773) [-391.966] (-395.928) (-392.071) * (-392.000) (-390.216) (-390.931) [-391.444] -- 0:00:35
420000 -- (-392.134) (-392.125) [-395.843] (-395.714) * (-395.621) (-389.529) (-392.302) [-389.902] -- 0:00:35
Average standard deviation of split frequencies: 0.010397
420500 -- (-392.701) (-394.714) (-398.605) [-390.724] * [-392.520] (-389.988) (-390.200) (-390.679) -- 0:00:35
421000 -- (-393.414) (-392.331) (-391.397) [-391.368] * (-394.914) (-389.032) [-389.895] (-390.072) -- 0:00:35
421500 -- (-391.705) (-391.125) (-391.151) [-391.460] * (-390.268) [-390.358] (-389.897) (-390.698) -- 0:00:35
422000 -- (-394.794) (-391.391) [-391.551] (-391.465) * (-392.114) (-391.678) [-390.917] (-389.419) -- 0:00:35
422500 -- (-393.013) [-390.740] (-390.460) (-392.862) * [-390.833] (-390.019) (-395.257) (-392.935) -- 0:00:35
423000 -- (-389.402) (-391.936) [-389.268] (-395.962) * (-394.450) (-391.974) (-389.963) [-392.076] -- 0:00:35
423500 -- (-391.685) (-392.314) (-389.710) [-393.617] * [-392.754] (-391.445) (-392.028) (-390.663) -- 0:00:35
424000 -- (-392.525) (-393.086) [-390.172] (-392.337) * (-392.255) (-392.406) (-392.384) [-389.625] -- 0:00:35
424500 -- (-391.881) (-390.524) [-389.656] (-391.538) * (-391.386) (-393.391) [-393.132] (-397.257) -- 0:00:35
425000 -- (-391.943) [-390.270] (-392.950) (-391.198) * (-390.256) [-391.249] (-391.612) (-391.799) -- 0:00:35
Average standard deviation of split frequencies: 0.010250
425500 -- [-392.159] (-390.466) (-392.880) (-391.438) * [-389.275] (-394.641) (-390.700) (-390.860) -- 0:00:35
426000 -- (-392.329) [-392.207] (-399.709) (-390.343) * (-393.226) (-389.571) [-391.293] (-390.258) -- 0:00:35
426500 -- (-399.729) [-391.597] (-395.715) (-392.072) * (-391.594) (-389.697) (-389.836) [-395.714] -- 0:00:34
427000 -- [-392.693] (-401.784) (-391.084) (-390.420) * (-393.883) (-389.418) [-390.387] (-399.869) -- 0:00:34
427500 -- (-391.364) [-389.628] (-390.208) (-396.867) * (-393.437) [-390.284] (-390.929) (-395.115) -- 0:00:34
428000 -- [-391.462] (-391.072) (-389.083) (-391.708) * [-391.445] (-392.992) (-390.225) (-395.176) -- 0:00:34
428500 -- (-391.352) [-390.069] (-390.895) (-390.616) * (-392.319) (-388.944) [-391.820] (-392.037) -- 0:00:34
429000 -- (-393.934) (-390.381) [-390.876] (-392.687) * (-394.548) (-394.591) [-390.764] (-389.425) -- 0:00:35
429500 -- (-391.362) [-390.774] (-394.179) (-392.972) * (-390.386) [-391.309] (-391.589) (-390.463) -- 0:00:35
430000 -- (-391.910) [-389.169] (-391.866) (-391.222) * (-396.190) (-389.402) (-389.838) [-390.607] -- 0:00:35
Average standard deviation of split frequencies: 0.010459
430500 -- (-390.830) (-392.691) (-391.799) [-394.081] * (-392.420) [-391.536] (-390.735) (-389.611) -- 0:00:35
431000 -- (-391.650) (-393.524) [-393.068] (-391.478) * (-391.581) (-390.335) (-390.640) [-389.192] -- 0:00:35
431500 -- (-389.746) (-391.897) [-393.335] (-393.128) * (-390.079) [-389.499] (-390.982) (-389.806) -- 0:00:35
432000 -- (-391.617) [-391.320] (-392.065) (-393.541) * [-390.329] (-392.026) (-394.784) (-394.231) -- 0:00:35
432500 -- [-393.822] (-392.338) (-396.296) (-394.989) * [-394.453] (-391.937) (-397.685) (-392.721) -- 0:00:35
433000 -- (-390.556) (-392.063) (-391.284) [-392.082] * (-394.395) [-389.905] (-394.849) (-390.125) -- 0:00:35
433500 -- [-389.938] (-391.327) (-391.229) (-391.077) * (-392.403) [-390.625] (-395.985) (-391.747) -- 0:00:35
434000 -- (-391.428) [-390.475] (-391.491) (-390.630) * (-390.952) (-389.781) (-392.437) [-389.936] -- 0:00:35
434500 -- (-390.927) (-392.597) [-394.758] (-390.601) * [-393.465] (-391.907) (-391.180) (-394.588) -- 0:00:35
435000 -- (-391.567) (-392.015) [-390.480] (-393.471) * [-390.620] (-390.702) (-392.674) (-395.295) -- 0:00:35
Average standard deviation of split frequencies: 0.010692
435500 -- (-391.563) [-389.942] (-390.413) (-389.679) * (-389.860) (-389.165) [-389.854] (-392.179) -- 0:00:34
436000 -- (-389.169) [-394.076] (-389.507) (-390.719) * (-390.572) (-389.799) [-389.818] (-389.970) -- 0:00:34
436500 -- [-390.580] (-391.183) (-389.069) (-405.241) * [-391.859] (-390.122) (-389.408) (-389.920) -- 0:00:34
437000 -- [-391.829] (-391.547) (-389.761) (-392.200) * (-392.909) (-390.856) [-390.391] (-392.483) -- 0:00:34
437500 -- (-391.614) (-393.349) [-389.134] (-392.678) * (-389.707) [-390.417] (-389.354) (-395.006) -- 0:00:34
438000 -- (-392.709) (-392.392) [-389.476] (-392.121) * (-391.990) [-389.265] (-391.891) (-391.341) -- 0:00:34
438500 -- (-392.810) (-389.822) (-391.727) [-389.451] * (-395.958) (-390.652) [-390.948] (-390.730) -- 0:00:34
439000 -- [-393.845] (-391.604) (-390.471) (-391.775) * (-399.365) [-390.485] (-391.244) (-392.248) -- 0:00:34
439500 -- (-391.486) (-390.596) [-392.182] (-395.058) * (-399.620) (-389.996) [-392.257] (-392.677) -- 0:00:34
440000 -- (-390.673) (-390.021) [-389.472] (-394.283) * (-393.369) (-395.240) (-389.354) [-390.740] -- 0:00:34
Average standard deviation of split frequencies: 0.010096
440500 -- (-392.546) (-390.702) [-389.716] (-392.222) * (-390.287) (-393.995) [-391.951] (-396.808) -- 0:00:34
441000 -- (-389.794) (-393.726) [-389.514] (-389.089) * (-391.769) (-391.108) [-390.684] (-391.213) -- 0:00:34
441500 -- (-394.470) (-391.853) (-389.345) [-391.026] * [-392.938] (-393.324) (-390.260) (-399.220) -- 0:00:34
442000 -- (-389.461) (-394.358) [-389.432] (-392.179) * (-394.963) [-390.189] (-393.000) (-392.577) -- 0:00:34
442500 -- (-391.737) (-390.164) (-389.414) [-390.290] * (-389.850) (-392.111) (-389.842) [-391.155] -- 0:00:34
443000 -- (-389.963) (-390.086) (-395.003) [-392.148] * (-390.113) (-389.651) (-391.714) [-391.973] -- 0:00:33
443500 -- (-389.617) [-389.460] (-389.847) (-392.286) * (-390.551) (-392.953) [-392.402] (-391.064) -- 0:00:33
444000 -- (-389.539) (-389.327) (-390.624) [-390.278] * (-390.519) (-390.678) [-390.978] (-389.726) -- 0:00:33
444500 -- [-392.507] (-390.762) (-391.599) (-389.910) * (-389.863) (-389.066) (-392.959) [-392.557] -- 0:00:33
445000 -- [-389.930] (-390.063) (-391.942) (-391.519) * (-389.756) [-389.958] (-394.990) (-389.858) -- 0:00:33
Average standard deviation of split frequencies: 0.010966
445500 -- (-390.486) (-394.501) [-392.054] (-391.837) * (-390.424) (-391.035) (-391.506) [-390.246] -- 0:00:34
446000 -- (-394.672) [-391.433] (-389.961) (-392.277) * (-394.819) [-390.555] (-391.910) (-389.399) -- 0:00:34
446500 -- (-391.672) [-391.113] (-390.416) (-391.476) * (-391.672) (-393.031) (-392.341) [-390.352] -- 0:00:34
447000 -- [-392.980] (-392.604) (-390.531) (-390.540) * (-392.411) [-389.875] (-394.405) (-390.771) -- 0:00:34
447500 -- (-392.790) (-391.487) (-389.807) [-393.034] * [-391.842] (-392.615) (-393.146) (-392.009) -- 0:00:34
448000 -- (-391.579) (-390.440) (-390.277) [-394.513] * [-390.607] (-390.120) (-390.528) (-393.444) -- 0:00:34
448500 -- (-392.614) (-390.391) [-389.970] (-391.769) * (-392.690) (-390.826) (-390.465) [-393.163] -- 0:00:34
449000 -- (-390.327) (-393.212) (-393.818) [-391.325] * (-391.361) (-390.643) (-391.487) [-390.998] -- 0:00:34
449500 -- (-390.853) [-390.570] (-391.541) (-391.018) * (-391.250) (-390.391) [-390.330] (-389.992) -- 0:00:34
450000 -- (-393.679) (-389.402) (-390.387) [-390.323] * (-390.428) [-389.359] (-389.442) (-390.977) -- 0:00:34
Average standard deviation of split frequencies: 0.010983
450500 -- [-395.397] (-391.356) (-390.769) (-391.352) * (-390.869) (-389.709) [-389.826] (-392.579) -- 0:00:34
451000 -- (-393.266) (-390.796) (-389.513) [-393.476] * [-390.365] (-392.589) (-389.203) (-394.786) -- 0:00:34
451500 -- (-390.322) (-391.502) [-393.270] (-396.089) * (-392.911) (-391.118) (-389.413) [-389.626] -- 0:00:34
452000 -- (-396.053) (-394.282) [-392.901] (-394.066) * (-390.208) (-390.800) (-390.262) [-389.891] -- 0:00:33
452500 -- [-390.423] (-390.384) (-394.633) (-392.498) * [-396.067] (-390.658) (-391.109) (-390.357) -- 0:00:33
453000 -- [-393.825] (-391.679) (-390.053) (-390.693) * (-390.656) (-393.288) (-390.938) [-390.516] -- 0:00:33
453500 -- (-391.914) [-391.135] (-393.086) (-392.313) * [-392.146] (-391.203) (-392.116) (-391.550) -- 0:00:33
454000 -- (-399.594) (-391.935) (-391.832) [-392.753] * (-395.651) [-393.068] (-389.845) (-394.336) -- 0:00:33
454500 -- (-392.390) [-394.853] (-389.617) (-392.129) * (-390.465) (-392.949) [-390.438] (-391.394) -- 0:00:33
455000 -- (-391.644) [-391.602] (-389.629) (-389.746) * (-391.270) (-392.219) [-390.178] (-391.595) -- 0:00:33
Average standard deviation of split frequencies: 0.010855
455500 -- (-389.454) (-393.080) (-390.625) [-390.649] * [-390.447] (-392.824) (-389.281) (-391.622) -- 0:00:33
456000 -- [-391.855] (-390.095) (-394.163) (-390.804) * [-390.004] (-389.083) (-389.017) (-394.238) -- 0:00:33
456500 -- (-391.658) [-392.229] (-394.904) (-390.609) * (-391.197) [-391.481] (-390.160) (-393.526) -- 0:00:33
457000 -- [-390.435] (-393.940) (-394.076) (-390.187) * (-390.297) [-389.529] (-390.622) (-390.477) -- 0:00:33
457500 -- [-391.635] (-392.727) (-389.197) (-390.184) * (-389.516) (-393.977) (-393.783) [-389.389] -- 0:00:33
458000 -- (-390.173) (-390.983) [-390.601] (-391.139) * (-393.996) (-390.336) (-394.952) [-391.421] -- 0:00:33
458500 -- (-392.290) (-395.888) (-397.330) [-390.283] * (-393.093) (-392.020) [-397.283] (-391.443) -- 0:00:33
459000 -- (-391.755) [-390.495] (-393.710) (-390.749) * (-391.921) [-389.563] (-390.425) (-390.522) -- 0:00:33
459500 -- (-394.936) (-389.875) [-395.699] (-390.892) * [-391.836] (-390.721) (-393.093) (-391.009) -- 0:00:32
460000 -- [-393.959] (-390.939) (-389.791) (-391.829) * (-391.472) (-390.146) (-392.683) [-391.090] -- 0:00:32
Average standard deviation of split frequencies: 0.009274
460500 -- (-393.289) (-391.468) [-391.001] (-393.414) * (-392.400) (-392.972) [-394.358] (-392.272) -- 0:00:32
461000 -- (-391.173) (-391.876) [-391.901] (-395.646) * [-395.323] (-393.751) (-392.466) (-391.906) -- 0:00:32
461500 -- (-395.217) [-392.792] (-390.638) (-390.776) * (-395.462) [-389.379] (-390.611) (-392.950) -- 0:00:32
462000 -- (-390.623) (-396.195) [-390.285] (-393.937) * [-393.772] (-392.522) (-391.698) (-394.765) -- 0:00:32
462500 -- [-393.095] (-389.058) (-389.289) (-393.492) * [-390.299] (-389.796) (-389.979) (-391.085) -- 0:00:33
463000 -- [-392.408] (-391.167) (-390.734) (-393.218) * (-390.796) (-389.825) [-390.212] (-391.295) -- 0:00:33
463500 -- (-393.604) (-391.533) [-393.138] (-392.115) * (-391.387) [-391.562] (-393.937) (-393.380) -- 0:00:33
464000 -- (-390.251) (-390.506) [-392.012] (-395.564) * (-390.716) (-391.953) [-391.013] (-390.959) -- 0:00:33
464500 -- (-400.831) [-393.722] (-391.235) (-392.676) * [-389.691] (-390.026) (-392.444) (-390.445) -- 0:00:33
465000 -- (-394.412) (-394.053) (-391.861) [-390.250] * (-391.717) [-391.887] (-389.911) (-390.706) -- 0:00:33
Average standard deviation of split frequencies: 0.009818
465500 -- (-397.129) (-391.599) (-391.169) [-389.943] * (-392.161) (-391.349) (-390.832) [-391.267] -- 0:00:33
466000 -- [-392.224] (-390.909) (-389.451) (-390.338) * [-391.376] (-395.868) (-390.745) (-390.900) -- 0:00:33
466500 -- [-391.197] (-391.184) (-389.693) (-394.813) * [-389.448] (-398.974) (-393.661) (-391.564) -- 0:00:33
467000 -- (-392.288) (-390.629) [-391.164] (-390.780) * (-390.260) (-393.562) [-391.300] (-390.959) -- 0:00:33
467500 -- (-393.798) [-390.836] (-390.381) (-393.429) * (-393.954) (-389.728) [-389.612] (-389.874) -- 0:00:33
468000 -- (-390.149) [-391.606] (-393.416) (-392.560) * (-390.842) (-389.918) (-390.314) [-390.198] -- 0:00:32
468500 -- (-389.085) [-391.349] (-393.802) (-390.085) * [-393.029] (-392.841) (-390.976) (-390.074) -- 0:00:32
469000 -- (-389.927) (-390.873) (-389.338) [-392.391] * (-392.313) [-389.511] (-391.111) (-394.915) -- 0:00:32
469500 -- (-391.521) (-389.842) [-392.589] (-391.413) * (-392.224) (-393.604) (-390.848) [-391.031] -- 0:00:32
470000 -- (-392.464) (-390.631) [-393.467] (-390.327) * (-391.778) (-391.213) (-389.696) [-391.915] -- 0:00:32
Average standard deviation of split frequencies: 0.009485
470500 -- (-391.323) [-391.488] (-392.171) (-391.813) * (-389.450) (-393.983) (-390.740) [-389.692] -- 0:00:32
471000 -- (-396.841) [-394.927] (-390.720) (-392.200) * (-390.047) (-391.150) [-391.007] (-389.695) -- 0:00:32
471500 -- (-395.344) (-392.750) (-393.136) [-392.661] * [-389.219] (-392.070) (-390.213) (-391.955) -- 0:00:32
472000 -- [-393.938] (-392.219) (-390.095) (-391.233) * [-389.552] (-392.774) (-391.486) (-390.826) -- 0:00:32
472500 -- (-396.979) [-395.084] (-393.721) (-392.458) * (-390.938) [-392.184] (-392.034) (-390.866) -- 0:00:32
473000 -- (-393.006) (-389.699) [-390.547] (-390.111) * (-391.027) (-393.912) [-390.056] (-392.186) -- 0:00:32
473500 -- [-390.855] (-393.748) (-390.526) (-390.470) * (-389.792) [-395.185] (-390.555) (-393.770) -- 0:00:32
474000 -- (-389.631) [-390.491] (-395.453) (-390.689) * (-389.266) (-394.155) (-392.199) [-391.359] -- 0:00:32
474500 -- (-392.405) [-392.535] (-393.935) (-392.790) * (-393.765) (-390.303) [-389.969] (-391.630) -- 0:00:32
475000 -- [-395.546] (-391.311) (-393.532) (-393.176) * (-392.959) (-391.093) (-394.055) [-389.470] -- 0:00:32
Average standard deviation of split frequencies: 0.009670
475500 -- (-393.596) (-390.569) [-391.876] (-391.144) * (-389.704) (-389.689) [-392.025] (-389.965) -- 0:00:31
476000 -- (-391.692) [-391.860] (-393.252) (-390.784) * [-391.052] (-390.106) (-393.883) (-391.247) -- 0:00:31
476500 -- [-390.909] (-391.549) (-389.958) (-390.436) * [-392.468] (-391.212) (-392.232) (-391.655) -- 0:00:31
477000 -- [-391.551] (-389.844) (-391.274) (-390.728) * (-392.352) (-391.747) [-391.115] (-390.974) -- 0:00:31
477500 -- (-390.201) [-390.651] (-390.554) (-390.453) * (-389.742) (-392.594) (-397.464) [-392.437] -- 0:00:31
478000 -- (-393.063) (-391.286) (-390.534) [-391.421] * (-390.252) (-389.738) [-390.315] (-390.976) -- 0:00:31
478500 -- (-392.014) (-393.599) (-390.844) [-389.479] * (-389.819) (-395.546) (-391.729) [-393.434] -- 0:00:31
479000 -- (-392.192) (-393.261) (-393.475) [-391.701] * (-392.303) [-391.700] (-389.512) (-391.827) -- 0:00:31
479500 -- (-391.202) [-392.938] (-389.445) (-391.148) * (-389.715) (-389.667) (-390.997) [-393.420] -- 0:00:32
480000 -- (-390.682) (-394.171) [-390.517] (-393.076) * (-390.215) (-397.994) [-391.327] (-394.373) -- 0:00:32
Average standard deviation of split frequencies: 0.009862
480500 -- (-391.418) (-390.067) [-393.936] (-389.748) * (-390.576) [-391.620] (-389.950) (-392.056) -- 0:00:32
481000 -- (-392.196) (-391.859) (-394.967) [-389.163] * (-393.342) (-389.611) [-389.431] (-393.700) -- 0:00:32
481500 -- [-391.065] (-392.601) (-390.919) (-390.980) * (-392.646) (-390.033) [-389.912] (-390.172) -- 0:00:32
482000 -- [-390.526] (-392.960) (-391.167) (-390.998) * (-393.161) (-391.523) (-393.040) [-392.279] -- 0:00:32
482500 -- [-391.480] (-389.829) (-391.716) (-392.112) * [-391.538] (-392.536) (-390.742) (-394.298) -- 0:00:32
483000 -- (-392.128) (-391.363) [-389.594] (-392.226) * (-389.202) (-391.847) [-389.607] (-397.179) -- 0:00:32
483500 -- (-390.772) (-391.568) (-391.853) [-390.629] * (-390.420) (-392.919) (-390.768) [-393.166] -- 0:00:32
484000 -- (-392.370) (-389.708) [-394.648] (-391.088) * (-392.402) (-390.478) [-392.387] (-391.969) -- 0:00:31
484500 -- [-393.064] (-391.729) (-391.378) (-390.245) * (-393.285) (-394.605) (-392.956) [-394.162] -- 0:00:31
485000 -- (-390.850) [-389.868] (-390.671) (-392.661) * [-391.090] (-393.914) (-390.720) (-392.694) -- 0:00:31
Average standard deviation of split frequencies: 0.008945
485500 -- (-390.040) (-391.292) (-389.914) [-393.581] * (-390.977) (-392.415) (-391.198) [-394.089] -- 0:00:31
486000 -- [-390.031] (-392.146) (-397.087) (-389.743) * (-391.690) (-392.235) [-392.351] (-394.254) -- 0:00:31
486500 -- (-390.022) (-394.870) (-398.538) [-389.797] * (-393.689) (-394.311) [-392.909] (-391.414) -- 0:00:31
487000 -- [-390.066] (-392.150) (-391.970) (-389.444) * (-389.995) [-391.685] (-389.297) (-389.328) -- 0:00:31
487500 -- [-389.968] (-392.907) (-390.752) (-391.978) * (-389.802) (-390.846) (-389.409) [-389.663] -- 0:00:31
488000 -- (-390.651) [-391.062] (-389.743) (-391.584) * (-393.026) (-392.174) [-393.768] (-392.523) -- 0:00:31
488500 -- (-390.215) [-390.628] (-389.606) (-392.494) * (-390.550) (-392.055) [-390.545] (-393.184) -- 0:00:31
489000 -- (-395.119) (-391.460) (-391.669) [-390.280] * (-389.553) [-391.136] (-391.578) (-391.994) -- 0:00:31
489500 -- (-394.659) (-391.815) (-392.059) [-393.244] * (-390.676) (-394.448) [-390.683] (-392.696) -- 0:00:31
490000 -- [-391.135] (-393.910) (-390.408) (-392.562) * (-391.017) (-392.371) (-391.527) [-389.264] -- 0:00:31
Average standard deviation of split frequencies: 0.009607
490500 -- (-394.610) [-389.630] (-391.025) (-394.443) * (-395.289) (-390.444) (-391.262) [-391.708] -- 0:00:31
491000 -- (-394.287) (-392.262) [-391.858] (-392.721) * (-398.711) (-390.779) (-391.485) [-390.584] -- 0:00:31
491500 -- (-393.645) (-397.133) (-398.749) [-390.743] * (-392.581) (-394.834) [-391.801] (-393.960) -- 0:00:31
492000 -- [-391.283] (-392.203) (-392.426) (-391.345) * (-392.716) [-391.339] (-392.953) (-395.285) -- 0:00:30
492500 -- (-390.847) (-390.725) [-391.721] (-391.769) * (-392.447) (-391.674) [-389.610] (-392.046) -- 0:00:30
493000 -- (-395.242) [-389.955] (-390.419) (-391.156) * (-395.916) (-390.757) [-390.636] (-395.570) -- 0:00:30
493500 -- (-394.029) (-389.424) (-391.163) [-390.762] * [-394.694] (-395.544) (-394.157) (-397.130) -- 0:00:30
494000 -- (-390.824) (-393.097) (-391.624) [-391.794] * [-389.624] (-391.126) (-391.755) (-392.072) -- 0:00:30
494500 -- (-393.474) (-391.647) [-389.464] (-389.736) * (-396.124) [-390.638] (-392.155) (-393.415) -- 0:00:30
495000 -- [-389.098] (-390.728) (-390.242) (-392.700) * [-390.933] (-392.797) (-389.630) (-391.666) -- 0:00:30
Average standard deviation of split frequencies: 0.009399
495500 -- (-389.753) (-390.887) (-392.042) [-391.175] * [-392.132] (-392.027) (-392.547) (-391.301) -- 0:00:30
496000 -- (-390.358) [-392.554] (-390.844) (-390.008) * (-391.187) (-393.988) (-391.360) [-390.740] -- 0:00:30
496500 -- (-390.430) (-390.831) [-391.108] (-391.438) * (-391.878) [-390.311] (-396.807) (-391.899) -- 0:00:30
497000 -- (-391.041) [-389.936] (-393.310) (-391.227) * (-393.048) (-394.034) (-391.977) [-389.843] -- 0:00:31
497500 -- (-396.378) (-390.108) [-396.757] (-389.802) * (-393.493) (-393.423) (-391.622) [-396.217] -- 0:00:31
498000 -- (-398.396) (-389.443) [-391.102] (-389.527) * (-391.997) (-390.767) [-390.431] (-396.420) -- 0:00:31
498500 -- [-389.968] (-393.703) (-391.460) (-393.090) * (-390.376) [-390.559] (-390.602) (-396.221) -- 0:00:31
499000 -- (-393.295) (-392.410) (-389.759) [-392.486] * (-390.618) (-397.709) (-394.927) [-389.236] -- 0:00:31
499500 -- (-394.992) (-391.451) (-391.182) [-393.407] * (-389.634) (-390.734) (-398.955) [-393.287] -- 0:00:31
500000 -- (-394.035) (-390.882) (-392.117) [-391.465] * (-392.485) [-389.901] (-401.995) (-395.677) -- 0:00:31
Average standard deviation of split frequencies: 0.008862
500500 -- (-393.898) [-389.883] (-389.950) (-393.878) * (-396.833) [-391.199] (-393.668) (-391.292) -- 0:00:30
501000 -- (-389.406) [-388.955] (-389.968) (-391.309) * (-391.602) (-391.350) [-391.615] (-392.053) -- 0:00:30
501500 -- (-389.061) [-390.635] (-389.677) (-392.741) * (-393.553) (-391.942) [-390.069] (-390.672) -- 0:00:30
502000 -- (-395.772) (-390.961) [-390.241] (-390.120) * (-392.794) (-395.624) [-393.083] (-391.060) -- 0:00:30
502500 -- (-392.663) (-391.215) (-390.827) [-392.705] * (-390.457) [-391.882] (-396.645) (-389.853) -- 0:00:30
503000 -- (-391.980) (-389.150) (-393.450) [-393.863] * (-392.249) (-390.484) (-394.279) [-390.620] -- 0:00:30
503500 -- (-389.778) [-389.823] (-391.346) (-389.464) * (-391.970) [-390.137] (-393.028) (-390.486) -- 0:00:30
504000 -- [-391.536] (-392.243) (-392.621) (-390.163) * [-393.805] (-389.966) (-391.077) (-392.323) -- 0:00:30
504500 -- [-391.390] (-392.443) (-391.189) (-391.360) * (-391.412) [-389.902] (-391.273) (-393.007) -- 0:00:30
505000 -- [-390.265] (-390.306) (-394.103) (-389.989) * (-389.473) [-391.534] (-390.330) (-390.115) -- 0:00:30
Average standard deviation of split frequencies: 0.009207
505500 -- (-391.243) [-389.973] (-392.120) (-390.803) * [-391.059] (-389.582) (-390.731) (-393.361) -- 0:00:30
506000 -- (-391.312) (-395.008) (-393.758) [-390.744] * (-393.578) (-390.183) [-391.567] (-391.791) -- 0:00:30
506500 -- (-397.311) [-390.646] (-392.033) (-391.384) * (-389.388) (-391.632) (-391.760) [-390.951] -- 0:00:30
507000 -- [-391.846] (-391.247) (-391.160) (-390.337) * [-390.165] (-389.765) (-393.027) (-389.818) -- 0:00:30
507500 -- (-393.508) [-390.430] (-390.410) (-390.960) * (-393.288) [-389.514] (-390.781) (-395.804) -- 0:00:30
508000 -- (-393.980) (-390.653) (-390.235) [-390.725] * (-389.402) [-391.046] (-394.299) (-394.574) -- 0:00:30
508500 -- (-389.083) (-392.608) [-389.764] (-391.266) * [-390.034] (-392.600) (-390.971) (-391.005) -- 0:00:29
509000 -- (-391.095) (-390.623) (-391.477) [-392.043] * (-390.042) [-393.243] (-392.389) (-389.911) -- 0:00:29
509500 -- [-391.631] (-396.519) (-394.648) (-394.074) * [-389.585] (-395.070) (-390.813) (-396.437) -- 0:00:29
510000 -- (-389.704) (-390.174) [-391.036] (-394.161) * (-390.094) (-390.716) (-390.039) [-389.667] -- 0:00:29
Average standard deviation of split frequencies: 0.009828
510500 -- (-389.214) (-394.198) (-392.905) [-390.236] * (-391.929) (-390.800) (-391.902) [-389.263] -- 0:00:29
511000 -- [-389.735] (-393.215) (-392.777) (-392.745) * (-393.610) [-394.189] (-389.274) (-390.435) -- 0:00:29
511500 -- [-391.870] (-390.432) (-389.986) (-391.126) * (-392.400) (-397.839) (-392.537) [-390.507] -- 0:00:29
512000 -- (-392.899) (-390.079) (-391.420) [-391.963] * (-390.045) (-395.720) (-395.330) [-390.697] -- 0:00:29
512500 -- (-390.555) [-390.412] (-389.590) (-393.072) * (-395.009) (-390.621) (-393.840) [-391.122] -- 0:00:29
513000 -- (-392.509) (-390.378) (-390.240) [-389.472] * (-391.841) (-393.307) (-390.417) [-393.827] -- 0:00:29
513500 -- (-394.203) (-390.345) (-392.197) [-391.026] * (-390.508) (-393.248) (-389.521) [-390.992] -- 0:00:29
514000 -- (-394.020) [-391.528] (-396.230) (-392.142) * [-389.294] (-391.164) (-393.677) (-391.442) -- 0:00:30
514500 -- (-393.169) (-390.641) [-389.204] (-389.728) * (-391.476) (-392.463) [-389.448] (-391.265) -- 0:00:30
515000 -- (-391.172) (-389.769) (-391.919) [-392.379] * (-392.072) [-392.165] (-390.409) (-395.907) -- 0:00:30
Average standard deviation of split frequencies: 0.009948
515500 -- [-391.478] (-390.944) (-391.978) (-390.090) * (-390.269) (-391.281) (-396.399) [-393.067] -- 0:00:30
516000 -- [-392.663] (-390.691) (-391.990) (-389.511) * (-392.686) (-390.013) [-395.667] (-394.998) -- 0:00:30
516500 -- (-391.027) (-391.748) [-392.309] (-391.738) * [-391.919] (-392.732) (-389.918) (-391.659) -- 0:00:29
517000 -- (-391.712) (-391.416) [-389.883] (-390.659) * (-394.912) [-391.734] (-394.156) (-389.678) -- 0:00:29
517500 -- (-389.644) [-391.245] (-391.023) (-394.704) * (-397.749) [-390.810] (-392.272) (-392.033) -- 0:00:29
518000 -- (-390.516) (-397.017) (-390.393) [-393.994] * (-391.846) [-390.371] (-391.962) (-393.454) -- 0:00:29
518500 -- (-391.577) (-392.695) [-393.571] (-392.751) * (-389.234) (-391.012) [-389.502] (-390.027) -- 0:00:29
519000 -- [-392.281] (-390.472) (-392.939) (-393.615) * (-390.473) (-389.933) (-391.744) [-392.103] -- 0:00:29
519500 -- (-390.212) [-389.317] (-393.143) (-389.844) * [-390.044] (-391.553) (-392.631) (-391.210) -- 0:00:29
520000 -- (-390.121) (-391.388) (-391.301) [-390.523] * (-391.189) [-394.217] (-391.562) (-389.866) -- 0:00:29
Average standard deviation of split frequencies: 0.009708
520500 -- (-389.762) [-395.408] (-392.273) (-390.789) * (-391.250) [-394.296] (-396.998) (-391.971) -- 0:00:29
521000 -- (-390.546) (-392.333) (-390.703) [-390.987] * (-390.017) (-395.784) (-392.642) [-389.669] -- 0:00:29
521500 -- (-389.615) (-393.141) [-390.187] (-392.294) * (-391.120) (-393.944) [-389.645] (-391.613) -- 0:00:29
522000 -- (-389.400) (-391.579) [-393.531] (-390.015) * (-390.190) [-389.734] (-393.052) (-392.886) -- 0:00:29
522500 -- (-390.788) (-394.466) (-390.782) [-393.682] * (-389.888) (-391.865) [-391.098] (-393.726) -- 0:00:29
523000 -- [-392.747] (-393.810) (-389.823) (-395.235) * (-391.506) (-390.601) [-389.917] (-391.695) -- 0:00:29
523500 -- (-392.164) [-390.702] (-394.069) (-392.990) * (-397.440) (-393.226) [-393.048] (-393.320) -- 0:00:29
524000 -- (-393.391) (-393.706) (-395.208) [-392.336] * [-389.887] (-392.079) (-392.200) (-391.892) -- 0:00:29
524500 -- (-391.142) [-391.378] (-391.859) (-390.235) * (-392.116) [-390.036] (-391.484) (-399.549) -- 0:00:29
525000 -- [-389.875] (-391.345) (-391.796) (-392.715) * [-391.956] (-390.461) (-391.950) (-390.559) -- 0:00:28
Average standard deviation of split frequencies: 0.009808
525500 -- [-391.267] (-390.440) (-394.448) (-392.585) * (-393.367) (-393.234) (-390.000) [-391.385] -- 0:00:28
526000 -- (-393.288) [-391.562] (-390.253) (-392.628) * (-393.003) (-390.887) [-392.090] (-392.493) -- 0:00:28
526500 -- (-397.352) (-391.435) (-392.154) [-390.483] * (-393.247) (-389.629) (-389.612) [-390.560] -- 0:00:28
527000 -- (-395.888) (-391.443) [-392.533] (-391.471) * (-392.350) (-391.563) (-390.453) [-391.997] -- 0:00:28
527500 -- [-392.756] (-390.077) (-390.423) (-390.568) * (-392.399) (-393.721) (-391.082) [-391.006] -- 0:00:28
528000 -- (-393.849) (-390.732) [-391.803] (-389.471) * (-390.116) (-392.388) [-391.770] (-391.300) -- 0:00:28
528500 -- (-392.658) (-390.933) [-391.359] (-390.689) * [-389.376] (-392.147) (-390.127) (-389.433) -- 0:00:28
529000 -- [-390.597] (-394.798) (-391.125) (-389.766) * (-391.095) (-393.821) (-394.035) [-389.649] -- 0:00:28
529500 -- (-397.414) (-390.456) [-392.096] (-390.240) * [-390.699] (-391.625) (-390.625) (-389.640) -- 0:00:28
530000 -- (-392.182) [-389.743] (-391.081) (-391.710) * (-389.958) (-394.081) [-389.645] (-391.371) -- 0:00:28
Average standard deviation of split frequencies: 0.009928
530500 -- (-389.380) (-394.205) [-392.911] (-391.783) * (-391.687) [-392.287] (-390.330) (-393.201) -- 0:00:29
531000 -- (-389.812) (-391.945) (-391.122) [-394.149] * (-394.021) [-395.384] (-392.094) (-389.664) -- 0:00:29
531500 -- (-393.226) (-395.218) [-389.177] (-389.062) * [-390.681] (-391.656) (-392.247) (-390.939) -- 0:00:29
532000 -- (-392.847) (-390.678) [-389.753] (-391.159) * [-391.021] (-392.129) (-396.128) (-398.061) -- 0:00:29
532500 -- (-394.507) (-389.575) [-391.565] (-391.655) * [-391.067] (-391.677) (-393.247) (-395.257) -- 0:00:28
533000 -- (-393.763) (-389.180) [-392.101] (-390.066) * [-393.884] (-391.358) (-389.341) (-391.585) -- 0:00:28
533500 -- (-394.741) [-390.763] (-391.638) (-390.134) * [-392.358] (-391.086) (-391.640) (-391.879) -- 0:00:28
534000 -- (-389.792) [-390.104] (-390.266) (-390.835) * (-391.281) [-389.974] (-390.587) (-391.400) -- 0:00:28
534500 -- (-390.923) (-392.489) [-396.600] (-390.712) * [-390.960] (-390.787) (-391.921) (-391.382) -- 0:00:28
535000 -- (-390.509) (-390.022) (-391.813) [-393.515] * (-393.429) [-389.460] (-391.151) (-396.221) -- 0:00:28
Average standard deviation of split frequencies: 0.009364
535500 -- (-391.067) (-390.350) [-392.784] (-392.304) * (-396.854) (-392.459) (-390.279) [-391.328] -- 0:00:28
536000 -- (-391.045) (-393.296) [-391.877] (-391.121) * (-392.554) (-392.129) (-391.155) [-390.227] -- 0:00:28
536500 -- (-390.159) (-393.504) [-388.991] (-393.174) * (-391.979) (-390.401) [-390.300] (-391.360) -- 0:00:28
537000 -- [-390.567] (-392.214) (-390.920) (-393.255) * (-390.222) [-389.587] (-390.241) (-391.165) -- 0:00:28
537500 -- (-392.397) [-392.146] (-393.271) (-391.496) * (-391.038) [-390.010] (-391.077) (-390.325) -- 0:00:28
538000 -- (-389.153) [-391.515] (-391.409) (-390.819) * (-390.533) [-390.646] (-389.986) (-389.348) -- 0:00:28
538500 -- (-392.620) [-390.013] (-390.831) (-395.437) * (-390.500) (-389.397) [-391.429] (-389.368) -- 0:00:28
539000 -- (-391.473) (-389.368) (-394.387) [-393.328] * (-391.401) (-391.916) [-391.266] (-391.224) -- 0:00:28
539500 -- (-392.582) (-390.437) (-395.185) [-389.497] * (-390.107) (-390.169) (-391.109) [-389.858] -- 0:00:28
540000 -- (-391.274) (-391.287) (-392.534) [-390.698] * [-390.537] (-391.579) (-394.481) (-391.740) -- 0:00:28
Average standard deviation of split frequencies: 0.009833
540500 -- (-389.989) [-395.096] (-391.472) (-391.254) * [-390.296] (-391.410) (-393.206) (-394.167) -- 0:00:28
541000 -- [-393.091] (-390.674) (-389.994) (-391.568) * [-391.465] (-392.284) (-393.411) (-390.059) -- 0:00:27
541500 -- (-389.896) (-390.717) (-390.814) [-390.315] * (-392.580) (-391.551) (-389.711) [-392.768] -- 0:00:27
542000 -- (-391.706) (-392.577) (-391.291) [-389.821] * (-391.093) [-391.190] (-389.827) (-393.466) -- 0:00:27
542500 -- [-394.147] (-392.023) (-391.399) (-393.314) * (-394.644) (-392.813) (-392.147) [-392.640] -- 0:00:27
543000 -- (-392.880) (-390.534) [-393.461] (-394.398) * (-392.458) (-391.663) [-390.002] (-398.702) -- 0:00:27
543500 -- (-392.889) (-392.478) [-389.744] (-398.140) * (-394.101) (-390.746) [-390.565] (-392.308) -- 0:00:27
544000 -- (-389.980) (-396.853) [-390.112] (-394.780) * (-393.673) [-392.013] (-393.619) (-396.147) -- 0:00:27
544500 -- [-391.280] (-390.857) (-393.527) (-389.951) * (-389.803) (-392.050) [-391.736] (-396.214) -- 0:00:27
545000 -- [-393.858] (-391.642) (-391.284) (-391.860) * [-391.392] (-390.251) (-393.127) (-391.661) -- 0:00:27
Average standard deviation of split frequencies: 0.009497
545500 -- (-395.001) (-389.328) (-390.734) [-391.299] * [-389.068] (-393.306) (-390.519) (-391.386) -- 0:00:27
546000 -- (-395.716) [-390.561] (-395.314) (-392.039) * [-389.067] (-393.609) (-389.996) (-389.552) -- 0:00:27
546500 -- (-390.179) [-390.550] (-388.957) (-392.060) * (-389.236) (-392.630) (-392.342) [-389.442] -- 0:00:27
547000 -- (-390.326) [-389.291] (-392.420) (-392.998) * (-390.338) (-389.935) [-390.599] (-392.360) -- 0:00:27
547500 -- [-392.115] (-390.097) (-394.270) (-391.208) * (-389.089) (-391.842) (-392.005) [-391.690] -- 0:00:27
548000 -- [-389.464] (-392.922) (-392.224) (-391.154) * [-389.845] (-389.851) (-391.272) (-392.742) -- 0:00:28
548500 -- (-390.651) (-393.560) [-390.947] (-390.731) * [-389.822] (-391.607) (-393.918) (-395.116) -- 0:00:27
549000 -- (-389.569) (-392.113) [-391.423] (-394.280) * [-393.724] (-390.533) (-389.435) (-393.147) -- 0:00:27
549500 -- (-389.299) (-392.850) [-389.905] (-394.554) * [-397.791] (-389.702) (-395.477) (-394.794) -- 0:00:27
550000 -- (-391.093) [-393.071] (-390.056) (-392.101) * (-390.766) [-390.583] (-392.474) (-392.804) -- 0:00:27
Average standard deviation of split frequencies: 0.009417
550500 -- (-393.501) (-389.504) (-389.826) [-390.834] * (-391.765) (-391.031) (-390.135) [-390.073] -- 0:00:27
551000 -- (-392.216) (-392.385) (-390.834) [-392.072] * (-392.601) (-389.906) (-392.924) [-389.504] -- 0:00:27
551500 -- [-389.252] (-394.587) (-390.505) (-396.435) * (-392.772) [-390.225] (-391.330) (-392.369) -- 0:00:27
552000 -- (-393.633) [-391.798] (-390.779) (-392.339) * (-391.441) (-392.075) [-391.049] (-393.127) -- 0:00:27
552500 -- [-394.286] (-392.234) (-391.916) (-390.568) * (-391.267) [-389.908] (-392.862) (-396.088) -- 0:00:27
553000 -- (-391.577) (-391.411) (-390.474) [-390.142] * (-392.048) [-392.514] (-390.680) (-398.252) -- 0:00:27
553500 -- [-391.339] (-391.835) (-389.847) (-391.382) * [-389.423] (-390.525) (-395.441) (-390.449) -- 0:00:27
554000 -- (-389.610) (-390.955) [-389.151] (-389.785) * (-392.983) (-394.373) (-390.352) [-391.839] -- 0:00:27
554500 -- (-395.926) (-390.603) (-389.378) [-390.966] * (-391.897) (-390.815) (-390.037) [-391.688] -- 0:00:27
555000 -- (-392.513) (-390.614) [-394.211] (-390.260) * (-391.747) [-390.141] (-390.980) (-390.258) -- 0:00:27
Average standard deviation of split frequencies: 0.008927
555500 -- (-391.438) (-390.364) [-391.362] (-390.880) * [-390.080] (-392.020) (-393.442) (-389.612) -- 0:00:27
556000 -- (-391.479) [-391.801] (-391.107) (-392.454) * (-389.074) [-394.656] (-393.397) (-396.750) -- 0:00:27
556500 -- (-392.195) (-391.690) (-392.599) [-391.008] * (-390.717) (-396.446) (-389.356) [-391.114] -- 0:00:27
557000 -- (-390.810) (-389.791) (-389.335) [-391.183] * (-390.324) (-392.079) (-390.067) [-392.101] -- 0:00:27
557500 -- (-389.770) (-389.339) [-390.861] (-392.240) * (-393.862) (-392.635) (-390.113) [-390.672] -- 0:00:26
558000 -- (-394.365) [-389.752] (-390.006) (-391.136) * (-390.548) (-391.380) [-390.720] (-389.565) -- 0:00:26
558500 -- (-394.458) (-392.864) (-391.374) [-390.091] * [-391.015] (-391.641) (-391.578) (-390.361) -- 0:00:26
559000 -- (-391.658) (-390.634) (-393.120) [-391.768] * [-389.564] (-392.685) (-390.225) (-392.670) -- 0:00:26
559500 -- (-389.840) (-391.372) [-401.356] (-390.480) * [-391.064] (-394.380) (-390.507) (-391.080) -- 0:00:26
560000 -- (-392.981) [-389.874] (-393.423) (-393.543) * (-391.326) (-392.477) (-390.514) [-391.173] -- 0:00:26
Average standard deviation of split frequencies: 0.008705
560500 -- [-391.051] (-390.188) (-390.719) (-400.220) * (-391.335) (-394.748) [-390.447] (-391.568) -- 0:00:26
561000 -- [-393.886] (-392.277) (-390.569) (-395.100) * (-390.557) (-393.798) [-391.564] (-389.553) -- 0:00:26
561500 -- (-390.391) (-390.848) (-389.663) [-389.597] * [-389.785] (-389.654) (-391.814) (-392.937) -- 0:00:26
562000 -- (-390.337) (-391.954) [-390.008] (-391.871) * [-393.466] (-389.256) (-390.853) (-392.013) -- 0:00:26
562500 -- [-390.627] (-394.977) (-389.975) (-393.026) * (-391.033) [-389.250] (-392.523) (-392.453) -- 0:00:26
563000 -- (-389.729) (-389.750) [-392.276] (-395.660) * (-394.033) (-390.109) [-392.702] (-399.222) -- 0:00:26
563500 -- (-391.896) [-390.238] (-394.888) (-390.519) * (-390.822) (-392.439) (-389.982) [-398.587] -- 0:00:26
564000 -- (-395.999) (-396.150) [-389.568] (-391.891) * [-393.523] (-391.627) (-390.530) (-392.552) -- 0:00:26
564500 -- (-390.251) [-391.922] (-390.357) (-391.395) * (-392.199) [-390.671] (-392.410) (-390.714) -- 0:00:26
565000 -- (-392.750) (-392.447) [-390.374] (-390.460) * (-390.159) [-389.979] (-394.302) (-393.988) -- 0:00:26
Average standard deviation of split frequencies: 0.008721
565500 -- (-391.371) (-390.701) (-392.286) [-389.501] * (-390.747) (-390.870) (-391.216) [-391.451] -- 0:00:26
566000 -- [-391.335] (-392.609) (-393.104) (-390.420) * (-389.921) (-390.577) (-392.728) [-392.960] -- 0:00:26
566500 -- (-391.320) (-389.624) (-391.235) [-390.608] * [-390.838] (-390.273) (-396.029) (-393.890) -- 0:00:26
567000 -- [-391.067] (-395.939) (-391.635) (-392.270) * (-391.406) [-392.939] (-389.790) (-391.561) -- 0:00:26
567500 -- (-393.370) [-390.049] (-389.489) (-392.293) * (-391.222) (-389.403) (-392.688) [-392.081] -- 0:00:26
568000 -- (-390.851) [-393.404] (-389.671) (-392.909) * (-393.025) [-390.369] (-395.122) (-390.891) -- 0:00:26
568500 -- (-391.988) [-390.171] (-390.795) (-393.190) * (-391.837) (-391.151) [-391.923] (-390.902) -- 0:00:26
569000 -- (-390.514) [-392.189] (-390.494) (-389.388) * (-392.044) [-389.608] (-390.570) (-394.092) -- 0:00:26
569500 -- (-393.620) [-395.631] (-390.350) (-392.035) * (-396.118) (-392.520) (-391.793) [-390.501] -- 0:00:26
570000 -- [-392.957] (-395.576) (-392.347) (-393.510) * (-394.831) (-390.952) [-393.693] (-392.078) -- 0:00:26
Average standard deviation of split frequencies: 0.009087
570500 -- (-389.760) (-392.695) [-390.747] (-389.035) * (-390.592) (-389.114) [-390.565] (-389.799) -- 0:00:26
571000 -- (-392.179) (-389.004) (-391.395) [-390.600] * (-393.106) (-392.612) (-392.635) [-390.896] -- 0:00:26
571500 -- (-390.091) [-390.123] (-389.456) (-390.770) * [-394.051] (-393.709) (-392.824) (-392.921) -- 0:00:26
572000 -- (-390.229) [-389.554] (-394.343) (-392.327) * (-391.257) (-391.282) (-392.212) [-392.065] -- 0:00:26
572500 -- (-391.821) (-389.496) [-392.889] (-391.701) * (-393.556) (-389.590) (-390.678) [-390.756] -- 0:00:26
573000 -- (-389.917) (-391.259) (-393.199) [-391.076] * (-392.677) (-390.236) (-390.379) [-392.353] -- 0:00:26
573500 -- (-392.912) (-393.957) (-389.977) [-389.220] * (-393.110) (-391.470) [-389.596] (-390.536) -- 0:00:26
574000 -- (-397.116) (-391.986) (-391.650) [-390.360] * (-394.772) (-391.676) [-389.344] (-390.036) -- 0:00:25
574500 -- (-394.293) [-398.031] (-391.378) (-391.632) * (-393.669) (-390.481) [-393.306] (-392.681) -- 0:00:25
575000 -- (-394.861) [-390.906] (-390.753) (-391.349) * (-395.453) [-390.476] (-391.816) (-397.015) -- 0:00:25
Average standard deviation of split frequencies: 0.008473
575500 -- [-391.772] (-393.091) (-391.069) (-394.361) * [-392.034] (-391.846) (-390.536) (-394.120) -- 0:00:25
576000 -- (-389.875) (-390.787) (-392.698) [-392.623] * (-390.195) [-389.982] (-390.247) (-393.513) -- 0:00:25
576500 -- (-391.417) [-392.532] (-391.515) (-390.858) * [-390.699] (-390.017) (-391.393) (-391.535) -- 0:00:25
577000 -- (-392.079) [-396.560] (-391.652) (-390.290) * (-391.425) [-391.484] (-393.210) (-390.843) -- 0:00:25
577500 -- [-389.744] (-392.184) (-389.614) (-392.875) * (-390.919) (-390.862) (-390.857) [-391.982] -- 0:00:25
578000 -- (-390.632) (-390.016) [-390.624] (-390.516) * (-390.625) (-392.457) [-391.250] (-393.739) -- 0:00:25
578500 -- [-390.501] (-390.191) (-390.811) (-390.739) * [-390.357] (-390.549) (-392.469) (-390.479) -- 0:00:25
579000 -- [-390.527] (-393.268) (-392.154) (-391.730) * (-391.491) (-390.199) (-393.122) [-391.896] -- 0:00:25
579500 -- (-390.234) (-392.545) (-395.606) [-391.850] * [-391.155] (-390.845) (-390.602) (-391.650) -- 0:00:25
580000 -- (-392.367) [-389.932] (-391.042) (-391.185) * (-396.990) [-389.868] (-391.192) (-392.352) -- 0:00:25
Average standard deviation of split frequencies: 0.007712
580500 -- (-391.231) [-390.585] (-390.918) (-391.070) * (-397.586) [-391.584] (-390.840) (-389.485) -- 0:00:25
581000 -- (-391.385) (-392.707) [-392.915] (-398.264) * [-393.023] (-390.695) (-394.630) (-390.696) -- 0:00:25
581500 -- [-390.726] (-392.467) (-389.601) (-391.868) * [-391.304] (-389.114) (-389.836) (-393.668) -- 0:00:25
582000 -- (-391.620) (-394.191) [-389.367] (-390.029) * (-392.739) (-390.792) (-391.928) [-389.251] -- 0:00:25
582500 -- (-392.417) (-391.264) (-393.653) [-391.367] * (-393.919) (-393.902) [-394.342] (-390.584) -- 0:00:25
583000 -- (-390.209) (-392.406) [-392.267] (-389.400) * (-391.875) [-391.440] (-394.021) (-390.917) -- 0:00:25
583500 -- (-394.402) (-391.437) [-389.892] (-393.686) * (-392.048) (-389.808) [-392.626] (-390.232) -- 0:00:25
584000 -- (-391.467) [-394.185] (-399.351) (-392.793) * (-394.772) (-393.709) (-395.550) [-391.361] -- 0:00:25
584500 -- (-390.694) [-392.659] (-390.944) (-389.657) * (-389.757) [-392.252] (-391.675) (-390.696) -- 0:00:25
585000 -- [-389.980] (-392.513) (-395.060) (-390.187) * (-389.195) (-391.832) (-392.043) [-394.713] -- 0:00:25
Average standard deviation of split frequencies: 0.007089
585500 -- (-392.395) [-392.670] (-391.855) (-395.141) * (-390.903) [-389.929] (-391.938) (-392.274) -- 0:00:25
586000 -- (-391.236) [-391.599] (-393.137) (-398.769) * (-394.699) [-389.760] (-390.191) (-394.042) -- 0:00:25
586500 -- (-391.372) (-391.214) [-390.646] (-390.066) * [-391.449] (-391.776) (-390.255) (-392.447) -- 0:00:25
587000 -- (-395.288) (-397.469) [-392.227] (-391.836) * [-390.408] (-393.946) (-389.989) (-394.212) -- 0:00:25
587500 -- (-394.303) (-396.738) [-389.925] (-391.786) * [-389.857] (-389.552) (-396.012) (-392.758) -- 0:00:25
588000 -- (-395.598) (-389.637) (-391.468) [-394.407] * (-393.034) (-393.004) [-393.751] (-392.379) -- 0:00:25
588500 -- [-391.730] (-390.293) (-390.254) (-396.325) * (-392.317) (-395.637) [-391.040] (-390.478) -- 0:00:25
589000 -- (-391.258) (-390.777) [-392.770] (-390.291) * [-390.410] (-394.650) (-393.493) (-391.738) -- 0:00:25
589500 -- [-390.792] (-390.840) (-396.648) (-393.232) * (-390.201) (-391.885) [-399.740] (-390.398) -- 0:00:25
590000 -- (-392.254) (-392.420) (-391.750) [-389.840] * [-391.126] (-390.552) (-394.925) (-390.057) -- 0:00:25
Average standard deviation of split frequencies: 0.007632
590500 -- (-391.983) [-390.563] (-392.342) (-389.562) * (-389.826) (-398.248) (-391.816) [-391.849] -- 0:00:24
591000 -- [-390.463] (-393.777) (-389.886) (-391.636) * [-390.227] (-392.617) (-391.894) (-390.261) -- 0:00:24
591500 -- (-392.936) (-392.519) (-391.588) [-390.556] * (-391.510) (-391.551) (-392.460) [-396.383] -- 0:00:24
592000 -- (-389.437) [-390.724] (-391.097) (-390.103) * (-390.768) [-392.741] (-389.544) (-392.440) -- 0:00:24
592500 -- (-390.222) (-391.659) [-391.478] (-391.558) * [-392.354] (-389.778) (-389.613) (-392.953) -- 0:00:24
593000 -- [-389.820] (-396.528) (-392.979) (-390.950) * (-389.935) [-390.664] (-390.434) (-391.546) -- 0:00:24
593500 -- (-392.802) [-391.805] (-394.867) (-393.416) * (-389.203) [-391.754] (-394.303) (-390.031) -- 0:00:24
594000 -- (-391.413) (-389.738) (-390.448) [-392.603] * [-390.975] (-391.443) (-395.384) (-392.799) -- 0:00:24
594500 -- (-391.730) (-389.566) (-392.810) [-389.813] * [-390.417] (-390.322) (-391.806) (-394.595) -- 0:00:24
595000 -- (-398.082) (-393.042) (-390.500) [-389.665] * [-389.248] (-390.427) (-390.494) (-389.141) -- 0:00:24
Average standard deviation of split frequencies: 0.008503
595500 -- [-390.042] (-390.832) (-391.027) (-393.311) * (-392.482) (-393.454) (-390.675) [-391.427] -- 0:00:24
596000 -- (-395.196) (-390.255) [-392.743] (-391.245) * (-392.478) (-391.876) (-389.818) [-389.977] -- 0:00:24
596500 -- (-394.238) (-389.732) (-392.886) [-392.653] * (-398.247) (-390.942) [-390.663] (-389.841) -- 0:00:24
597000 -- (-392.956) [-391.727] (-393.086) (-397.670) * (-389.143) (-392.962) (-393.055) [-390.252] -- 0:00:24
597500 -- (-393.920) [-392.202] (-390.259) (-390.314) * (-390.950) (-396.162) (-392.336) [-389.828] -- 0:00:24
598000 -- (-392.771) [-390.943] (-391.661) (-392.811) * (-389.526) (-393.294) (-397.848) [-390.732] -- 0:00:24
598500 -- [-392.740] (-393.760) (-393.212) (-391.336) * [-390.851] (-391.720) (-394.802) (-391.467) -- 0:00:24
599000 -- [-390.765] (-392.795) (-389.638) (-389.298) * (-392.792) [-389.827] (-391.549) (-392.113) -- 0:00:24
599500 -- (-390.812) [-389.551] (-396.281) (-394.191) * (-394.242) [-394.996] (-391.727) (-391.425) -- 0:00:24
600000 -- [-391.697] (-389.211) (-390.597) (-391.915) * [-390.281] (-390.675) (-390.902) (-389.753) -- 0:00:24
Average standard deviation of split frequencies: 0.008437
600500 -- (-390.248) (-390.827) [-389.812] (-390.248) * (-390.735) (-389.598) [-389.913] (-391.889) -- 0:00:24
601000 -- (-390.948) (-396.777) (-393.862) [-389.376] * [-392.569] (-390.310) (-391.256) (-390.553) -- 0:00:24
601500 -- [-390.952] (-393.843) (-393.429) (-392.958) * (-391.369) (-389.260) [-389.760] (-393.245) -- 0:00:24
602000 -- (-391.442) [-390.105] (-395.433) (-394.639) * [-390.778] (-389.439) (-393.362) (-389.879) -- 0:00:24
602500 -- (-389.511) (-389.624) [-390.712] (-395.051) * (-391.871) (-391.962) (-395.135) [-389.824] -- 0:00:24
603000 -- [-389.906] (-390.058) (-391.637) (-392.428) * [-392.932] (-390.466) (-391.545) (-392.502) -- 0:00:24
603500 -- (-390.084) (-392.145) [-390.127] (-395.211) * [-393.372] (-395.513) (-390.068) (-390.791) -- 0:00:24
604000 -- (-391.526) (-391.027) (-390.388) [-391.739] * [-391.629] (-393.681) (-390.247) (-392.021) -- 0:00:24
604500 -- (-391.500) (-390.477) [-394.380] (-390.530) * (-391.552) (-391.413) (-391.591) [-390.991] -- 0:00:24
605000 -- (-391.871) (-390.131) (-391.448) [-390.955] * (-390.899) (-390.847) (-392.643) [-390.029] -- 0:00:24
Average standard deviation of split frequencies: 0.008946
605500 -- (-395.993) (-391.656) [-389.849] (-393.119) * (-395.448) (-392.174) [-391.169] (-390.927) -- 0:00:24
606000 -- (-391.481) [-389.944] (-390.562) (-392.455) * (-389.808) (-390.804) [-391.043] (-391.273) -- 0:00:24
606500 -- (-390.924) [-393.165] (-391.667) (-393.082) * (-392.984) [-390.511] (-390.098) (-390.108) -- 0:00:24
607000 -- (-393.678) (-391.200) [-390.235] (-390.689) * (-392.570) [-390.540] (-390.419) (-390.091) -- 0:00:23
607500 -- (-391.085) [-392.092] (-389.940) (-392.277) * [-391.383] (-392.570) (-389.140) (-395.233) -- 0:00:23
608000 -- [-393.884] (-394.184) (-393.160) (-391.488) * (-392.776) (-394.124) (-392.044) [-392.052] -- 0:00:23
608500 -- (-392.989) (-394.059) (-393.800) [-391.773] * [-390.461] (-391.418) (-392.064) (-392.562) -- 0:00:23
609000 -- (-390.102) [-390.815] (-390.700) (-393.513) * (-390.957) (-390.533) [-389.809] (-391.784) -- 0:00:23
609500 -- [-390.603] (-390.952) (-393.224) (-392.021) * [-389.568] (-389.863) (-389.989) (-393.204) -- 0:00:23
610000 -- (-389.358) (-391.300) [-394.308] (-391.688) * (-390.679) [-391.239] (-390.733) (-391.467) -- 0:00:23
Average standard deviation of split frequencies: 0.009263
610500 -- (-389.495) (-390.486) [-394.193] (-390.503) * [-391.155] (-391.508) (-390.579) (-389.704) -- 0:00:23
611000 -- (-392.947) (-390.333) [-393.350] (-393.796) * (-390.798) (-392.613) [-390.382] (-391.143) -- 0:00:23
611500 -- [-391.859] (-391.339) (-394.779) (-390.136) * (-392.183) (-390.794) [-390.384] (-392.153) -- 0:00:23
612000 -- (-392.203) (-392.220) (-390.724) [-390.256] * [-393.113] (-391.751) (-390.267) (-391.965) -- 0:00:23
612500 -- (-389.608) (-390.478) [-389.934] (-388.957) * [-392.583] (-389.190) (-389.530) (-390.843) -- 0:00:23
613000 -- (-392.209) [-389.976] (-390.933) (-389.634) * (-389.870) (-389.388) [-389.959] (-394.085) -- 0:00:23
613500 -- (-392.499) (-391.439) [-391.063] (-389.873) * (-390.038) (-390.320) [-395.199] (-394.267) -- 0:00:23
614000 -- [-391.995] (-395.262) (-389.863) (-396.070) * (-393.335) (-390.555) (-390.282) [-389.998] -- 0:00:23
614500 -- [-391.745] (-393.299) (-391.128) (-392.635) * (-390.173) (-389.953) (-392.649) [-390.625] -- 0:00:23
615000 -- (-391.800) (-391.276) (-392.360) [-395.731] * (-391.652) (-393.607) [-390.170] (-392.588) -- 0:00:23
Average standard deviation of split frequencies: 0.009991
615500 -- (-390.066) (-393.375) (-391.726) [-389.874] * [-389.036] (-393.459) (-391.458) (-390.946) -- 0:00:23
616000 -- (-393.682) [-390.526] (-389.969) (-389.222) * (-392.555) (-390.693) (-392.710) [-392.478] -- 0:00:23
616500 -- (-396.867) [-391.181] (-389.448) (-390.169) * (-391.968) [-390.526] (-391.483) (-390.892) -- 0:00:23
617000 -- (-389.638) (-391.220) (-393.132) [-394.038] * (-391.389) (-393.654) (-389.657) [-390.690] -- 0:00:23
617500 -- (-391.665) (-390.143) (-393.863) [-389.989] * (-391.153) [-390.751] (-390.492) (-395.129) -- 0:00:23
618000 -- [-390.553] (-390.087) (-391.232) (-391.819) * (-393.033) (-391.177) [-391.280] (-391.528) -- 0:00:23
618500 -- [-390.000] (-393.543) (-389.233) (-393.369) * [-390.131] (-393.001) (-389.725) (-392.658) -- 0:00:23
619000 -- [-393.419] (-392.206) (-391.119) (-389.904) * (-390.738) (-389.741) [-389.982] (-392.026) -- 0:00:23
619500 -- (-393.074) (-394.758) [-389.817] (-391.063) * (-390.003) [-389.727] (-392.212) (-391.767) -- 0:00:23
620000 -- (-395.221) (-391.253) (-391.350) [-389.876] * (-390.155) (-389.695) [-392.575] (-391.973) -- 0:00:23
Average standard deviation of split frequencies: 0.009561
620500 -- (-396.276) (-390.901) [-390.124] (-390.887) * (-391.557) (-391.861) [-389.296] (-394.502) -- 0:00:23
621000 -- [-390.475] (-389.597) (-391.769) (-395.297) * [-389.004] (-390.143) (-389.897) (-390.044) -- 0:00:23
621500 -- (-389.681) (-389.558) [-390.732] (-391.215) * [-391.917] (-394.096) (-391.214) (-392.975) -- 0:00:23
622000 -- (-389.929) (-390.668) [-390.035] (-390.147) * [-392.374] (-394.471) (-389.414) (-392.593) -- 0:00:23
622500 -- (-390.760) [-391.592] (-390.438) (-391.706) * [-389.794] (-392.230) (-392.601) (-392.607) -- 0:00:23
623000 -- (-390.114) [-390.111] (-389.931) (-391.043) * [-392.601] (-390.281) (-391.369) (-394.812) -- 0:00:22
623500 -- (-393.170) (-390.056) [-391.453] (-389.854) * (-389.588) (-389.916) (-393.629) [-391.574] -- 0:00:22
624000 -- (-392.687) (-394.688) [-391.666] (-391.746) * (-390.278) [-389.615] (-392.830) (-391.153) -- 0:00:22
624500 -- (-391.504) (-396.446) [-389.819] (-390.885) * (-391.468) [-392.013] (-392.939) (-390.275) -- 0:00:22
625000 -- (-391.552) [-390.988] (-390.592) (-391.883) * (-390.111) [-389.390] (-393.991) (-391.668) -- 0:00:22
Average standard deviation of split frequencies: 0.009169
625500 -- (-391.709) (-391.128) [-389.921] (-389.902) * (-391.859) (-392.770) [-390.448] (-391.819) -- 0:00:22
626000 -- (-390.495) (-391.428) [-389.422] (-390.052) * (-391.157) [-390.780] (-391.918) (-392.890) -- 0:00:22
626500 -- (-394.409) [-392.512] (-394.370) (-390.487) * (-391.339) [-390.203] (-390.412) (-394.916) -- 0:00:22
627000 -- (-391.733) (-389.818) (-393.908) [-392.540] * (-389.870) [-390.053] (-395.106) (-389.626) -- 0:00:22
627500 -- (-392.799) (-394.753) (-391.276) [-392.353] * (-390.687) [-389.151] (-391.483) (-389.833) -- 0:00:22
628000 -- (-389.311) (-391.954) [-389.403] (-389.110) * (-390.735) (-389.255) (-391.374) [-390.222] -- 0:00:22
628500 -- [-389.874] (-389.975) (-390.978) (-389.765) * [-391.118] (-391.646) (-391.048) (-391.623) -- 0:00:22
629000 -- (-390.617) (-389.687) [-391.433] (-389.490) * (-390.680) (-390.564) [-392.540] (-391.260) -- 0:00:22
629500 -- [-390.819] (-392.296) (-394.830) (-390.528) * [-393.258] (-390.726) (-392.782) (-393.713) -- 0:00:22
630000 -- [-391.143] (-390.993) (-391.590) (-393.948) * [-391.750] (-389.187) (-395.310) (-396.053) -- 0:00:22
Average standard deviation of split frequencies: 0.009453
630500 -- (-391.446) (-389.216) (-392.360) [-389.952] * (-391.039) (-389.477) [-391.067] (-392.235) -- 0:00:22
631000 -- [-390.151] (-391.466) (-392.692) (-395.301) * (-389.589) (-390.978) (-391.654) [-394.448] -- 0:00:22
631500 -- (-389.519) (-391.718) (-390.625) [-389.951] * [-389.633] (-391.375) (-390.497) (-391.332) -- 0:00:22
632000 -- [-390.111] (-390.936) (-393.218) (-394.899) * (-392.636) (-389.761) [-394.756] (-389.868) -- 0:00:22
632500 -- [-391.062] (-391.703) (-390.503) (-394.331) * (-392.614) (-389.988) [-393.213] (-392.400) -- 0:00:22
633000 -- (-389.498) (-391.080) (-393.712) [-391.233] * (-393.855) (-392.468) [-390.716] (-392.737) -- 0:00:22
633500 -- (-392.371) (-389.655) [-391.986] (-392.641) * (-390.416) [-393.626] (-393.057) (-391.697) -- 0:00:22
634000 -- (-394.420) (-391.711) [-391.268] (-391.645) * [-390.102] (-393.615) (-390.121) (-391.038) -- 0:00:22
634500 -- (-389.672) (-391.080) (-390.591) [-390.844] * (-391.035) (-390.747) [-391.919] (-395.083) -- 0:00:22
635000 -- (-392.937) (-390.979) (-391.904) [-392.877] * (-390.647) [-390.257] (-390.430) (-393.758) -- 0:00:22
Average standard deviation of split frequencies: 0.009548
635500 -- (-391.886) (-392.605) [-390.019] (-392.091) * (-390.908) (-389.603) (-394.812) [-390.102] -- 0:00:22
636000 -- (-390.276) [-392.518] (-389.877) (-389.919) * (-391.887) (-390.710) [-390.646] (-390.331) -- 0:00:22
636500 -- [-390.937] (-392.385) (-390.788) (-392.676) * (-389.132) (-390.625) (-390.996) [-390.609] -- 0:00:22
637000 -- (-395.023) [-392.569] (-390.550) (-390.455) * [-389.482] (-393.214) (-395.357) (-395.331) -- 0:00:22
637500 -- (-392.705) (-392.865) [-393.988] (-390.305) * (-392.964) [-390.530] (-391.182) (-391.755) -- 0:00:22
638000 -- (-390.206) (-391.499) (-394.686) [-392.830] * (-390.989) (-389.280) (-392.490) [-389.830] -- 0:00:22
638500 -- [-390.923] (-389.645) (-390.906) (-394.224) * (-389.841) [-389.630] (-390.478) (-390.077) -- 0:00:22
639000 -- (-391.506) (-395.207) (-392.100) [-394.618] * [-391.039] (-389.598) (-392.482) (-390.315) -- 0:00:22
639500 -- (-390.558) (-391.201) [-390.150] (-391.845) * (-390.894) [-391.678] (-392.667) (-391.406) -- 0:00:21
640000 -- (-395.333) [-391.105] (-389.923) (-392.330) * (-392.792) (-393.862) [-391.000] (-390.488) -- 0:00:21
Average standard deviation of split frequencies: 0.010128
640500 -- (-393.263) [-390.238] (-392.349) (-391.979) * (-390.670) (-390.839) [-392.560] (-390.671) -- 0:00:21
641000 -- (-389.365) (-391.761) (-391.614) [-391.423] * (-390.611) [-390.056] (-390.601) (-393.213) -- 0:00:21
641500 -- (-389.339) [-391.555] (-391.884) (-392.033) * [-390.910] (-392.153) (-390.420) (-393.029) -- 0:00:21
642000 -- [-389.419] (-390.936) (-394.159) (-391.687) * [-390.054] (-389.864) (-395.050) (-392.941) -- 0:00:21
642500 -- (-389.309) (-391.205) [-389.136] (-391.285) * (-390.675) (-390.176) [-392.672] (-394.124) -- 0:00:21
643000 -- (-390.402) [-390.147] (-391.438) (-393.178) * [-392.231] (-389.952) (-391.070) (-394.804) -- 0:00:21
643500 -- [-390.336] (-391.038) (-394.253) (-392.317) * (-393.963) (-391.419) [-389.111] (-397.321) -- 0:00:21
644000 -- (-393.128) [-390.855] (-391.936) (-392.127) * (-390.948) [-390.588] (-394.912) (-392.398) -- 0:00:21
644500 -- (-390.699) (-390.685) (-392.883) [-390.466] * (-392.534) (-392.894) [-391.661] (-391.246) -- 0:00:21
645000 -- (-389.765) (-395.496) (-392.395) [-390.901] * (-393.362) (-390.256) (-392.598) [-390.246] -- 0:00:21
Average standard deviation of split frequencies: 0.010419
645500 -- (-390.061) (-390.641) (-391.778) [-390.744] * (-392.220) (-391.636) (-392.810) [-392.364] -- 0:00:21
646000 -- (-392.389) (-390.362) [-391.511] (-402.290) * (-394.364) (-390.265) [-391.502] (-390.168) -- 0:00:21
646500 -- (-390.357) [-390.702] (-392.956) (-391.018) * [-392.728] (-392.496) (-391.526) (-389.902) -- 0:00:21
647000 -- (-390.460) (-391.077) (-394.230) [-392.653] * (-392.099) (-391.863) (-393.054) [-389.761] -- 0:00:21
647500 -- [-395.631] (-392.141) (-390.449) (-392.142) * [-391.974] (-391.126) (-391.018) (-392.082) -- 0:00:21
648000 -- [-393.060] (-389.593) (-392.407) (-395.596) * [-390.672] (-395.427) (-389.308) (-397.433) -- 0:00:21
648500 -- (-393.774) (-390.260) (-392.719) [-393.166] * (-392.900) [-390.697] (-389.455) (-390.246) -- 0:00:21
649000 -- (-392.207) [-392.806] (-392.403) (-391.675) * (-399.007) [-393.303] (-389.184) (-393.683) -- 0:00:21
649500 -- (-392.613) (-390.592) (-393.455) [-392.642] * (-390.916) [-390.471] (-389.389) (-391.947) -- 0:00:21
650000 -- (-390.772) (-389.731) (-394.912) [-390.585] * [-393.402] (-391.241) (-394.198) (-392.574) -- 0:00:21
Average standard deviation of split frequencies: 0.010612
650500 -- (-390.006) (-390.652) (-394.950) [-390.543] * (-392.996) [-391.434] (-392.022) (-390.539) -- 0:00:21
651000 -- (-389.323) [-392.618] (-391.127) (-394.207) * (-392.630) [-390.455] (-390.988) (-392.006) -- 0:00:21
651500 -- (-391.695) (-389.981) [-391.116] (-395.798) * (-391.985) [-390.171] (-391.798) (-389.144) -- 0:00:21
652000 -- (-391.854) [-389.679] (-389.903) (-394.203) * [-390.861] (-391.645) (-391.354) (-396.278) -- 0:00:21
652500 -- [-392.188] (-394.275) (-389.741) (-390.808) * (-391.491) (-391.283) [-389.726] (-391.890) -- 0:00:21
653000 -- (-390.887) (-394.979) (-390.782) [-390.358] * (-390.868) [-393.444] (-390.106) (-390.721) -- 0:00:21
653500 -- [-395.017] (-391.149) (-397.513) (-396.100) * [-391.267] (-391.595) (-389.461) (-391.055) -- 0:00:21
654000 -- (-393.737) (-392.415) [-391.221] (-390.288) * (-389.983) [-391.307] (-394.467) (-392.464) -- 0:00:21
654500 -- [-389.737] (-393.628) (-392.251) (-391.187) * (-391.098) [-390.663] (-392.158) (-389.702) -- 0:00:21
655000 -- (-392.071) [-390.412] (-392.067) (-394.560) * (-391.856) [-392.654] (-390.025) (-389.303) -- 0:00:21
Average standard deviation of split frequencies: 0.009297
655500 -- (-392.823) (-389.849) (-390.018) [-390.907] * (-391.989) (-392.838) [-390.311] (-396.823) -- 0:00:21
656000 -- (-390.167) [-389.587] (-389.379) (-392.702) * (-389.739) (-389.560) [-394.190] (-393.536) -- 0:00:20
656500 -- (-389.533) (-391.595) (-392.360) [-391.327] * (-390.701) [-389.728] (-394.091) (-391.592) -- 0:00:20
657000 -- (-391.616) [-391.025] (-390.411) (-390.420) * (-393.085) (-391.863) [-393.017] (-390.583) -- 0:00:20
657500 -- [-391.121] (-395.497) (-399.420) (-389.467) * (-391.381) [-389.856] (-392.377) (-391.705) -- 0:00:20
658000 -- (-389.715) [-391.946] (-392.008) (-393.624) * (-391.457) (-394.131) (-391.155) [-399.262] -- 0:00:20
658500 -- (-391.189) (-390.446) [-390.011] (-390.863) * (-391.668) (-392.751) [-391.432] (-394.939) -- 0:00:20
659000 -- (-391.012) (-389.829) [-390.664] (-391.477) * (-391.291) [-392.443] (-391.638) (-390.624) -- 0:00:20
659500 -- (-393.804) (-391.140) (-389.218) [-393.494] * (-392.232) [-390.241] (-394.476) (-391.408) -- 0:00:20
660000 -- (-392.016) (-389.986) [-389.637] (-394.250) * (-389.954) [-393.473] (-391.432) (-393.504) -- 0:00:20
Average standard deviation of split frequencies: 0.009053
660500 -- (-391.530) (-389.945) [-390.037] (-390.605) * (-392.396) (-390.316) (-402.488) [-397.044] -- 0:00:20
661000 -- [-391.749] (-389.952) (-392.233) (-391.621) * (-390.903) [-390.142] (-389.876) (-391.751) -- 0:00:20
661500 -- (-389.977) [-389.861] (-392.980) (-395.974) * [-393.836] (-390.217) (-391.988) (-391.804) -- 0:00:20
662000 -- (-395.179) [-392.117] (-394.019) (-391.938) * (-391.403) (-392.028) (-390.555) [-391.282] -- 0:00:20
662500 -- (-392.321) [-392.049] (-393.906) (-390.798) * (-393.650) (-389.511) [-391.656] (-395.951) -- 0:00:20
663000 -- [-389.975] (-390.948) (-393.632) (-390.734) * (-392.871) (-392.316) [-389.277] (-395.513) -- 0:00:20
663500 -- (-389.961) (-391.307) [-393.093] (-390.729) * (-389.509) (-395.168) [-390.464] (-389.746) -- 0:00:20
664000 -- (-392.134) [-390.919] (-392.353) (-390.972) * (-392.043) (-390.308) [-391.173] (-392.723) -- 0:00:20
664500 -- [-393.567] (-390.534) (-390.776) (-394.842) * (-396.225) [-390.661] (-392.387) (-391.896) -- 0:00:20
665000 -- (-389.655) [-389.908] (-393.456) (-390.375) * (-390.522) [-392.825] (-390.915) (-390.267) -- 0:00:20
Average standard deviation of split frequencies: 0.009511
665500 -- (-392.793) [-389.582] (-391.061) (-390.245) * [-392.814] (-389.518) (-391.762) (-393.202) -- 0:00:20
666000 -- (-390.347) (-392.130) [-390.646] (-396.172) * (-392.591) [-391.328] (-389.524) (-390.892) -- 0:00:20
666500 -- [-392.183] (-389.419) (-394.014) (-390.839) * (-393.662) (-390.077) [-389.239] (-392.079) -- 0:00:20
667000 -- [-391.828] (-393.011) (-389.906) (-391.979) * [-392.631] (-390.287) (-392.716) (-390.062) -- 0:00:20
667500 -- (-390.300) (-389.859) [-392.642] (-391.094) * [-395.561] (-393.235) (-392.416) (-393.367) -- 0:00:20
668000 -- (-390.309) (-391.196) (-391.626) [-389.117] * (-391.545) (-391.969) (-391.844) [-391.551] -- 0:00:20
668500 -- (-391.520) (-392.164) (-389.764) [-389.475] * [-390.275] (-391.404) (-391.835) (-394.881) -- 0:00:20
669000 -- (-392.059) (-396.967) [-390.365] (-390.836) * (-389.155) (-390.691) [-390.333] (-390.733) -- 0:00:20
669500 -- [-390.100] (-391.053) (-392.928) (-389.843) * (-389.341) [-391.102] (-390.960) (-390.817) -- 0:00:20
670000 -- (-390.229) (-390.367) (-396.089) [-391.825] * [-392.267] (-389.130) (-389.522) (-391.968) -- 0:00:20
Average standard deviation of split frequencies: 0.009401
670500 -- (-391.180) (-392.713) (-394.912) [-391.090] * (-390.898) (-390.260) (-391.879) [-392.061] -- 0:00:20
671000 -- [-392.896] (-389.505) (-392.996) (-391.100) * (-390.741) (-390.180) [-391.306] (-390.930) -- 0:00:20
671500 -- (-390.003) [-392.609] (-393.414) (-391.595) * (-391.442) [-392.203] (-392.656) (-392.023) -- 0:00:20
672000 -- (-391.746) [-391.020] (-392.280) (-389.246) * (-390.850) (-391.214) [-393.019] (-396.042) -- 0:00:20
672500 -- [-391.536] (-390.539) (-392.510) (-390.551) * (-396.794) (-390.935) [-391.376] (-391.361) -- 0:00:19
673000 -- [-393.696] (-393.076) (-389.283) (-390.543) * (-392.572) (-393.303) [-390.657] (-389.782) -- 0:00:19
673500 -- (-391.319) (-393.718) [-390.680] (-394.992) * (-389.255) (-390.501) (-392.272) [-390.080] -- 0:00:19
674000 -- [-390.330] (-391.428) (-396.293) (-393.882) * (-391.289) (-395.863) [-391.976] (-390.022) -- 0:00:19
674500 -- (-392.253) (-394.822) (-390.382) [-389.674] * (-391.425) (-394.524) [-394.752] (-391.080) -- 0:00:19
675000 -- (-391.449) (-392.070) [-391.220] (-389.937) * (-393.007) (-391.043) (-392.054) [-395.963] -- 0:00:19
Average standard deviation of split frequencies: 0.008848
675500 -- (-390.109) [-393.308] (-392.059) (-392.379) * (-394.738) (-396.086) [-392.340] (-398.554) -- 0:00:19
676000 -- (-390.318) (-394.228) (-392.091) [-394.517] * (-392.909) [-390.208] (-390.266) (-389.879) -- 0:00:19
676500 -- [-394.197] (-392.139) (-391.260) (-390.737) * (-394.461) (-391.178) (-392.370) [-390.115] -- 0:00:19
677000 -- (-393.971) (-392.029) [-389.503] (-392.718) * (-396.321) (-391.971) (-392.515) [-393.025] -- 0:00:19
677500 -- [-390.225] (-392.364) (-389.507) (-391.095) * [-391.863] (-390.686) (-391.232) (-390.958) -- 0:00:19
678000 -- (-392.946) (-392.516) [-390.225] (-393.715) * (-390.489) [-389.222] (-390.065) (-389.203) -- 0:00:19
678500 -- (-390.949) (-392.401) [-390.164] (-391.915) * (-395.058) (-389.984) [-392.564] (-390.881) -- 0:00:19
679000 -- (-393.836) [-390.727] (-390.391) (-394.268) * [-394.075] (-393.965) (-396.767) (-390.588) -- 0:00:19
679500 -- (-392.669) [-391.078] (-391.918) (-395.869) * (-392.944) (-395.122) (-392.559) [-394.501] -- 0:00:19
680000 -- (-391.012) [-392.393] (-391.888) (-393.432) * (-391.489) (-391.203) (-390.199) [-393.336] -- 0:00:19
Average standard deviation of split frequencies: 0.009220
680500 -- (-391.856) (-390.316) (-390.482) [-390.669] * [-389.897] (-391.271) (-391.456) (-397.757) -- 0:00:19
681000 -- (-392.237) [-396.117] (-391.982) (-390.019) * (-391.301) (-389.789) [-390.104] (-390.732) -- 0:00:19
681500 -- [-392.729] (-392.599) (-390.642) (-393.406) * (-391.959) (-390.105) (-390.606) [-391.908] -- 0:00:19
682000 -- (-392.294) [-392.047] (-391.970) (-393.030) * [-393.854] (-390.016) (-391.355) (-393.011) -- 0:00:19
682500 -- (-391.546) (-390.725) (-396.330) [-390.896] * (-395.210) (-389.829) [-389.671] (-392.405) -- 0:00:19
683000 -- (-392.718) [-392.951] (-392.312) (-390.053) * [-391.729] (-391.659) (-391.166) (-391.078) -- 0:00:19
683500 -- (-392.339) (-390.719) (-394.774) [-389.941] * (-390.071) (-390.338) (-391.398) [-391.371] -- 0:00:18
684000 -- (-391.779) (-392.452) (-393.672) [-390.371] * (-390.486) (-391.864) (-391.023) [-392.795] -- 0:00:19
684500 -- (-393.225) (-396.641) [-390.165] (-392.308) * [-392.872] (-392.023) (-391.849) (-391.263) -- 0:00:19
685000 -- [-396.595] (-390.997) (-390.589) (-391.740) * (-389.778) [-392.234] (-392.291) (-391.680) -- 0:00:19
Average standard deviation of split frequencies: 0.009105
685500 -- (-390.186) [-393.069] (-389.995) (-390.930) * [-390.567] (-392.389) (-392.165) (-392.463) -- 0:00:19
686000 -- [-393.540] (-391.029) (-395.296) (-392.066) * (-390.087) (-390.845) (-389.559) [-390.505] -- 0:00:19
686500 -- [-389.626] (-390.355) (-391.269) (-392.853) * (-389.530) (-389.765) [-391.231] (-392.935) -- 0:00:19
687000 -- (-390.011) (-390.305) (-392.052) [-395.824] * [-390.386] (-391.052) (-393.270) (-395.069) -- 0:00:19
687500 -- (-389.902) (-393.039) [-393.382] (-395.728) * (-390.624) [-392.945] (-391.582) (-393.022) -- 0:00:19
688000 -- (-389.832) (-391.202) [-390.733] (-393.837) * (-391.397) (-389.315) [-391.193] (-391.460) -- 0:00:19
688500 -- (-390.755) (-390.456) [-390.607] (-391.494) * (-393.203) [-391.203] (-389.517) (-389.762) -- 0:00:19
689000 -- (-392.098) (-389.822) [-390.413] (-395.392) * (-393.256) [-393.780] (-399.579) (-391.532) -- 0:00:18
689500 -- (-391.187) [-395.231] (-395.019) (-395.170) * [-389.514] (-389.818) (-396.111) (-393.291) -- 0:00:18
690000 -- (-395.380) (-395.816) (-393.846) [-390.625] * (-390.246) (-390.968) [-390.579] (-390.229) -- 0:00:18
Average standard deviation of split frequencies: 0.008532
690500 -- (-397.284) (-395.244) (-393.509) [-389.715] * (-389.553) (-391.707) [-394.524] (-389.952) -- 0:00:18
691000 -- (-393.325) (-393.371) (-392.021) [-389.366] * (-389.337) (-389.881) [-390.592] (-390.634) -- 0:00:18
691500 -- [-390.582] (-390.674) (-391.830) (-389.812) * (-389.999) [-391.193] (-394.086) (-391.460) -- 0:00:18
692000 -- (-393.502) [-389.853] (-392.365) (-389.336) * (-391.719) (-390.006) [-390.183] (-392.249) -- 0:00:18
692500 -- (-394.411) (-389.547) [-390.501] (-389.439) * [-392.748] (-395.806) (-391.735) (-393.415) -- 0:00:18
693000 -- (-390.366) (-390.373) [-390.326] (-390.749) * [-393.035] (-398.741) (-396.837) (-390.238) -- 0:00:18
693500 -- (-390.325) [-391.360] (-390.994) (-390.569) * (-390.078) [-391.770] (-395.108) (-389.305) -- 0:00:18
694000 -- [-392.209] (-390.921) (-394.615) (-393.304) * (-392.290) (-392.704) [-392.150] (-390.476) -- 0:00:18
694500 -- (-391.951) (-392.819) [-395.476] (-392.496) * (-393.363) [-392.637] (-391.941) (-391.303) -- 0:00:18
695000 -- [-393.771] (-393.048) (-389.531) (-393.472) * [-390.524] (-391.703) (-391.287) (-393.293) -- 0:00:18
Average standard deviation of split frequencies: 0.008297
695500 -- [-395.672] (-391.406) (-392.432) (-391.607) * (-390.804) [-390.394] (-390.065) (-390.822) -- 0:00:18
696000 -- (-396.744) (-395.130) [-392.011] (-390.308) * (-389.912) [-390.802] (-389.132) (-394.778) -- 0:00:18
696500 -- (-398.746) [-391.509] (-390.100) (-390.102) * (-389.592) (-393.216) (-393.834) [-390.058] -- 0:00:18
697000 -- (-394.900) [-392.694] (-391.121) (-395.612) * [-391.717] (-390.239) (-390.939) (-389.568) -- 0:00:18
697500 -- (-391.821) (-394.625) (-392.284) [-390.993] * (-389.315) (-392.064) (-390.332) [-390.509] -- 0:00:18
698000 -- (-391.261) [-389.388] (-390.133) (-394.471) * (-392.474) (-392.436) (-390.307) [-392.146] -- 0:00:18
698500 -- [-392.818] (-389.762) (-390.364) (-392.445) * (-393.517) (-391.298) [-389.410] (-394.703) -- 0:00:18
699000 -- (-392.720) [-392.581] (-391.036) (-395.157) * (-392.161) (-391.090) (-392.626) [-393.541] -- 0:00:18
699500 -- (-392.323) [-392.289] (-389.762) (-390.593) * (-391.048) (-390.274) [-392.502] (-390.333) -- 0:00:18
700000 -- (-393.618) (-392.994) [-389.902] (-392.283) * (-389.362) (-390.834) [-392.211] (-391.772) -- 0:00:18
Average standard deviation of split frequencies: 0.008031
700500 -- [-391.368] (-391.179) (-390.688) (-390.888) * (-390.309) [-391.136] (-392.323) (-391.525) -- 0:00:18
701000 -- (-393.544) [-390.065] (-391.191) (-389.411) * (-389.969) (-390.960) (-391.007) [-389.698] -- 0:00:18
701500 -- [-390.938] (-390.317) (-392.225) (-392.684) * (-392.057) (-391.894) (-393.803) [-390.777] -- 0:00:18
702000 -- [-392.688] (-389.626) (-392.048) (-390.810) * (-391.406) [-390.776] (-390.713) (-391.694) -- 0:00:18
702500 -- (-395.303) (-392.127) [-390.590] (-391.396) * (-391.480) (-392.027) (-390.468) [-390.147] -- 0:00:18
703000 -- (-392.561) [-389.981] (-391.517) (-394.666) * (-391.219) (-392.655) (-389.690) [-391.781] -- 0:00:18
703500 -- (-392.170) [-391.416] (-390.703) (-392.212) * (-391.211) [-390.011] (-389.397) (-394.352) -- 0:00:18
704000 -- (-392.156) [-393.808] (-389.668) (-390.033) * [-389.572] (-390.908) (-390.251) (-391.127) -- 0:00:18
704500 -- (-395.819) [-390.303] (-392.727) (-392.029) * (-390.432) [-390.534] (-391.034) (-391.289) -- 0:00:18
705000 -- (-394.130) (-391.427) [-392.468] (-392.607) * [-390.049] (-392.489) (-393.421) (-391.261) -- 0:00:17
Average standard deviation of split frequencies: 0.008096
705500 -- (-391.080) (-395.962) (-391.197) [-393.827] * [-389.217] (-392.795) (-389.929) (-390.080) -- 0:00:17
706000 -- (-389.478) [-393.124] (-393.937) (-390.120) * (-392.585) (-391.123) [-390.568] (-390.921) -- 0:00:17
706500 -- (-391.643) [-389.431] (-391.288) (-390.229) * (-391.687) [-389.404] (-391.719) (-392.657) -- 0:00:17
707000 -- (-394.441) (-389.884) (-390.038) [-394.583] * [-392.404] (-390.030) (-392.670) (-390.268) -- 0:00:17
707500 -- (-393.791) (-389.661) (-392.591) [-390.061] * [-391.244] (-391.160) (-396.440) (-395.436) -- 0:00:17
708000 -- [-390.871] (-394.682) (-397.473) (-391.414) * (-392.340) (-392.944) [-389.432] (-390.242) -- 0:00:17
708500 -- [-390.164] (-394.345) (-392.561) (-392.927) * [-391.135] (-393.640) (-394.508) (-390.626) -- 0:00:17
709000 -- [-389.770] (-393.666) (-399.192) (-391.967) * (-392.022) (-391.761) (-391.925) [-391.810] -- 0:00:17
709500 -- (-390.232) [-391.769] (-392.371) (-391.552) * (-391.727) (-392.556) [-390.128] (-396.274) -- 0:00:17
710000 -- (-389.904) [-390.126] (-389.871) (-389.730) * (-394.088) [-393.443] (-392.188) (-396.344) -- 0:00:17
Average standard deviation of split frequencies: 0.007753
710500 -- [-390.807] (-389.704) (-391.811) (-391.844) * (-392.171) [-389.978] (-391.923) (-390.392) -- 0:00:17
711000 -- (-390.729) (-392.905) [-389.847] (-394.606) * (-392.070) [-392.724] (-391.401) (-390.377) -- 0:00:17
711500 -- (-392.094) (-389.336) [-389.059] (-391.249) * [-392.084] (-390.912) (-390.089) (-390.025) -- 0:00:17
712000 -- (-392.889) (-392.719) (-391.503) [-393.088] * (-392.696) (-391.598) [-390.786] (-389.734) -- 0:00:17
712500 -- (-390.425) [-390.635] (-390.905) (-390.564) * [-389.781] (-389.450) (-393.369) (-391.195) -- 0:00:17
713000 -- (-392.115) (-393.619) (-390.134) [-389.589] * (-391.389) [-389.626] (-390.894) (-389.709) -- 0:00:17
713500 -- [-393.147] (-395.140) (-389.916) (-389.346) * (-391.246) (-393.008) (-390.401) [-389.395] -- 0:00:17
714000 -- [-393.482] (-392.200) (-391.635) (-389.867) * (-392.015) (-390.117) [-390.014] (-390.023) -- 0:00:17
714500 -- (-390.378) (-389.860) (-392.374) [-390.192] * (-392.343) [-390.283] (-390.677) (-394.650) -- 0:00:17
715000 -- (-394.532) [-391.361] (-390.598) (-389.978) * (-392.187) (-397.468) [-394.973] (-392.352) -- 0:00:17
Average standard deviation of split frequencies: 0.007448
715500 -- [-390.038] (-391.770) (-391.756) (-391.159) * (-389.855) (-390.878) [-392.889] (-390.759) -- 0:00:17
716000 -- (-391.517) (-390.559) [-392.632] (-390.537) * [-391.222] (-394.554) (-393.354) (-390.731) -- 0:00:17
716500 -- [-391.791] (-392.134) (-393.186) (-389.904) * (-391.453) (-392.475) [-390.131] (-391.313) -- 0:00:17
717000 -- [-389.779] (-390.711) (-393.520) (-391.437) * (-392.439) [-390.698] (-390.432) (-389.485) -- 0:00:16
717500 -- (-391.068) [-390.052] (-394.727) (-393.884) * (-389.094) (-391.445) (-390.823) [-392.411] -- 0:00:16
718000 -- [-390.601] (-392.447) (-391.409) (-392.034) * (-394.360) (-395.523) (-392.580) [-395.154] -- 0:00:17
718500 -- (-392.048) (-392.378) (-393.278) [-390.558] * [-393.764] (-396.202) (-389.963) (-391.694) -- 0:00:17
719000 -- (-392.688) [-390.431] (-391.051) (-390.277) * [-392.155] (-392.836) (-390.373) (-394.768) -- 0:00:17
719500 -- (-394.585) (-391.544) [-391.242] (-390.402) * (-391.231) [-391.848] (-389.747) (-389.681) -- 0:00:17
720000 -- (-389.498) (-389.758) [-389.653] (-390.241) * [-393.386] (-390.618) (-393.642) (-391.147) -- 0:00:17
Average standard deviation of split frequencies: 0.007277
720500 -- (-391.302) [-389.732] (-390.353) (-391.329) * [-390.420] (-389.959) (-391.923) (-390.745) -- 0:00:17
721000 -- (-393.090) (-390.292) (-392.927) [-390.142] * (-394.519) (-389.481) (-393.103) [-389.938] -- 0:00:17
721500 -- (-392.928) [-389.349] (-389.631) (-391.026) * (-389.455) [-390.012] (-390.811) (-392.359) -- 0:00:16
722000 -- (-391.072) (-392.577) [-389.547] (-390.618) * (-392.665) [-390.371] (-392.545) (-395.032) -- 0:00:16
722500 -- (-390.284) (-390.489) [-389.984] (-390.848) * (-390.809) (-391.149) (-389.978) [-390.643] -- 0:00:16
723000 -- [-391.604] (-390.789) (-391.556) (-393.252) * (-392.301) [-391.447] (-390.036) (-390.647) -- 0:00:16
723500 -- (-390.941) (-392.141) (-389.710) [-397.293] * (-394.913) (-391.096) (-393.738) [-390.796] -- 0:00:16
724000 -- [-389.604] (-390.224) (-389.566) (-394.792) * (-393.774) (-395.452) [-392.121] (-392.111) -- 0:00:16
724500 -- (-393.522) [-390.480] (-393.535) (-392.583) * (-393.250) (-395.940) (-391.054) [-390.705] -- 0:00:16
725000 -- (-391.138) (-390.840) [-391.190] (-390.504) * (-395.065) [-393.074] (-389.558) (-393.084) -- 0:00:16
Average standard deviation of split frequencies: 0.007548
725500 -- (-392.533) (-390.065) (-390.554) [-394.245] * (-392.595) (-389.706) [-390.465] (-391.209) -- 0:00:16
726000 -- (-392.908) (-391.369) (-390.612) [-397.297] * (-396.846) [-390.194] (-391.638) (-389.396) -- 0:00:16
726500 -- (-395.475) (-393.649) (-392.050) [-392.250] * [-391.227] (-391.875) (-390.592) (-389.772) -- 0:00:16
727000 -- (-393.896) (-391.989) [-390.405] (-390.954) * (-393.246) [-390.898] (-389.554) (-391.985) -- 0:00:16
727500 -- [-391.670] (-390.616) (-391.042) (-390.780) * (-390.575) [-390.934] (-394.360) (-393.317) -- 0:00:16
728000 -- (-392.492) [-389.762] (-390.997) (-391.662) * [-389.417] (-394.789) (-392.298) (-391.596) -- 0:00:16
728500 -- (-390.172) (-391.642) [-393.132] (-394.025) * (-389.589) (-392.308) (-392.238) [-393.458] -- 0:00:16
729000 -- [-391.634] (-392.270) (-390.922) (-392.945) * (-390.932) (-389.912) [-392.135] (-394.965) -- 0:00:16
729500 -- [-393.605] (-392.376) (-390.303) (-389.675) * (-392.123) [-391.083] (-391.991) (-393.757) -- 0:00:16
730000 -- (-401.351) (-393.225) [-389.690] (-390.443) * (-394.186) (-396.823) (-391.499) [-391.322] -- 0:00:16
Average standard deviation of split frequencies: 0.007863
730500 -- (-394.176) (-390.382) (-390.547) [-390.194] * (-393.359) [-390.885] (-392.441) (-394.780) -- 0:00:16
731000 -- (-395.832) (-396.123) (-392.821) [-389.635] * [-391.016] (-389.809) (-389.970) (-391.035) -- 0:00:16
731500 -- (-395.153) [-390.406] (-391.541) (-390.929) * (-391.602) [-390.169] (-392.731) (-389.889) -- 0:00:16
732000 -- (-395.477) (-392.225) [-390.903] (-391.978) * [-390.075] (-391.604) (-389.095) (-394.349) -- 0:00:16
732500 -- (-390.982) [-391.810] (-392.126) (-390.065) * (-392.599) (-390.551) [-391.460] (-392.602) -- 0:00:16
733000 -- (-389.993) (-390.380) (-393.466) [-390.874] * [-391.887] (-389.913) (-389.476) (-396.166) -- 0:00:16
733500 -- (-399.453) (-389.942) (-391.031) [-393.391] * (-390.212) (-390.002) [-389.310] (-393.903) -- 0:00:15
734000 -- (-391.406) (-389.993) (-391.754) [-392.780] * (-390.580) (-389.525) (-393.645) [-390.497] -- 0:00:15
734500 -- (-392.522) (-392.496) [-391.233] (-392.603) * (-390.359) [-392.132] (-393.452) (-390.415) -- 0:00:15
735000 -- (-392.209) (-392.839) [-391.213] (-391.956) * (-391.564) (-390.443) (-391.185) [-390.998] -- 0:00:15
Average standard deviation of split frequencies: 0.007806
735500 -- [-389.548] (-393.712) (-391.409) (-390.444) * (-389.548) (-390.520) (-394.642) [-389.365] -- 0:00:16
736000 -- (-392.574) (-389.416) (-393.667) [-391.288] * (-391.186) (-391.373) [-390.746] (-391.289) -- 0:00:16
736500 -- (-391.528) (-391.331) [-393.315] (-391.069) * [-393.138] (-395.408) (-393.517) (-389.282) -- 0:00:16
737000 -- (-390.599) (-389.593) [-395.097] (-395.153) * [-390.560] (-396.209) (-389.817) (-391.208) -- 0:00:16
737500 -- [-391.615] (-391.144) (-393.785) (-391.011) * (-390.658) (-393.232) [-389.092] (-389.895) -- 0:00:16
738000 -- [-394.223] (-390.142) (-393.485) (-391.127) * (-390.953) (-390.678) (-391.621) [-391.471] -- 0:00:15
738500 -- (-393.508) [-391.924] (-391.006) (-397.571) * (-393.495) (-391.928) [-390.463] (-390.022) -- 0:00:15
739000 -- (-391.133) [-395.173] (-392.123) (-391.615) * (-391.617) (-391.345) (-392.869) [-390.306] -- 0:00:15
739500 -- [-393.327] (-390.228) (-389.636) (-392.604) * (-389.945) [-391.532] (-393.802) (-391.691) -- 0:00:15
740000 -- (-393.116) (-391.746) [-390.504] (-391.965) * [-392.217] (-393.789) (-392.110) (-390.141) -- 0:00:15
Average standard deviation of split frequencies: 0.007638
740500 -- (-391.135) [-392.132] (-390.183) (-394.008) * [-389.381] (-395.535) (-391.225) (-391.228) -- 0:00:15
741000 -- (-391.324) (-390.437) [-390.251] (-393.667) * [-390.145] (-393.769) (-390.546) (-394.957) -- 0:00:15
741500 -- (-389.741) (-393.179) (-390.038) [-392.209] * [-392.281] (-393.109) (-390.351) (-391.695) -- 0:00:15
742000 -- (-390.514) [-391.413] (-391.499) (-393.231) * [-391.993] (-392.239) (-394.580) (-394.252) -- 0:00:15
742500 -- (-391.408) [-390.672] (-391.586) (-390.843) * (-392.745) (-394.614) (-396.971) [-390.232] -- 0:00:15
743000 -- (-393.530) [-391.387] (-389.833) (-391.940) * (-392.214) [-395.879] (-390.593) (-389.910) -- 0:00:15
743500 -- (-394.013) (-390.332) (-391.212) [-392.442] * (-390.369) (-393.880) (-389.981) [-392.070] -- 0:00:15
744000 -- (-393.962) [-391.054] (-392.102) (-390.890) * (-390.967) (-394.660) (-391.412) [-391.031] -- 0:00:15
744500 -- (-388.957) (-390.686) (-391.176) [-391.739] * (-393.531) (-392.136) (-390.768) [-390.718] -- 0:00:15
745000 -- (-389.394) [-391.810] (-391.893) (-393.646) * (-392.923) [-395.180] (-390.503) (-389.787) -- 0:00:15
Average standard deviation of split frequencies: 0.008257
745500 -- (-389.253) [-391.880] (-391.666) (-389.071) * [-391.789] (-392.682) (-390.874) (-391.378) -- 0:00:15
746000 -- (-391.543) [-390.798] (-390.486) (-391.119) * (-392.664) (-391.662) [-392.548] (-390.278) -- 0:00:15
746500 -- [-392.847] (-390.717) (-392.850) (-389.791) * (-394.217) (-398.894) [-395.331] (-391.940) -- 0:00:15
747000 -- [-389.842] (-391.304) (-393.814) (-391.046) * (-390.474) [-391.651] (-392.260) (-392.898) -- 0:00:15
747500 -- (-394.580) (-391.383) (-389.572) [-391.143] * (-390.255) (-390.414) [-393.558] (-393.860) -- 0:00:15
748000 -- (-392.702) (-392.105) (-392.985) [-392.292] * (-393.199) (-392.779) [-389.875] (-391.769) -- 0:00:15
748500 -- [-391.532] (-392.300) (-393.363) (-390.517) * (-391.523) (-389.054) [-391.960] (-390.544) -- 0:00:15
749000 -- [-392.285] (-390.077) (-391.318) (-390.443) * (-390.958) [-394.219] (-390.380) (-390.200) -- 0:00:15
749500 -- (-391.390) (-391.672) [-389.910] (-389.389) * (-393.070) [-392.327] (-391.752) (-392.802) -- 0:00:15
750000 -- [-390.729] (-396.371) (-392.816) (-392.264) * (-394.829) (-392.051) [-390.399] (-394.098) -- 0:00:15
Average standard deviation of split frequencies: 0.008331
750500 -- (-390.991) (-395.203) (-392.669) [-393.530] * (-391.881) (-391.810) [-390.770] (-394.037) -- 0:00:14
751000 -- (-392.075) (-392.496) (-391.197) [-391.478] * [-390.125] (-393.232) (-391.958) (-394.642) -- 0:00:14
751500 -- (-390.998) [-394.918] (-391.249) (-389.608) * (-390.155) [-390.295] (-392.325) (-394.086) -- 0:00:14
752000 -- (-389.385) (-390.566) (-395.762) [-389.960] * [-390.852] (-393.414) (-391.206) (-392.700) -- 0:00:14
752500 -- [-389.374] (-393.900) (-390.075) (-391.198) * (-389.173) (-392.295) [-389.821] (-391.402) -- 0:00:15
753000 -- (-391.627) (-398.449) (-392.438) [-390.366] * (-389.384) (-390.917) [-391.416] (-393.251) -- 0:00:15
753500 -- [-391.025] (-391.469) (-394.073) (-392.164) * (-389.330) (-393.233) [-392.536] (-392.041) -- 0:00:15
754000 -- (-390.352) (-395.936) (-398.898) [-389.758] * (-391.425) (-391.291) [-393.230] (-393.848) -- 0:00:15
754500 -- (-389.687) [-390.520] (-390.630) (-390.451) * (-395.757) [-390.803] (-391.513) (-392.595) -- 0:00:14
755000 -- (-391.020) (-390.207) [-390.312] (-394.418) * (-392.342) (-391.896) [-389.890] (-390.057) -- 0:00:14
Average standard deviation of split frequencies: 0.008065
755500 -- (-391.590) (-390.650) [-391.912] (-390.263) * (-389.580) (-390.342) (-390.560) [-391.018] -- 0:00:14
756000 -- (-390.513) (-390.824) [-395.000] (-389.935) * [-391.057] (-391.906) (-392.485) (-390.642) -- 0:00:14
756500 -- (-389.612) (-389.952) (-391.026) [-391.880] * (-394.619) (-394.133) (-392.301) [-389.258] -- 0:00:14
757000 -- (-390.841) (-391.624) (-391.140) [-390.521] * (-395.567) (-392.795) (-389.865) [-390.233] -- 0:00:14
757500 -- (-392.106) [-389.745] (-390.985) (-390.280) * (-394.609) (-391.515) [-390.113] (-390.770) -- 0:00:14
758000 -- (-390.007) (-395.667) (-389.952) [-391.532] * [-396.819] (-391.578) (-390.668) (-390.100) -- 0:00:14
758500 -- [-395.253] (-391.362) (-389.538) (-391.782) * (-390.276) (-390.884) (-392.384) [-390.391] -- 0:00:14
759000 -- [-390.475] (-393.219) (-392.454) (-391.926) * (-389.750) (-390.185) (-391.031) [-390.602] -- 0:00:14
759500 -- [-390.929] (-391.327) (-393.075) (-393.967) * [-392.746] (-390.119) (-390.447) (-389.607) -- 0:00:14
760000 -- (-394.562) (-391.968) (-389.784) [-392.350] * (-391.357) [-391.885] (-389.255) (-390.786) -- 0:00:14
Average standard deviation of split frequencies: 0.007602
760500 -- (-393.479) (-392.552) (-390.182) [-390.067] * (-391.743) [-399.178] (-390.086) (-393.736) -- 0:00:14
761000 -- (-389.310) (-390.226) [-395.050] (-391.470) * [-390.121] (-392.332) (-389.442) (-390.260) -- 0:00:14
761500 -- (-391.446) (-391.594) (-391.696) [-390.504] * [-389.748] (-398.170) (-390.874) (-394.806) -- 0:00:14
762000 -- (-391.419) (-391.506) [-390.533] (-391.521) * (-389.899) (-391.597) [-390.758] (-389.545) -- 0:00:14
762500 -- (-392.715) (-391.501) [-391.151] (-390.624) * (-390.749) [-389.085] (-389.775) (-390.174) -- 0:00:14
763000 -- (-393.609) [-391.832] (-391.225) (-392.102) * (-390.788) (-389.170) [-393.607] (-390.380) -- 0:00:14
763500 -- (-391.769) (-389.749) [-392.148] (-389.758) * (-394.435) (-391.811) [-390.582] (-390.294) -- 0:00:14
764000 -- (-390.938) (-389.692) (-394.232) [-389.908] * (-394.087) (-389.017) [-393.250] (-390.312) -- 0:00:14
764500 -- (-391.754) (-391.956) [-391.552] (-396.244) * (-390.241) (-389.765) (-390.373) [-390.597] -- 0:00:14
765000 -- [-390.864] (-394.210) (-391.957) (-389.788) * (-391.258) [-389.769] (-390.508) (-391.135) -- 0:00:14
Average standard deviation of split frequencies: 0.007836
765500 -- [-391.267] (-392.230) (-389.344) (-391.133) * (-395.375) (-390.622) [-390.026] (-392.833) -- 0:00:14
766000 -- (-390.850) [-390.393] (-392.733) (-391.718) * [-390.811] (-393.241) (-390.614) (-396.595) -- 0:00:14
766500 -- (-392.245) (-392.417) (-391.167) [-389.432] * [-391.347] (-391.590) (-390.755) (-392.808) -- 0:00:14
767000 -- (-390.738) [-392.834] (-393.329) (-394.267) * [-396.392] (-392.668) (-391.611) (-389.180) -- 0:00:13
767500 -- (-391.901) [-393.948] (-392.880) (-392.503) * (-390.957) (-394.273) (-392.055) [-390.444] -- 0:00:13
768000 -- (-391.270) (-393.544) (-392.560) [-393.753] * (-390.752) [-392.374] (-398.277) (-392.882) -- 0:00:13
768500 -- (-392.995) (-390.246) (-391.095) [-392.577] * [-391.864] (-391.577) (-390.287) (-391.089) -- 0:00:13
769000 -- (-391.058) (-390.257) (-389.670) [-391.889] * (-395.479) (-390.290) (-390.560) [-393.302] -- 0:00:13
769500 -- (-390.398) (-389.778) (-389.662) [-392.072] * [-395.048] (-390.326) (-390.052) (-392.040) -- 0:00:14
770000 -- [-391.751] (-391.550) (-389.700) (-395.056) * (-390.634) [-392.149] (-390.355) (-389.155) -- 0:00:14
Average standard deviation of split frequencies: 0.008400
770500 -- (-395.518) [-394.718] (-390.996) (-390.985) * (-394.378) (-390.962) [-393.265] (-393.597) -- 0:00:13
771000 -- [-390.407] (-390.806) (-390.779) (-390.912) * [-391.812] (-393.877) (-390.234) (-394.255) -- 0:00:13
771500 -- (-393.882) [-395.150] (-390.321) (-393.028) * (-391.026) (-389.182) (-392.737) [-392.730] -- 0:00:13
772000 -- (-392.624) (-391.426) (-390.043) [-389.921] * [-391.373] (-389.660) (-395.954) (-391.483) -- 0:00:13
772500 -- (-391.284) (-392.648) (-389.948) [-389.468] * (-391.048) [-390.468] (-396.118) (-389.864) -- 0:00:13
773000 -- (-389.497) [-389.902] (-392.137) (-389.213) * (-393.212) [-394.108] (-391.529) (-391.111) -- 0:00:13
773500 -- [-391.221] (-390.186) (-391.502) (-389.212) * (-391.115) (-389.741) (-394.683) [-391.434] -- 0:00:13
774000 -- (-391.263) (-389.804) [-390.863] (-392.098) * (-391.217) (-393.659) [-389.875] (-394.413) -- 0:00:13
774500 -- (-393.748) [-391.551] (-389.714) (-391.922) * [-391.153] (-392.151) (-391.076) (-391.451) -- 0:00:13
775000 -- [-395.228] (-391.892) (-389.675) (-392.992) * [-394.642] (-389.703) (-392.176) (-390.957) -- 0:00:13
Average standard deviation of split frequencies: 0.008788
775500 -- (-393.038) (-391.978) [-390.010] (-393.804) * (-391.506) [-390.470] (-391.837) (-391.718) -- 0:00:13
776000 -- (-393.004) (-392.865) [-391.135] (-390.904) * [-391.947] (-391.181) (-390.191) (-390.612) -- 0:00:13
776500 -- [-392.140] (-392.163) (-391.466) (-390.267) * (-390.505) (-395.241) [-393.746] (-389.733) -- 0:00:13
777000 -- (-391.676) (-390.763) (-393.895) [-391.150] * (-389.414) [-392.538] (-394.235) (-391.364) -- 0:00:13
777500 -- (-390.099) (-389.654) [-390.775] (-391.609) * (-390.720) (-392.806) [-394.085] (-389.587) -- 0:00:13
778000 -- (-390.595) [-391.486] (-393.243) (-390.260) * (-393.769) [-390.410] (-394.636) (-389.440) -- 0:00:13
778500 -- (-396.878) [-393.801] (-389.640) (-391.680) * (-393.022) (-392.082) [-392.112] (-391.180) -- 0:00:13
779000 -- (-391.056) (-394.185) [-394.426] (-393.088) * (-392.028) (-391.277) (-391.634) [-389.532] -- 0:00:13
779500 -- (-390.206) (-390.625) (-392.209) [-390.347] * (-390.689) [-393.032] (-391.875) (-389.239) -- 0:00:13
780000 -- [-389.314] (-391.125) (-389.671) (-392.219) * (-392.194) [-390.144] (-391.008) (-390.693) -- 0:00:13
Average standard deviation of split frequencies: 0.008534
780500 -- [-389.761] (-392.385) (-391.446) (-389.743) * (-391.701) [-389.642] (-394.254) (-390.410) -- 0:00:13
781000 -- [-392.125] (-390.448) (-392.974) (-391.694) * [-393.586] (-389.913) (-391.479) (-395.072) -- 0:00:13
781500 -- [-389.603] (-391.821) (-392.705) (-389.948) * (-389.109) (-390.884) [-389.997] (-396.256) -- 0:00:13
782000 -- [-391.195] (-392.788) (-395.832) (-391.140) * [-393.864] (-389.540) (-391.103) (-392.781) -- 0:00:13
782500 -- (-392.937) [-389.525] (-392.025) (-389.778) * (-396.455) [-390.619] (-390.148) (-393.407) -- 0:00:13
783000 -- (-391.940) (-390.380) [-390.358] (-390.440) * (-393.608) (-390.263) (-393.498) [-390.479] -- 0:00:13
783500 -- (-393.235) (-391.510) (-392.776) [-394.320] * (-393.889) (-392.161) [-389.818] (-393.087) -- 0:00:12
784000 -- (-390.189) (-391.497) [-389.917] (-392.894) * (-392.217) (-393.386) (-391.155) [-390.534] -- 0:00:12
784500 -- (-390.766) (-393.826) [-392.513] (-391.264) * (-392.019) (-393.418) [-390.310] (-392.870) -- 0:00:12
785000 -- (-392.243) (-394.753) (-394.143) [-390.004] * (-392.342) (-393.830) (-391.887) [-389.246] -- 0:00:12
Average standard deviation of split frequencies: 0.008434
785500 -- (-389.839) (-390.962) (-391.998) [-390.149] * (-392.930) (-393.844) (-394.214) [-391.108] -- 0:00:12
786000 -- (-394.480) (-391.414) (-392.613) [-391.715] * (-393.633) (-394.494) [-399.055] (-389.866) -- 0:00:12
786500 -- [-390.566] (-389.155) (-392.566) (-389.940) * (-395.434) [-389.845] (-391.723) (-389.314) -- 0:00:13
787000 -- [-391.167] (-394.253) (-394.288) (-390.017) * (-393.260) (-393.097) [-391.516] (-391.247) -- 0:00:12
787500 -- [-390.078] (-390.167) (-392.487) (-392.594) * [-392.470] (-388.954) (-395.426) (-391.044) -- 0:00:12
788000 -- (-393.231) (-390.507) (-392.109) [-393.029] * (-393.584) [-389.883] (-394.182) (-392.174) -- 0:00:12
788500 -- (-398.792) (-391.048) [-392.421] (-391.434) * (-391.588) (-389.796) [-393.699] (-392.829) -- 0:00:12
789000 -- (-392.234) (-390.197) [-392.874] (-394.219) * [-395.569] (-389.738) (-393.298) (-395.298) -- 0:00:12
789500 -- (-394.049) (-390.157) (-391.195) [-391.674] * (-392.674) (-394.334) [-401.481] (-394.136) -- 0:00:12
790000 -- (-402.230) (-390.556) [-390.469] (-389.502) * (-389.191) (-393.520) (-394.520) [-395.388] -- 0:00:12
Average standard deviation of split frequencies: 0.008347
790500 -- (-392.284) (-389.860) [-389.852] (-392.824) * (-390.546) (-392.640) [-393.054] (-390.648) -- 0:00:12
791000 -- (-390.363) (-393.727) [-389.504] (-394.012) * (-390.526) (-392.841) (-390.906) [-392.496] -- 0:00:12
791500 -- (-392.940) (-394.509) [-391.294] (-390.392) * (-390.531) [-390.895] (-390.932) (-392.890) -- 0:00:12
792000 -- (-390.744) [-390.869] (-390.851) (-389.943) * (-394.316) (-392.507) [-390.874] (-390.967) -- 0:00:12
792500 -- (-391.802) (-390.657) (-390.892) [-395.734] * [-393.632] (-390.351) (-390.060) (-390.516) -- 0:00:12
793000 -- [-392.721] (-392.118) (-393.816) (-391.280) * (-390.993) (-391.449) [-393.309] (-392.760) -- 0:00:12
793500 -- [-392.571] (-392.381) (-389.763) (-392.723) * [-392.346] (-396.404) (-390.472) (-391.036) -- 0:00:12
794000 -- [-393.233] (-393.153) (-391.671) (-390.233) * (-390.853) (-390.999) (-390.981) [-389.974] -- 0:00:12
794500 -- [-390.829] (-392.897) (-394.298) (-395.259) * (-390.710) (-389.949) [-389.589] (-389.722) -- 0:00:12
795000 -- (-390.326) (-390.051) (-390.069) [-389.892] * (-392.407) (-390.057) (-392.562) [-397.565] -- 0:00:12
Average standard deviation of split frequencies: 0.008686
795500 -- (-394.153) (-392.449) (-390.616) [-390.868] * [-391.069] (-390.495) (-390.326) (-389.855) -- 0:00:12
796000 -- (-393.935) (-390.325) (-391.530) [-391.193] * (-391.330) (-391.265) (-392.427) [-389.179] -- 0:00:12
796500 -- (-390.388) (-389.948) (-395.010) [-391.267] * (-390.265) (-390.261) (-391.349) [-391.880] -- 0:00:12
797000 -- (-392.133) [-390.962] (-396.166) (-390.884) * [-389.837] (-392.444) (-392.850) (-390.740) -- 0:00:12
797500 -- (-393.980) [-392.165] (-394.018) (-394.012) * [-392.238] (-392.966) (-392.628) (-392.050) -- 0:00:12
798000 -- (-391.307) (-390.849) [-390.496] (-390.822) * [-394.076] (-390.309) (-390.490) (-390.926) -- 0:00:12
798500 -- (-393.712) (-389.120) [-391.029] (-393.612) * [-393.354] (-390.718) (-394.143) (-390.269) -- 0:00:12
799000 -- (-391.664) (-389.833) [-391.103] (-393.535) * (-391.099) (-390.972) [-390.745] (-393.507) -- 0:00:12
799500 -- (-392.770) (-391.102) (-395.878) [-390.207] * (-391.441) (-392.470) (-396.219) [-392.003] -- 0:00:12
800000 -- (-390.983) (-391.002) [-395.509] (-390.970) * (-393.433) (-390.481) [-396.896] (-392.685) -- 0:00:12
Average standard deviation of split frequencies: 0.008792
800500 -- (-393.543) [-392.023] (-390.144) (-397.524) * (-391.882) (-389.885) [-396.147] (-392.879) -- 0:00:11
801000 -- (-390.123) (-390.841) [-391.167] (-390.758) * (-390.376) [-391.384] (-397.546) (-389.048) -- 0:00:11
801500 -- (-393.075) (-389.457) (-391.688) [-389.489] * [-389.906] (-389.488) (-394.715) (-389.230) -- 0:00:11
802000 -- (-395.686) (-391.441) [-389.460] (-390.796) * (-394.389) [-390.245] (-392.870) (-391.830) -- 0:00:11
802500 -- (-397.756) [-391.095] (-390.757) (-393.671) * (-392.776) (-395.683) (-389.943) [-389.429] -- 0:00:11
803000 -- (-392.378) (-390.972) (-390.934) [-390.736] * [-389.921] (-397.013) (-390.588) (-391.467) -- 0:00:11
803500 -- (-391.814) (-391.742) (-393.025) [-392.350] * (-390.329) [-397.485] (-389.908) (-391.456) -- 0:00:11
804000 -- [-391.728] (-392.182) (-392.627) (-390.759) * (-389.593) [-391.359] (-389.854) (-389.558) -- 0:00:11
804500 -- [-389.218] (-391.403) (-390.033) (-396.155) * (-389.469) [-391.013] (-390.389) (-389.175) -- 0:00:11
805000 -- [-390.445] (-392.842) (-391.177) (-394.542) * (-390.670) (-391.584) (-390.365) [-390.274] -- 0:00:11
Average standard deviation of split frequencies: 0.008344
805500 -- [-393.267] (-392.407) (-391.083) (-393.128) * (-390.738) (-392.234) [-395.391] (-390.224) -- 0:00:11
806000 -- (-395.286) [-391.704] (-390.340) (-393.621) * (-390.918) [-389.024] (-390.512) (-389.857) -- 0:00:11
806500 -- (-390.036) (-392.117) [-390.330] (-394.496) * (-389.562) (-396.718) (-393.028) [-391.627] -- 0:00:11
807000 -- (-391.955) (-390.666) [-391.177] (-390.294) * (-391.762) [-392.783] (-393.613) (-392.670) -- 0:00:11
807500 -- (-393.559) [-391.544] (-393.608) (-392.431) * (-391.008) (-390.790) [-389.114] (-391.258) -- 0:00:11
808000 -- (-394.902) (-389.961) (-394.986) [-393.509] * (-391.528) (-393.373) [-389.160] (-391.335) -- 0:00:11
808500 -- (-393.047) (-389.915) [-397.806] (-392.426) * (-389.863) (-391.440) (-393.367) [-390.579] -- 0:00:11
809000 -- (-390.779) [-390.232] (-391.648) (-389.179) * (-391.395) [-389.640] (-390.842) (-389.548) -- 0:00:11
809500 -- (-390.946) (-391.580) (-391.093) [-391.751] * (-392.571) (-392.524) (-391.625) [-390.625] -- 0:00:11
810000 -- [-390.363] (-392.206) (-391.254) (-391.908) * (-392.627) (-392.795) (-390.808) [-390.155] -- 0:00:11
Average standard deviation of split frequencies: 0.007947
810500 -- (-392.238) [-393.652] (-393.146) (-395.015) * (-391.854) (-392.799) (-389.261) [-391.809] -- 0:00:11
811000 -- (-390.938) [-390.149] (-394.033) (-393.861) * (-391.254) (-390.427) (-397.376) [-390.084] -- 0:00:11
811500 -- (-397.962) [-390.154] (-393.672) (-395.526) * (-391.630) [-390.681] (-394.790) (-390.580) -- 0:00:11
812000 -- [-391.147] (-390.157) (-396.100) (-390.546) * [-392.611] (-390.022) (-390.882) (-391.724) -- 0:00:11
812500 -- (-392.096) [-395.895] (-392.859) (-394.700) * [-390.580] (-400.371) (-390.292) (-396.394) -- 0:00:11
813000 -- (-390.848) [-393.264] (-390.313) (-395.334) * [-389.810] (-391.682) (-390.358) (-391.285) -- 0:00:11
813500 -- (-391.156) (-395.326) [-390.476] (-390.789) * [-392.378] (-391.086) (-389.191) (-389.397) -- 0:00:11
814000 -- [-389.621] (-399.358) (-390.409) (-395.361) * (-391.623) (-390.677) [-393.317] (-390.937) -- 0:00:11
814500 -- [-391.726] (-390.293) (-394.629) (-390.340) * (-391.465) (-389.904) [-392.490] (-391.369) -- 0:00:11
815000 -- (-389.388) [-390.442] (-390.067) (-390.177) * (-391.191) [-390.763] (-390.882) (-391.998) -- 0:00:11
Average standard deviation of split frequencies: 0.008126
815500 -- [-390.748] (-391.916) (-390.688) (-389.684) * (-390.780) [-391.738] (-391.080) (-391.984) -- 0:00:11
816000 -- (-389.002) (-393.076) (-390.446) [-390.691] * [-389.998] (-392.031) (-391.947) (-392.648) -- 0:00:11
816500 -- (-390.333) (-393.513) (-390.133) [-391.228] * (-392.557) (-389.735) [-390.497] (-391.540) -- 0:00:11
817000 -- (-391.148) [-392.707] (-393.006) (-390.462) * (-389.958) (-390.049) [-389.729] (-393.587) -- 0:00:10
817500 -- (-392.619) [-391.118] (-389.919) (-392.777) * (-390.969) (-389.619) (-393.217) [-389.590] -- 0:00:10
818000 -- (-394.682) (-392.710) [-390.995] (-394.645) * [-391.107] (-392.048) (-389.587) (-390.831) -- 0:00:10
818500 -- (-405.115) (-389.611) (-390.864) [-392.454] * [-390.163] (-391.748) (-392.368) (-392.299) -- 0:00:10
819000 -- [-392.595] (-390.464) (-391.444) (-393.401) * [-392.614] (-395.489) (-393.744) (-390.664) -- 0:00:10
819500 -- (-391.238) (-392.260) (-390.739) [-391.515] * (-391.574) (-390.408) (-393.163) [-389.050] -- 0:00:10
820000 -- [-391.652] (-390.503) (-389.986) (-389.432) * [-391.025] (-389.621) (-391.018) (-390.202) -- 0:00:10
Average standard deviation of split frequencies: 0.008425
820500 -- (-395.951) (-389.496) (-390.100) [-389.551] * [-390.393] (-391.418) (-392.275) (-391.222) -- 0:00:10
821000 -- [-391.382] (-392.816) (-393.653) (-391.632) * (-389.837) (-392.478) (-390.996) [-391.344] -- 0:00:10
821500 -- (-393.702) (-394.247) (-393.127) [-391.767] * (-392.024) (-389.734) [-390.250] (-393.183) -- 0:00:10
822000 -- (-394.862) [-393.448] (-392.939) (-392.797) * [-394.163] (-391.212) (-394.517) (-392.665) -- 0:00:10
822500 -- [-390.667] (-394.980) (-389.695) (-390.915) * (-391.732) [-390.286] (-391.611) (-394.097) -- 0:00:10
823000 -- (-391.047) [-391.671] (-393.310) (-392.478) * (-391.184) (-393.062) [-393.411] (-392.012) -- 0:00:10
823500 -- (-393.020) [-389.392] (-391.104) (-396.647) * (-393.209) (-389.465) (-391.767) [-391.513] -- 0:00:10
824000 -- (-389.184) (-393.402) [-391.526] (-390.812) * (-391.250) [-391.464] (-390.926) (-391.178) -- 0:00:10
824500 -- (-389.500) (-389.877) (-392.948) [-392.619] * [-396.341] (-389.810) (-396.366) (-390.182) -- 0:00:10
825000 -- (-391.101) (-389.675) (-391.158) [-391.658] * (-392.938) [-393.448] (-393.424) (-390.036) -- 0:00:10
Average standard deviation of split frequencies: 0.008294
825500 -- (-390.600) [-392.966] (-389.732) (-391.281) * (-390.199) (-390.389) (-391.453) [-393.780] -- 0:00:10
826000 -- [-390.175] (-390.129) (-392.934) (-389.198) * (-394.362) (-389.393) [-392.303] (-394.862) -- 0:00:10
826500 -- (-390.898) (-389.374) (-392.412) [-392.414] * (-392.974) (-390.375) (-389.688) [-394.664] -- 0:00:10
827000 -- (-393.066) (-390.445) [-391.147] (-392.695) * (-394.945) (-391.222) [-390.806] (-391.244) -- 0:00:10
827500 -- (-390.430) (-391.007) [-393.059] (-389.062) * (-394.276) (-390.935) [-390.465] (-392.089) -- 0:00:10
828000 -- (-390.628) [-391.560] (-389.889) (-392.732) * (-392.821) [-390.132] (-392.529) (-391.574) -- 0:00:10
828500 -- (-392.177) [-389.495] (-390.800) (-392.263) * (-395.334) (-390.208) [-390.521] (-393.884) -- 0:00:10
829000 -- (-396.455) (-389.834) (-398.355) [-389.676] * (-393.379) [-394.210] (-390.762) (-391.746) -- 0:00:10
829500 -- (-397.263) (-391.398) (-390.198) [-390.216] * [-392.846] (-392.741) (-390.872) (-390.251) -- 0:00:10
830000 -- (-392.186) (-395.091) (-391.076) [-392.459] * (-391.403) (-390.072) (-392.677) [-392.326] -- 0:00:10
Average standard deviation of split frequencies: 0.008399
830500 -- [-392.411] (-392.561) (-391.442) (-389.843) * (-390.806) (-392.980) (-392.678) [-390.838] -- 0:00:10
831000 -- (-391.001) (-394.206) (-393.549) [-389.165] * [-395.126] (-396.755) (-392.782) (-390.082) -- 0:00:10
831500 -- (-393.109) [-394.073] (-389.720) (-389.290) * [-390.540] (-389.965) (-391.689) (-393.765) -- 0:00:10
832000 -- (-398.596) (-393.429) [-393.502] (-390.311) * (-390.749) (-390.683) [-389.542] (-394.409) -- 0:00:10
832500 -- (-398.841) (-391.435) (-391.015) [-389.684] * (-392.136) [-393.486] (-394.088) (-394.385) -- 0:00:10
833000 -- [-389.815] (-393.615) (-392.059) (-391.420) * (-391.795) (-389.097) (-391.126) [-392.118] -- 0:00:10
833500 -- (-392.977) (-397.306) (-390.062) [-389.594] * (-390.721) (-390.524) (-393.502) [-390.634] -- 0:00:09
834000 -- (-389.792) (-393.265) [-390.556] (-390.102) * (-389.997) [-390.409] (-393.517) (-396.568) -- 0:00:09
834500 -- (-390.249) (-390.031) (-391.603) [-391.915] * [-390.584] (-390.693) (-391.436) (-393.823) -- 0:00:09
835000 -- (-391.274) [-391.604] (-392.781) (-391.042) * (-393.116) (-394.794) (-392.723) [-391.067] -- 0:00:09
Average standard deviation of split frequencies: 0.008759
835500 -- (-391.149) (-392.847) (-390.539) [-390.014] * [-391.742] (-393.053) (-392.728) (-391.115) -- 0:00:09
836000 -- (-394.136) (-393.860) (-392.522) [-390.286] * (-389.268) [-390.117] (-390.783) (-389.267) -- 0:00:09
836500 -- [-391.295] (-391.280) (-393.625) (-393.148) * (-393.162) [-389.989] (-391.087) (-390.444) -- 0:00:09
837000 -- (-391.941) (-389.833) (-395.109) [-393.065] * (-389.872) (-390.789) (-389.679) [-391.214] -- 0:00:09
837500 -- (-392.111) [-389.858] (-389.763) (-391.053) * (-392.986) (-391.390) (-391.423) [-390.837] -- 0:00:09
838000 -- (-390.937) (-389.339) (-390.678) [-390.778] * (-391.012) [-389.397] (-391.294) (-395.879) -- 0:00:09
838500 -- (-390.212) (-389.467) [-392.681] (-389.692) * (-394.970) (-390.516) (-390.737) [-390.454] -- 0:00:09
839000 -- (-389.199) [-390.087] (-390.271) (-390.027) * (-395.774) [-391.052] (-391.264) (-392.581) -- 0:00:09
839500 -- (-389.907) [-392.347] (-395.957) (-391.075) * (-396.335) (-392.256) [-389.256] (-393.412) -- 0:00:09
840000 -- (-394.057) (-389.688) [-391.917] (-391.664) * (-395.423) (-395.249) [-389.212] (-389.523) -- 0:00:09
Average standard deviation of split frequencies: 0.008935
840500 -- (-393.867) [-389.789] (-394.030) (-392.687) * [-389.896] (-391.538) (-392.277) (-390.909) -- 0:00:09
841000 -- [-391.745] (-390.130) (-390.183) (-392.308) * (-394.023) [-390.335] (-393.135) (-393.181) -- 0:00:09
841500 -- [-389.715] (-391.509) (-392.154) (-392.917) * (-390.746) [-389.198] (-392.217) (-393.461) -- 0:00:09
842000 -- (-390.962) [-393.918] (-393.342) (-393.120) * [-393.676] (-389.930) (-394.402) (-392.062) -- 0:00:09
842500 -- (-391.090) (-395.963) (-391.994) [-392.466] * (-393.350) [-390.748] (-391.591) (-393.099) -- 0:00:09
843000 -- [-390.948] (-391.932) (-390.029) (-396.879) * (-390.604) (-390.979) (-392.307) [-389.997] -- 0:00:09
843500 -- [-389.909] (-391.267) (-391.540) (-393.007) * (-390.684) (-390.935) (-391.826) [-390.084] -- 0:00:09
844000 -- (-390.745) (-390.398) [-393.113] (-389.040) * (-391.321) (-390.246) (-396.839) [-392.786] -- 0:00:09
844500 -- [-392.229] (-391.328) (-392.970) (-390.062) * (-391.765) (-392.761) (-391.978) [-391.051] -- 0:00:09
845000 -- [-390.396] (-389.345) (-391.849) (-390.536) * (-391.425) (-392.894) [-390.445] (-391.600) -- 0:00:09
Average standard deviation of split frequencies: 0.008878
845500 -- (-390.561) [-391.912] (-391.358) (-392.554) * [-392.134] (-395.612) (-391.698) (-392.612) -- 0:00:09
846000 -- (-391.571) (-390.230) (-390.261) [-391.786] * (-390.830) (-393.784) [-390.532] (-391.610) -- 0:00:09
846500 -- [-391.807] (-390.268) (-389.489) (-391.480) * (-390.209) (-389.185) [-390.593] (-392.093) -- 0:00:09
847000 -- [-391.441] (-390.389) (-390.848) (-390.509) * (-392.737) (-393.449) [-390.686] (-390.302) -- 0:00:09
847500 -- (-390.133) (-392.159) (-390.368) [-391.914] * (-390.132) (-391.946) [-392.612] (-392.293) -- 0:00:09
848000 -- (-393.423) (-392.253) (-392.297) [-391.697] * (-392.964) (-395.465) [-393.950] (-391.379) -- 0:00:09
848500 -- (-394.966) [-390.506] (-393.530) (-389.812) * (-391.367) [-389.489] (-393.726) (-391.853) -- 0:00:09
849000 -- (-395.124) (-390.515) [-391.426] (-389.838) * (-390.245) [-390.612] (-390.270) (-391.682) -- 0:00:09
849500 -- (-399.086) [-391.739] (-389.190) (-390.876) * [-389.672] (-389.675) (-391.197) (-396.697) -- 0:00:09
850000 -- [-394.291] (-393.128) (-389.193) (-393.283) * (-389.640) (-392.005) (-390.688) [-391.260] -- 0:00:09
Average standard deviation of split frequencies: 0.008867
850500 -- [-392.897] (-396.177) (-389.972) (-399.217) * (-390.262) (-392.970) (-389.512) [-390.618] -- 0:00:08
851000 -- (-391.395) [-393.200] (-391.105) (-395.112) * [-390.721] (-389.778) (-391.662) (-392.752) -- 0:00:08
851500 -- (-393.811) (-390.013) [-389.326] (-393.549) * (-389.784) [-389.760] (-391.065) (-390.287) -- 0:00:08
852000 -- (-394.195) (-390.820) (-393.200) [-390.185] * (-390.875) (-392.050) [-389.351] (-391.448) -- 0:00:08
852500 -- (-393.743) (-391.847) (-389.830) [-389.498] * [-389.804] (-390.275) (-391.419) (-393.579) -- 0:00:08
853000 -- (-391.144) (-391.647) [-389.459] (-390.634) * (-389.334) (-391.226) (-389.864) [-390.285] -- 0:00:08
853500 -- (-394.635) (-391.096) [-389.789] (-393.222) * (-394.279) (-390.028) [-392.223] (-389.802) -- 0:00:08
854000 -- (-391.566) (-397.129) [-392.078] (-389.552) * [-391.089] (-393.391) (-391.020) (-389.224) -- 0:00:08
854500 -- (-390.992) [-390.979] (-392.629) (-393.191) * (-391.897) (-396.434) [-390.307] (-394.275) -- 0:00:08
855000 -- (-392.754) [-390.405] (-390.156) (-389.520) * (-391.473) (-390.607) [-390.261] (-391.697) -- 0:00:08
Average standard deviation of split frequencies: 0.008481
855500 -- (-395.688) [-391.845] (-390.857) (-390.210) * (-394.148) (-390.318) (-390.663) [-392.013] -- 0:00:08
856000 -- (-397.251) [-390.439] (-391.729) (-391.459) * (-393.271) [-391.437] (-392.378) (-390.717) -- 0:00:08
856500 -- (-391.159) (-394.111) (-391.638) [-390.299] * (-391.049) (-391.708) (-392.253) [-390.574] -- 0:00:08
857000 -- [-392.304] (-389.202) (-389.932) (-391.247) * [-391.865] (-391.490) (-391.373) (-391.454) -- 0:00:08
857500 -- (-391.407) [-390.145] (-391.280) (-390.405) * (-389.244) [-389.991] (-392.755) (-393.206) -- 0:00:08
858000 -- [-389.859] (-389.914) (-392.936) (-390.206) * [-390.704] (-393.116) (-396.385) (-391.106) -- 0:00:08
858500 -- (-390.075) (-392.684) (-393.009) [-390.402] * [-390.443] (-393.013) (-392.077) (-393.572) -- 0:00:08
859000 -- [-390.039] (-390.417) (-394.153) (-390.117) * [-391.306] (-389.877) (-390.734) (-393.678) -- 0:00:08
859500 -- (-394.008) (-391.190) (-390.433) [-391.057] * (-392.071) (-390.463) [-392.548] (-390.721) -- 0:00:08
860000 -- (-392.281) (-392.148) (-389.565) [-392.295] * (-390.207) (-391.489) [-389.131] (-389.205) -- 0:00:08
Average standard deviation of split frequencies: 0.008471
860500 -- [-390.807] (-390.816) (-390.277) (-393.338) * (-389.278) (-389.648) (-393.749) [-392.321] -- 0:00:08
861000 -- (-390.230) (-391.296) (-390.206) [-389.441] * (-392.588) (-388.964) (-390.328) [-390.726] -- 0:00:08
861500 -- (-391.415) (-389.619) (-392.820) [-390.069] * (-390.800) (-389.721) (-389.864) [-390.187] -- 0:00:08
862000 -- (-397.067) (-391.103) [-395.010] (-389.322) * (-391.659) [-390.387] (-390.520) (-393.772) -- 0:00:08
862500 -- (-391.078) (-393.572) (-391.259) [-389.357] * (-393.918) [-391.473] (-390.251) (-392.218) -- 0:00:08
863000 -- (-391.619) [-391.304] (-393.373) (-390.483) * [-390.877] (-392.369) (-392.324) (-390.296) -- 0:00:08
863500 -- (-389.685) (-389.955) [-391.736] (-390.401) * (-391.474) (-392.644) (-392.505) [-393.538] -- 0:00:08
864000 -- (-389.583) (-394.493) (-391.428) [-391.817] * [-390.207] (-391.988) (-391.456) (-389.599) -- 0:00:08
864500 -- [-390.329] (-392.134) (-392.135) (-391.107) * (-390.981) (-391.601) (-391.809) [-389.407] -- 0:00:08
865000 -- (-390.020) [-392.283] (-389.595) (-394.644) * (-391.784) [-390.556] (-389.125) (-389.202) -- 0:00:08
Average standard deviation of split frequencies: 0.008419
865500 -- (-389.533) (-394.911) (-389.604) [-393.984] * (-392.915) (-394.675) (-391.901) [-389.257] -- 0:00:08
866000 -- (-389.899) (-393.917) [-390.599] (-398.325) * [-391.787] (-390.738) (-389.881) (-390.256) -- 0:00:08
866500 -- (-390.021) (-390.195) [-391.343] (-394.925) * (-392.322) [-389.745] (-391.380) (-390.312) -- 0:00:08
867000 -- (-391.324) (-390.963) (-390.848) [-393.169] * (-392.767) (-389.759) [-392.681] (-391.547) -- 0:00:07
867500 -- [-392.066] (-390.006) (-395.632) (-390.315) * (-390.133) [-396.737] (-394.842) (-394.582) -- 0:00:07
868000 -- (-390.328) (-392.311) (-393.008) [-391.884] * (-392.579) (-392.034) (-394.707) [-391.664] -- 0:00:07
868500 -- (-391.542) (-391.061) (-394.253) [-390.330] * (-395.071) (-389.835) [-392.989] (-392.474) -- 0:00:07
869000 -- (-390.765) (-393.666) (-392.494) [-392.371] * (-392.531) (-390.176) (-391.219) [-390.015] -- 0:00:07
869500 -- (-393.315) (-390.793) (-393.046) [-391.370] * [-390.754] (-394.002) (-390.561) (-390.187) -- 0:00:07
870000 -- (-395.085) (-391.382) (-391.128) [-390.087] * [-390.094] (-393.009) (-390.009) (-391.095) -- 0:00:07
Average standard deviation of split frequencies: 0.008338
870500 -- (-392.143) [-390.376] (-391.439) (-391.287) * (-392.111) [-390.991] (-393.595) (-393.986) -- 0:00:07
871000 -- (-390.218) (-390.008) [-392.433] (-393.892) * (-391.623) [-389.131] (-394.002) (-392.371) -- 0:00:07
871500 -- (-391.712) [-390.433] (-391.038) (-393.004) * (-390.125) [-389.110] (-396.713) (-389.307) -- 0:00:07
872000 -- (-390.788) (-390.861) (-391.568) [-390.965] * (-390.747) [-389.993] (-392.400) (-391.234) -- 0:00:07
872500 -- (-392.747) (-390.546) [-390.864] (-389.742) * [-390.662] (-390.260) (-390.901) (-391.528) -- 0:00:07
873000 -- (-394.559) [-390.623] (-399.600) (-390.962) * (-391.960) [-391.562] (-389.834) (-394.592) -- 0:00:07
873500 -- (-394.048) [-396.044] (-391.849) (-390.283) * [-392.549] (-391.054) (-389.825) (-392.645) -- 0:00:07
874000 -- (-389.815) [-396.377] (-392.394) (-389.441) * (-393.146) (-390.295) [-389.717] (-389.882) -- 0:00:07
874500 -- (-390.820) [-393.051] (-392.239) (-392.353) * (-389.470) (-394.694) [-389.676] (-392.340) -- 0:00:07
875000 -- (-394.952) [-390.952] (-389.692) (-390.468) * (-390.505) (-392.573) [-389.964] (-390.221) -- 0:00:07
Average standard deviation of split frequencies: 0.008180
875500 -- (-391.364) (-391.627) (-391.014) [-390.184] * (-393.635) (-389.884) (-391.181) [-390.829] -- 0:00:07
876000 -- (-390.877) (-390.912) [-390.544] (-389.096) * (-393.276) (-390.931) (-392.658) [-389.589] -- 0:00:07
876500 -- (-395.986) [-392.208] (-390.119) (-390.899) * (-395.114) (-393.026) [-392.881] (-390.074) -- 0:00:07
877000 -- (-390.362) [-390.709] (-391.660) (-391.101) * (-390.703) (-390.395) [-391.087] (-391.211) -- 0:00:07
877500 -- (-393.896) (-393.033) (-391.807) [-391.594] * (-390.187) [-395.208] (-391.440) (-393.003) -- 0:00:07
878000 -- [-389.397] (-392.760) (-390.077) (-395.324) * (-389.827) (-392.994) [-392.095] (-389.445) -- 0:00:07
878500 -- [-390.778] (-393.809) (-389.917) (-390.396) * (-392.022) (-392.425) [-390.147] (-389.830) -- 0:00:07
879000 -- [-390.223] (-391.446) (-391.023) (-391.763) * (-394.870) [-390.265] (-391.241) (-389.666) -- 0:00:07
879500 -- (-390.404) [-389.303] (-390.547) (-391.385) * [-398.315] (-389.846) (-390.047) (-389.373) -- 0:00:07
880000 -- (-389.719) (-394.121) [-391.556] (-396.788) * (-395.662) (-389.901) [-389.638] (-389.871) -- 0:00:07
Average standard deviation of split frequencies: 0.007958
880500 -- (-395.261) [-390.668] (-395.254) (-391.742) * [-392.923] (-389.729) (-391.645) (-392.686) -- 0:00:07
881000 -- [-391.798] (-394.526) (-394.933) (-391.356) * [-392.275] (-389.353) (-390.734) (-392.777) -- 0:00:07
881500 -- (-390.065) [-389.709] (-393.716) (-391.217) * (-390.069) (-394.118) (-391.158) [-390.440] -- 0:00:07
882000 -- (-390.048) (-393.474) [-397.512] (-399.645) * (-392.691) (-393.136) (-392.684) [-391.107] -- 0:00:07
882500 -- (-393.316) [-394.193] (-392.319) (-391.881) * (-392.057) [-390.024] (-397.134) (-389.409) -- 0:00:07
883000 -- (-390.579) [-391.551] (-391.474) (-390.941) * [-390.522] (-390.732) (-392.462) (-390.675) -- 0:00:07
883500 -- (-390.221) (-391.648) (-394.624) [-393.735] * (-391.513) [-391.947] (-391.722) (-392.928) -- 0:00:06
884000 -- (-391.094) (-390.880) (-390.963) [-389.790] * (-394.135) (-390.532) [-391.205] (-392.403) -- 0:00:06
884500 -- (-391.290) (-390.206) [-391.465] (-391.379) * (-390.612) (-389.331) (-391.519) [-390.321] -- 0:00:06
885000 -- (-389.957) (-390.931) (-393.385) [-391.024] * [-390.246] (-389.163) (-392.024) (-389.680) -- 0:00:06
Average standard deviation of split frequencies: 0.007342
885500 -- (-393.792) [-391.108] (-392.542) (-390.935) * [-390.480] (-390.942) (-389.911) (-391.096) -- 0:00:06
886000 -- (-390.365) (-391.442) (-389.705) [-390.545] * [-391.282] (-390.121) (-391.092) (-392.593) -- 0:00:06
886500 -- [-389.204] (-392.192) (-391.181) (-396.728) * [-389.959] (-390.032) (-391.705) (-389.973) -- 0:00:06
887000 -- [-389.023] (-391.188) (-390.876) (-390.468) * [-390.836] (-389.570) (-395.043) (-390.071) -- 0:00:06
887500 -- (-391.821) [-390.991] (-392.837) (-393.874) * [-390.713] (-390.273) (-393.957) (-389.424) -- 0:00:06
888000 -- (-396.368) (-393.354) [-395.888] (-390.625) * [-389.792] (-391.996) (-391.965) (-392.058) -- 0:00:06
888500 -- (-395.913) (-390.963) (-394.211) [-389.499] * (-391.516) (-391.406) [-393.036] (-390.530) -- 0:00:06
889000 -- [-390.619] (-389.654) (-391.008) (-391.587) * (-391.047) (-393.671) [-396.964] (-393.562) -- 0:00:06
889500 -- (-389.910) (-390.510) (-389.650) [-390.374] * (-392.380) (-390.759) [-391.722] (-390.904) -- 0:00:06
890000 -- (-389.536) (-392.218) (-390.058) [-391.276] * [-391.111] (-393.881) (-390.761) (-390.998) -- 0:00:06
Average standard deviation of split frequencies: 0.007622
890500 -- (-390.512) (-391.543) [-390.504] (-389.717) * (-393.386) (-397.149) [-390.217] (-392.270) -- 0:00:06
891000 -- (-390.445) (-393.313) [-391.653] (-393.618) * (-396.441) (-391.367) (-390.014) [-390.503] -- 0:00:06
891500 -- (-392.033) (-393.889) [-391.474] (-392.070) * (-395.172) (-392.619) [-389.730] (-393.863) -- 0:00:06
892000 -- [-393.901] (-391.183) (-391.409) (-389.642) * (-392.155) [-393.465] (-390.924) (-392.267) -- 0:00:06
892500 -- (-395.081) (-392.018) (-394.559) [-389.704] * (-390.504) [-389.511] (-390.188) (-390.142) -- 0:00:06
893000 -- (-390.390) [-389.912] (-393.458) (-391.945) * (-392.984) (-390.999) (-391.236) [-390.142] -- 0:00:06
893500 -- (-394.140) (-396.651) [-391.402] (-389.638) * (-390.650) (-393.127) [-391.380] (-389.966) -- 0:00:06
894000 -- (-390.180) (-392.320) [-389.629] (-389.735) * (-391.432) (-394.640) [-390.968] (-389.833) -- 0:00:06
894500 -- (-391.063) [-392.414] (-391.639) (-389.975) * (-390.973) (-390.809) (-394.024) [-390.298] -- 0:00:06
895000 -- (-391.464) (-394.071) [-392.403] (-389.932) * (-392.178) [-390.290] (-391.705) (-391.219) -- 0:00:06
Average standard deviation of split frequencies: 0.007366
895500 -- (-395.795) (-391.420) (-397.249) [-389.817] * (-392.793) (-389.614) [-390.081] (-390.665) -- 0:00:06
896000 -- [-394.004] (-389.744) (-391.901) (-392.642) * (-390.677) [-392.260] (-389.839) (-390.765) -- 0:00:06
896500 -- (-390.659) (-392.186) [-391.385] (-391.776) * (-395.309) (-390.983) (-389.821) [-389.982] -- 0:00:06
897000 -- (-389.698) [-391.786] (-391.353) (-391.179) * (-392.446) (-390.934) [-390.694] (-389.851) -- 0:00:06
897500 -- (-390.447) (-392.948) (-389.758) [-389.711] * (-391.550) (-393.027) (-392.418) [-389.139] -- 0:00:06
898000 -- [-390.503] (-390.265) (-389.483) (-395.941) * (-391.920) (-399.033) [-393.920] (-392.100) -- 0:00:06
898500 -- (-393.606) [-391.961] (-389.707) (-390.233) * [-392.909] (-391.231) (-390.348) (-390.096) -- 0:00:06
899000 -- (-394.662) (-390.791) (-389.375) [-390.760] * (-390.992) (-390.986) (-390.434) [-392.112] -- 0:00:06
899500 -- (-392.698) (-390.795) (-392.032) [-390.801] * (-391.623) (-390.270) (-391.626) [-390.573] -- 0:00:06
900000 -- (-389.349) (-389.452) [-390.354] (-389.442) * (-391.095) [-392.172] (-392.135) (-394.402) -- 0:00:06
Average standard deviation of split frequencies: 0.007188
900500 -- (-391.264) (-389.234) (-393.320) [-390.265] * [-390.761] (-394.255) (-395.380) (-391.568) -- 0:00:05
901000 -- (-392.663) (-393.814) [-392.202] (-390.770) * (-393.139) (-390.592) (-393.569) [-389.408] -- 0:00:05
901500 -- (-391.509) (-393.245) [-390.200] (-389.962) * (-389.625) (-390.728) (-394.609) [-396.297] -- 0:00:05
902000 -- [-391.379] (-395.618) (-391.836) (-391.664) * (-391.625) (-390.168) [-390.989] (-390.558) -- 0:00:05
902500 -- (-390.752) (-398.492) (-393.689) [-390.649] * (-390.567) [-390.693] (-395.378) (-390.042) -- 0:00:05
903000 -- (-390.821) (-393.789) [-390.771] (-393.196) * (-393.061) [-390.161] (-391.338) (-390.928) -- 0:00:05
903500 -- (-391.893) [-389.845] (-392.322) (-392.856) * (-392.742) (-391.273) [-392.131] (-391.840) -- 0:00:05
904000 -- (-391.337) (-390.940) [-390.274] (-390.003) * [-394.595] (-392.582) (-390.469) (-392.057) -- 0:00:05
904500 -- (-390.510) [-392.523] (-394.039) (-391.996) * (-389.575) (-391.276) (-394.080) [-390.927] -- 0:00:05
905000 -- (-389.911) (-390.480) (-390.063) [-390.453] * (-390.234) (-390.984) (-392.187) [-389.887] -- 0:00:05
Average standard deviation of split frequencies: 0.007076
905500 -- [-390.209] (-390.446) (-391.347) (-390.822) * (-391.580) (-395.616) [-390.134] (-390.293) -- 0:00:05
906000 -- (-389.476) (-390.693) (-392.867) [-391.494] * (-393.478) (-393.708) (-392.128) [-393.368] -- 0:00:05
906500 -- (-396.904) (-392.773) [-389.393] (-390.170) * [-392.957] (-392.555) (-392.640) (-389.769) -- 0:00:05
907000 -- (-394.130) [-392.869] (-391.106) (-389.317) * (-391.972) (-393.654) (-392.087) [-391.439] -- 0:00:05
907500 -- [-390.008] (-398.187) (-390.481) (-391.736) * (-390.191) (-390.313) (-394.187) [-391.422] -- 0:00:05
908000 -- (-390.021) [-391.024] (-390.221) (-390.134) * (-390.832) (-391.538) [-393.348] (-394.583) -- 0:00:05
908500 -- [-389.748] (-390.711) (-392.298) (-393.106) * [-390.612] (-390.083) (-392.274) (-392.132) -- 0:00:05
909000 -- (-392.173) [-390.540] (-390.613) (-389.163) * [-391.421] (-392.723) (-392.263) (-389.557) -- 0:00:05
909500 -- [-393.938] (-389.167) (-390.443) (-390.810) * (-394.051) [-391.146] (-391.774) (-390.729) -- 0:00:05
910000 -- [-390.940] (-392.650) (-390.276) (-393.078) * (-394.319) (-389.441) [-389.494] (-391.466) -- 0:00:05
Average standard deviation of split frequencies: 0.006695
910500 -- (-390.579) (-396.895) (-394.129) [-391.867] * (-398.023) (-391.020) (-390.014) [-394.497] -- 0:00:05
911000 -- [-389.407] (-393.126) (-389.362) (-392.829) * (-395.129) [-391.560] (-391.315) (-396.038) -- 0:00:05
911500 -- [-391.561] (-389.577) (-392.318) (-393.189) * (-393.115) (-393.793) [-389.306] (-393.225) -- 0:00:05
912000 -- (-391.045) (-389.677) [-392.935] (-392.969) * [-390.904] (-391.696) (-389.770) (-391.430) -- 0:00:05
912500 -- (-392.832) (-392.315) [-390.748] (-392.250) * (-394.409) [-391.096] (-389.427) (-393.060) -- 0:00:05
913000 -- (-391.028) (-393.233) (-391.459) [-390.525] * (-392.408) (-391.793) (-389.315) [-392.856] -- 0:00:05
913500 -- (-389.812) (-391.543) (-390.857) [-389.459] * (-392.644) (-390.318) [-392.679] (-390.584) -- 0:00:05
914000 -- (-392.273) (-390.941) [-390.458] (-394.612) * (-390.911) (-393.866) [-392.826] (-391.696) -- 0:00:05
914500 -- (-390.765) (-392.876) (-393.581) [-393.680] * [-391.094] (-392.363) (-391.151) (-393.591) -- 0:00:05
915000 -- (-390.297) (-390.765) [-394.022] (-394.906) * (-392.140) (-389.757) [-391.016] (-394.703) -- 0:00:05
Average standard deviation of split frequencies: 0.006519
915500 -- (-395.901) (-391.603) (-390.529) [-390.572] * (-389.743) (-390.585) (-390.236) [-392.410] -- 0:00:05
916000 -- (-389.714) (-392.350) [-390.448] (-394.142) * (-389.725) (-392.958) (-390.984) [-391.165] -- 0:00:05
916500 -- (-389.520) [-391.424] (-392.183) (-389.805) * (-391.686) [-390.542] (-389.990) (-390.255) -- 0:00:05
917000 -- (-391.734) (-390.869) (-392.045) [-389.917] * [-391.595] (-396.834) (-389.755) (-389.515) -- 0:00:04
917500 -- [-390.859] (-390.864) (-392.457) (-394.306) * (-389.747) (-392.778) [-391.513] (-392.189) -- 0:00:04
918000 -- (-393.806) [-389.948] (-392.807) (-392.343) * (-389.732) [-390.350] (-391.346) (-390.997) -- 0:00:04
918500 -- [-389.605] (-391.879) (-395.437) (-392.875) * [-389.571] (-391.373) (-390.720) (-391.271) -- 0:00:04
919000 -- (-391.108) [-391.041] (-391.081) (-391.799) * [-389.292] (-392.536) (-390.609) (-389.538) -- 0:00:04
919500 -- (-391.611) (-390.925) (-393.691) [-393.720] * (-390.542) (-391.099) (-392.164) [-391.240] -- 0:00:04
920000 -- (-394.813) (-389.842) (-397.111) [-389.563] * [-389.865] (-393.726) (-392.222) (-391.872) -- 0:00:04
Average standard deviation of split frequencies: 0.006349
920500 -- (-393.674) (-391.946) (-392.069) [-391.818] * (-389.237) (-389.517) [-392.123] (-391.709) -- 0:00:04
921000 -- [-391.353] (-394.392) (-392.758) (-389.833) * (-389.960) (-390.408) (-390.679) [-391.007] -- 0:00:04
921500 -- (-390.225) [-389.703] (-391.643) (-390.643) * (-392.512) (-390.186) (-393.195) [-393.169] -- 0:00:04
922000 -- (-392.281) [-393.655] (-390.483) (-395.592) * [-393.327] (-389.843) (-393.986) (-389.860) -- 0:00:04
922500 -- (-390.439) (-391.555) [-390.212] (-391.893) * (-391.939) [-390.375] (-399.657) (-390.003) -- 0:00:04
923000 -- (-390.168) [-392.871] (-392.398) (-391.219) * (-390.707) [-390.271] (-393.617) (-392.475) -- 0:00:04
923500 -- [-391.972] (-394.013) (-390.716) (-391.575) * (-397.263) (-390.714) [-391.694] (-390.559) -- 0:00:04
924000 -- (-392.462) [-391.615] (-390.470) (-395.602) * [-390.724] (-390.846) (-393.036) (-390.827) -- 0:00:04
924500 -- (-390.848) (-391.461) (-392.492) [-394.631] * (-391.799) [-390.970] (-391.321) (-392.818) -- 0:00:04
925000 -- (-391.712) (-390.302) [-390.279] (-392.128) * (-392.176) (-393.156) [-390.203] (-391.650) -- 0:00:04
Average standard deviation of split frequencies: 0.006686
925500 -- (-393.870) (-389.834) (-392.001) [-389.877] * (-396.288) [-389.667] (-390.502) (-391.405) -- 0:00:04
926000 -- (-395.050) (-392.222) [-390.935] (-391.290) * [-390.497] (-391.480) (-394.561) (-392.990) -- 0:00:04
926500 -- (-389.925) [-391.845] (-390.999) (-393.829) * [-392.952] (-394.591) (-392.336) (-391.216) -- 0:00:04
927000 -- [-392.254] (-394.556) (-391.003) (-391.576) * (-389.125) [-393.506] (-392.922) (-395.511) -- 0:00:04
927500 -- (-391.508) (-391.440) (-390.580) [-390.723] * (-397.502) (-390.154) (-394.180) [-392.724] -- 0:00:04
928000 -- (-392.929) (-393.536) (-399.650) [-389.603] * (-394.921) [-394.374] (-391.932) (-396.820) -- 0:00:04
928500 -- (-393.288) (-391.485) [-393.144] (-389.874) * [-392.862] (-390.217) (-390.445) (-389.748) -- 0:00:04
929000 -- (-391.266) [-392.838] (-393.382) (-390.285) * (-394.770) (-391.944) [-391.544] (-392.230) -- 0:00:04
929500 -- (-393.771) (-390.640) [-389.973] (-391.748) * (-390.275) (-395.406) [-390.672] (-393.896) -- 0:00:04
930000 -- (-392.966) [-390.531] (-390.028) (-394.348) * (-390.094) [-390.646] (-396.958) (-392.331) -- 0:00:04
Average standard deviation of split frequencies: 0.006787
930500 -- [-392.395] (-393.423) (-390.720) (-391.905) * (-389.747) (-390.145) [-389.576] (-390.669) -- 0:00:04
931000 -- [-391.617] (-391.971) (-393.856) (-391.692) * (-389.170) (-390.676) [-390.828] (-391.270) -- 0:00:04
931500 -- [-390.609] (-393.128) (-389.775) (-390.807) * (-392.566) (-393.560) [-391.410] (-392.510) -- 0:00:04
932000 -- [-389.213] (-395.363) (-389.599) (-389.587) * [-391.111] (-391.904) (-391.303) (-390.059) -- 0:00:04
932500 -- (-389.233) [-393.113] (-390.244) (-389.512) * (-390.947) (-390.907) [-394.619] (-392.441) -- 0:00:04
933000 -- (-389.123) (-391.608) [-389.437] (-389.924) * [-395.489] (-389.831) (-393.234) (-395.899) -- 0:00:04
933500 -- [-390.429] (-389.606) (-391.808) (-389.276) * (-389.690) (-389.332) (-392.381) [-396.037] -- 0:00:03
934000 -- (-391.344) [-391.152] (-389.445) (-392.497) * (-392.072) [-390.622] (-393.674) (-392.206) -- 0:00:03
934500 -- (-391.480) [-389.486] (-393.304) (-389.666) * (-390.149) (-389.324) [-392.320] (-391.794) -- 0:00:03
935000 -- (-390.148) [-392.553] (-391.508) (-391.174) * (-390.178) (-390.527) (-389.319) [-391.432] -- 0:00:03
Average standard deviation of split frequencies: 0.006782
935500 -- (-397.176) (-392.784) [-391.840] (-392.687) * (-392.336) [-391.481] (-389.235) (-391.524) -- 0:00:03
936000 -- (-390.265) (-391.184) (-390.363) [-393.386] * (-396.100) [-390.635] (-391.209) (-393.334) -- 0:00:03
936500 -- (-390.013) (-395.062) [-392.772] (-391.677) * (-390.053) (-390.316) [-390.961] (-391.648) -- 0:00:03
937000 -- (-390.235) (-398.990) [-390.294] (-390.762) * [-390.294] (-389.552) (-392.224) (-392.158) -- 0:00:03
937500 -- (-390.770) (-396.303) (-391.651) [-390.706] * [-391.507] (-390.049) (-392.573) (-394.016) -- 0:00:03
938000 -- (-391.585) (-397.283) [-390.136] (-390.573) * (-392.940) (-390.412) [-389.584] (-392.168) -- 0:00:03
938500 -- (-390.852) [-391.196] (-391.140) (-390.043) * (-393.053) (-390.240) (-393.243) [-392.394] -- 0:00:03
939000 -- [-390.046] (-391.977) (-392.066) (-390.532) * [-390.683] (-390.540) (-390.753) (-393.041) -- 0:00:03
939500 -- (-391.818) (-389.440) (-392.000) [-390.563] * [-390.042] (-392.886) (-392.249) (-394.738) -- 0:00:03
940000 -- (-390.982) [-389.442] (-392.514) (-391.609) * (-389.964) [-392.733] (-391.351) (-392.331) -- 0:00:03
Average standard deviation of split frequencies: 0.006682
940500 -- (-389.761) (-391.381) [-392.473] (-391.279) * [-389.441] (-392.917) (-389.130) (-397.658) -- 0:00:03
941000 -- [-391.892] (-394.443) (-392.543) (-389.754) * [-390.253] (-394.003) (-392.634) (-390.704) -- 0:00:03
941500 -- [-390.645] (-400.103) (-391.642) (-391.917) * [-389.320] (-392.523) (-394.402) (-392.324) -- 0:00:03
942000 -- (-392.593) (-396.245) (-393.765) [-390.139] * (-390.353) (-391.441) [-392.733] (-391.079) -- 0:00:03
942500 -- [-394.157] (-395.207) (-395.910) (-390.103) * (-390.559) [-391.194] (-391.469) (-390.808) -- 0:00:03
943000 -- (-391.125) (-391.147) (-391.658) [-390.441] * (-390.690) (-391.923) (-390.200) [-391.700] -- 0:00:03
943500 -- (-392.092) [-392.674] (-392.560) (-392.455) * (-389.908) (-391.487) [-391.573] (-391.821) -- 0:00:03
944000 -- (-390.825) (-391.821) (-392.811) [-390.335] * [-390.486] (-391.791) (-393.977) (-389.240) -- 0:00:03
944500 -- [-391.519] (-391.008) (-393.131) (-391.803) * (-392.398) (-391.641) [-389.580] (-389.396) -- 0:00:03
945000 -- [-390.340] (-394.562) (-393.020) (-395.796) * [-389.595] (-390.303) (-390.381) (-392.099) -- 0:00:03
Average standard deviation of split frequencies: 0.007381
945500 -- [-389.240] (-392.087) (-389.079) (-394.160) * (-389.705) (-389.847) (-391.781) [-393.184] -- 0:00:03
946000 -- (-393.532) (-392.122) [-389.490] (-392.447) * (-390.645) (-390.753) (-390.371) [-390.415] -- 0:00:03
946500 -- [-395.511] (-391.837) (-391.419) (-389.428) * [-389.237] (-390.554) (-395.615) (-395.022) -- 0:00:03
947000 -- [-390.744] (-393.279) (-395.218) (-391.102) * (-389.749) (-391.466) [-393.119] (-390.630) -- 0:00:03
947500 -- [-391.202] (-394.523) (-392.151) (-393.394) * (-392.095) (-390.072) (-394.011) [-390.823] -- 0:00:03
948000 -- (-392.306) (-390.797) (-393.978) [-391.876] * (-398.535) [-389.347] (-392.531) (-390.590) -- 0:00:03
948500 -- (-391.122) (-391.020) (-393.897) [-391.410] * (-391.904) (-392.524) (-392.686) [-389.796] -- 0:00:03
949000 -- (-394.954) (-390.674) [-395.747] (-392.912) * (-389.709) [-390.629] (-396.299) (-391.693) -- 0:00:03
949500 -- [-390.490] (-390.711) (-392.056) (-393.141) * (-389.908) (-394.637) [-389.907] (-391.753) -- 0:00:03
950000 -- [-390.772] (-390.928) (-390.579) (-390.533) * (-389.566) [-393.172] (-392.891) (-390.504) -- 0:00:03
Average standard deviation of split frequencies: 0.006744
950500 -- [-389.921] (-391.272) (-393.542) (-391.336) * (-389.918) (-392.945) (-393.313) [-392.927] -- 0:00:02
951000 -- [-390.562] (-393.926) (-389.904) (-393.298) * [-390.838] (-389.577) (-389.957) (-392.321) -- 0:00:02
951500 -- (-394.845) (-391.260) [-390.431] (-392.995) * (-391.122) [-391.515] (-390.655) (-396.230) -- 0:00:02
952000 -- (-397.295) (-392.867) [-390.911] (-391.209) * (-392.342) [-392.769] (-392.476) (-394.970) -- 0:00:02
952500 -- [-389.695] (-392.213) (-390.598) (-390.227) * (-389.632) (-393.387) (-390.987) [-393.672] -- 0:00:02
953000 -- (-390.683) (-390.120) (-398.002) [-389.213] * (-390.006) [-391.291] (-395.203) (-393.774) -- 0:00:02
953500 -- (-390.911) (-390.153) [-394.400] (-391.824) * (-391.719) (-394.282) [-390.529] (-391.127) -- 0:00:02
954000 -- [-390.382] (-390.681) (-391.615) (-399.912) * (-390.426) [-392.961] (-391.575) (-394.797) -- 0:00:02
954500 -- [-390.115] (-389.888) (-391.980) (-389.336) * (-393.087) [-393.600] (-392.830) (-390.860) -- 0:00:02
955000 -- (-389.650) (-390.693) (-389.721) [-389.041] * (-394.937) (-390.184) (-391.633) [-391.035] -- 0:00:02
Average standard deviation of split frequencies: 0.006147
955500 -- [-389.486] (-389.980) (-391.264) (-389.043) * (-390.662) (-389.335) [-389.695] (-390.938) -- 0:00:02
956000 -- [-389.486] (-392.646) (-390.806) (-388.931) * (-392.714) [-390.221] (-390.717) (-390.752) -- 0:00:02
956500 -- (-393.231) (-394.305) [-389.661] (-392.954) * [-389.391] (-391.149) (-392.646) (-392.762) -- 0:00:02
957000 -- (-392.095) (-392.720) (-394.391) [-393.532] * [-390.854] (-391.405) (-394.560) (-389.033) -- 0:00:02
957500 -- (-393.103) [-390.944] (-392.329) (-392.430) * (-392.679) (-391.179) (-392.631) [-392.748] -- 0:00:02
958000 -- (-391.463) (-394.552) (-393.340) [-391.694] * (-390.561) (-391.058) (-390.205) [-391.885] -- 0:00:02
958500 -- (-392.895) (-393.147) [-392.041] (-393.856) * (-390.030) (-389.759) (-393.486) [-390.239] -- 0:00:02
959000 -- [-391.041] (-395.116) (-395.891) (-392.903) * [-391.059] (-392.161) (-392.807) (-390.392) -- 0:00:02
959500 -- (-392.497) (-390.426) [-389.880] (-389.557) * (-393.947) (-391.969) (-394.395) [-392.090] -- 0:00:02
960000 -- (-390.815) (-391.603) [-390.069] (-390.951) * (-396.667) [-392.774] (-393.856) (-391.542) -- 0:00:02
Average standard deviation of split frequencies: 0.005888
960500 -- [-391.270] (-390.458) (-390.740) (-389.500) * (-391.413) (-390.988) (-394.713) [-390.221] -- 0:00:02
961000 -- (-391.825) (-389.328) (-390.987) [-389.293] * (-390.695) [-390.810] (-393.118) (-390.854) -- 0:00:02
961500 -- (-391.020) [-389.521] (-390.800) (-390.986) * (-390.869) (-391.841) (-389.080) [-391.103] -- 0:00:02
962000 -- (-390.108) [-391.344] (-390.836) (-391.721) * (-390.432) (-389.867) (-393.322) [-390.549] -- 0:00:02
962500 -- (-397.444) [-390.351] (-392.893) (-391.157) * (-390.929) [-391.283] (-390.687) (-390.145) -- 0:00:02
963000 -- (-394.580) [-393.598] (-389.209) (-390.737) * (-393.364) (-391.143) (-389.298) [-392.677] -- 0:00:02
963500 -- (-390.221) (-396.386) [-389.929] (-390.592) * (-395.680) (-390.544) (-390.074) [-390.372] -- 0:00:02
964000 -- [-390.229] (-391.974) (-389.692) (-391.986) * (-391.396) [-390.771] (-398.197) (-390.966) -- 0:00:02
964500 -- (-389.365) (-394.376) [-389.805] (-390.568) * (-393.086) (-388.982) (-392.411) [-391.267] -- 0:00:02
965000 -- [-389.378] (-391.700) (-390.770) (-394.386) * (-392.201) (-389.336) [-390.421] (-392.211) -- 0:00:02
Average standard deviation of split frequencies: 0.006409
965500 -- (-390.123) (-391.323) (-390.476) [-391.615] * (-398.266) (-389.915) [-391.126] (-391.174) -- 0:00:02
966000 -- (-390.123) (-390.116) [-390.451] (-392.742) * [-390.701] (-392.890) (-393.356) (-391.627) -- 0:00:02
966500 -- (-392.493) (-390.442) (-392.556) [-394.905] * (-392.216) (-390.519) [-389.752] (-392.737) -- 0:00:02
967000 -- (-391.691) [-391.638] (-393.703) (-392.932) * [-390.759] (-391.204) (-397.721) (-395.153) -- 0:00:01
967500 -- [-389.734] (-390.840) (-394.780) (-389.576) * (-392.106) [-394.627] (-391.843) (-389.924) -- 0:00:01
968000 -- (-389.558) (-392.065) (-393.291) [-392.055] * (-394.398) (-392.689) (-389.758) [-390.154] -- 0:00:01
968500 -- (-389.626) [-390.651] (-391.038) (-389.401) * (-394.444) (-389.023) (-396.038) [-389.994] -- 0:00:01
969000 -- [-390.620] (-390.777) (-390.567) (-389.839) * (-393.571) [-389.455] (-389.417) (-391.065) -- 0:00:01
969500 -- [-392.589] (-391.376) (-392.921) (-389.667) * (-392.572) (-391.322) [-390.998] (-391.386) -- 0:00:01
970000 -- (-391.473) [-394.403] (-391.891) (-390.164) * [-390.662] (-390.510) (-391.958) (-391.573) -- 0:00:01
Average standard deviation of split frequencies: 0.006411
970500 -- [-390.128] (-390.601) (-390.962) (-391.886) * (-395.182) (-390.287) [-391.191] (-388.963) -- 0:00:01
971000 -- (-389.468) (-391.112) (-393.289) [-390.104] * [-390.249] (-390.203) (-389.867) (-394.968) -- 0:00:01
971500 -- (-391.435) (-391.394) (-390.282) [-392.029] * [-391.690] (-392.824) (-391.860) (-389.966) -- 0:00:01
972000 -- (-390.735) (-391.793) (-389.289) [-393.745] * [-391.318] (-392.670) (-391.099) (-389.866) -- 0:00:01
972500 -- (-391.377) (-390.735) [-390.991] (-394.721) * (-389.501) (-391.016) (-391.864) [-391.283] -- 0:00:01
973000 -- (-390.155) [-390.402] (-389.660) (-391.413) * [-391.398] (-390.441) (-390.537) (-392.663) -- 0:00:01
973500 -- [-390.761] (-391.476) (-390.302) (-390.066) * (-391.531) [-395.194] (-391.377) (-393.061) -- 0:00:01
974000 -- (-392.457) (-393.404) (-389.984) [-390.033] * (-392.550) (-396.235) (-392.468) [-390.536] -- 0:00:01
974500 -- (-391.021) (-395.178) [-390.310] (-390.702) * (-393.417) (-392.575) (-391.841) [-392.693] -- 0:00:01
975000 -- (-391.497) (-392.911) [-392.222] (-391.607) * (-392.080) [-390.509] (-391.047) (-392.358) -- 0:00:01
Average standard deviation of split frequencies: 0.006665
975500 -- [-392.762] (-391.868) (-397.269) (-390.388) * [-391.576] (-390.931) (-392.566) (-393.908) -- 0:00:01
976000 -- [-390.029] (-390.297) (-391.979) (-393.821) * (-390.379) [-392.309] (-391.478) (-393.607) -- 0:00:01
976500 -- (-392.729) (-389.468) [-393.004] (-390.849) * (-392.149) [-394.932] (-390.456) (-395.708) -- 0:00:01
977000 -- (-395.407) (-388.967) [-389.066] (-389.925) * (-394.094) (-390.816) (-391.777) [-393.573] -- 0:00:01
977500 -- [-389.937] (-390.765) (-391.693) (-392.074) * (-390.224) [-390.086] (-393.289) (-389.641) -- 0:00:01
978000 -- (-391.753) (-395.785) [-390.113] (-391.575) * (-389.850) (-390.166) [-391.264] (-393.100) -- 0:00:01
978500 -- (-391.321) (-389.605) (-391.784) [-389.433] * (-393.862) (-390.700) (-389.352) [-396.535] -- 0:00:01
979000 -- (-393.743) (-389.773) [-392.237] (-392.762) * (-390.091) (-391.480) (-392.452) [-395.030] -- 0:00:01
979500 -- (-392.959) (-390.896) (-394.502) [-389.706] * (-391.394) (-395.509) [-390.250] (-395.889) -- 0:00:01
980000 -- (-389.698) (-391.179) (-392.352) [-391.359] * (-393.371) (-389.669) (-397.217) [-394.852] -- 0:00:01
Average standard deviation of split frequencies: 0.006858
980500 -- (-391.563) [-390.502] (-393.365) (-391.808) * [-390.383] (-392.740) (-393.321) (-391.838) -- 0:00:01
981000 -- (-393.970) [-390.275] (-392.579) (-390.075) * (-393.067) [-392.517] (-395.530) (-390.267) -- 0:00:01
981500 -- (-394.413) [-392.486] (-394.137) (-389.466) * [-392.590] (-393.999) (-390.412) (-389.511) -- 0:00:01
982000 -- (-391.475) (-394.717) (-391.300) [-393.329] * (-394.346) (-390.281) [-391.215] (-393.119) -- 0:00:01
982500 -- (-390.729) (-389.630) (-392.019) [-390.999] * [-390.083] (-390.580) (-390.896) (-390.396) -- 0:00:01
983000 -- [-391.499] (-392.525) (-391.775) (-391.070) * (-391.837) (-391.435) (-391.493) [-391.397] -- 0:00:01
983500 -- [-390.401] (-395.524) (-393.263) (-391.396) * (-394.433) (-399.370) (-394.241) [-391.709] -- 0:00:00
984000 -- [-389.918] (-391.467) (-390.690) (-392.096) * (-390.365) (-390.438) (-389.912) [-389.750] -- 0:00:00
984500 -- (-391.905) (-391.809) [-390.872] (-392.204) * [-392.531] (-389.227) (-392.066) (-391.394) -- 0:00:00
985000 -- (-391.579) (-391.204) [-389.934] (-391.787) * (-392.558) (-389.227) (-392.362) [-391.816] -- 0:00:00
Average standard deviation of split frequencies: 0.006661
985500 -- [-389.825] (-395.128) (-391.829) (-391.075) * (-393.079) (-390.987) [-393.113] (-391.090) -- 0:00:00
986000 -- (-390.675) (-394.842) [-389.094] (-390.660) * (-391.820) (-391.022) (-395.507) [-391.517] -- 0:00:00
986500 -- [-392.995] (-391.471) (-389.150) (-389.291) * (-390.504) [-390.269] (-392.674) (-390.807) -- 0:00:00
987000 -- (-389.967) (-389.483) (-391.759) [-390.546] * [-391.954] (-390.717) (-392.649) (-390.249) -- 0:00:00
987500 -- (-390.256) (-391.905) (-391.461) [-389.896] * (-393.406) (-392.986) (-393.890) [-390.350] -- 0:00:00
988000 -- (-390.513) (-390.860) [-390.678] (-393.653) * (-392.112) (-391.195) [-393.946] (-393.120) -- 0:00:00
988500 -- [-390.761] (-389.212) (-390.524) (-391.828) * (-392.579) [-390.382] (-390.629) (-389.506) -- 0:00:00
989000 -- [-391.786] (-391.302) (-390.648) (-392.033) * [-393.614] (-392.369) (-391.562) (-390.334) -- 0:00:00
989500 -- [-390.022] (-391.083) (-394.006) (-391.875) * (-391.469) (-392.053) [-392.095] (-390.869) -- 0:00:00
990000 -- (-392.093) (-391.723) (-392.474) [-392.241] * (-390.649) (-394.008) [-392.180] (-393.278) -- 0:00:00
Average standard deviation of split frequencies: 0.006472
990500 -- [-390.530] (-392.173) (-393.276) (-391.708) * (-391.769) [-394.682] (-390.341) (-396.871) -- 0:00:00
991000 -- (-391.083) (-391.480) [-390.952] (-390.204) * (-394.511) [-394.954] (-391.269) (-395.204) -- 0:00:00
991500 -- [-392.651] (-390.268) (-390.682) (-390.908) * [-394.639] (-394.892) (-391.897) (-397.041) -- 0:00:00
992000 -- (-394.427) (-391.298) [-390.624] (-396.922) * (-390.215) (-393.529) [-390.118] (-395.755) -- 0:00:00
992500 -- (-393.656) (-391.386) [-390.542] (-390.817) * (-391.914) [-400.176] (-390.397) (-393.971) -- 0:00:00
993000 -- (-390.474) (-393.621) [-389.819] (-390.745) * [-391.511] (-390.995) (-391.922) (-390.699) -- 0:00:00
993500 -- (-393.222) [-391.973] (-392.403) (-391.476) * (-389.596) [-393.429] (-390.520) (-394.180) -- 0:00:00
994000 -- (-390.115) (-390.318) (-395.484) [-391.097] * (-390.241) (-392.288) [-390.523] (-391.102) -- 0:00:00
994500 -- (-391.169) (-390.814) [-390.889] (-391.680) * (-391.265) (-392.922) [-390.082] (-391.806) -- 0:00:00
995000 -- (-391.132) (-390.133) (-391.957) [-393.816] * (-391.722) [-391.167] (-390.221) (-391.693) -- 0:00:00
Average standard deviation of split frequencies: 0.006626
995500 -- (-392.270) [-389.786] (-392.603) (-391.713) * [-391.547] (-393.403) (-393.516) (-390.841) -- 0:00:00
996000 -- (-390.805) (-389.901) [-391.520] (-393.897) * (-391.215) (-391.821) [-391.926] (-392.367) -- 0:00:00
996500 -- [-392.933] (-391.716) (-390.440) (-391.060) * (-392.558) [-393.449] (-392.280) (-389.570) -- 0:00:00
997000 -- (-398.282) (-391.796) (-392.871) [-391.730] * (-392.996) [-392.301] (-391.283) (-389.213) -- 0:00:00
997500 -- (-391.894) (-389.119) (-391.904) [-394.088] * (-391.106) (-390.469) (-390.044) [-389.965] -- 0:00:00
998000 -- (-391.113) (-393.505) (-389.549) [-389.781] * (-394.924) (-391.384) [-393.608] (-391.111) -- 0:00:00
998500 -- (-390.602) (-391.831) (-390.224) [-391.518] * (-390.985) (-391.705) (-390.573) [-392.208] -- 0:00:00
999000 -- (-390.254) [-390.536] (-390.329) (-391.349) * (-389.370) (-392.583) [-394.509] (-392.713) -- 0:00:00
999500 -- [-390.300] (-390.922) (-393.043) (-391.948) * (-389.862) (-390.562) (-396.779) [-392.109] -- 0:00:00
1000000 -- (-392.329) [-390.279] (-398.307) (-394.635) * (-390.443) (-393.186) (-398.073) [-391.391] -- 0:00:00
Average standard deviation of split frequencies: 0.006501
Analysis completed in 60 seconds
Analysis used 58.39 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -388.88
Likelihood of best state for "cold" chain of run 2 was -388.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 65 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
40.1 % ( 35 %) Dirichlet(Pi{all})
38.8 % ( 25 %) Slider(Pi{all})
79.0 % ( 41 %) Multiplier(Alpha{1,2})
78.3 % ( 59 %) Multiplier(Alpha{3})
26.1 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.7 % ( 24 %) Dirichlet(Pi{all})
38.9 % ( 31 %) Slider(Pi{all})
78.9 % ( 47 %) Multiplier(Alpha{1,2})
78.0 % ( 54 %) Multiplier(Alpha{3})
26.3 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167512 0.82 0.67
3 | 166301 166627 0.84
4 | 166769 166533 166258
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166358 0.82 0.66
3 | 167181 166320 0.84
4 | 166786 166821 166534
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -390.59
| 1 |
| 1 2 2 2 22 2 |
| 1 1 1 1 2 22 1 1 1 |
| 2 2 2 1 22 2 1121 2 12 |
|2 2 1 * 2 * 22 1 2 1 1 1 12 1 * 1|
|1 2 1 12 2 2 1 2 21 * 1 |
| 2 2 1 1 1 1 12 1 2 |
| * 1 2 1 11 1 2 1 2 2 12 11 2 |
| 21 1 2 2 1 1 2 1 |
| 2 2 12 2 2 |
| 21 2 1 2 |
| 1 1 11 |
| |
| |
| 2 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -392.66
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.62 -394.63
2 -390.60 -395.00
--------------------------------------
TOTAL -390.61 -394.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898012 0.090087 0.366441 1.483847 0.870130 1277.07 1362.65 1.000
r(A<->C){all} 0.163706 0.020485 0.000011 0.461322 0.123866 128.64 191.47 1.003
r(A<->G){all} 0.174655 0.021276 0.000064 0.474495 0.134779 202.12 224.97 1.000
r(A<->T){all} 0.169908 0.021360 0.000077 0.459273 0.131684 222.98 230.92 1.002
r(C<->G){all} 0.164915 0.018676 0.000015 0.442295 0.127004 196.10 199.90 1.006
r(C<->T){all} 0.164712 0.020209 0.000007 0.448557 0.126708 185.66 198.41 1.010
r(G<->T){all} 0.162105 0.018823 0.000007 0.431085 0.124892 188.06 276.22 1.001
pi(A){all} 0.188399 0.000540 0.146031 0.236961 0.187837 1164.96 1278.56 1.000
pi(C){all} 0.226211 0.000585 0.178264 0.271718 0.225784 1283.23 1324.82 1.000
pi(G){all} 0.366239 0.000796 0.313485 0.421524 0.366110 1082.11 1240.89 1.000
pi(T){all} 0.219152 0.000594 0.172697 0.266847 0.219326 1080.27 1178.14 1.001
alpha{1,2} 0.411381 0.221647 0.000129 1.345447 0.245221 1301.82 1332.70 1.000
alpha{3} 0.461645 0.225800 0.000166 1.476337 0.307520 983.51 1054.78 1.000
pinvar{all} 0.994342 0.000045 0.981647 0.999995 0.996460 959.24 1057.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ...**.
9 -- .*...*
10 -- .***.*
11 -- .*.*..
12 -- ...*.*
13 -- .*..*.
14 -- .**...
15 -- .**.**
16 -- ..*.*.
17 -- ..*..*
18 -- ..****
19 -- ....**
20 -- .****.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.005653 0.148568 0.156562 2
8 455 0.151566 0.007066 0.146569 0.156562 2
9 449 0.149567 0.004240 0.146569 0.152565 2
10 442 0.147235 0.000942 0.146569 0.147901 2
11 436 0.145237 0.014133 0.135243 0.155230 2
12 435 0.144903 0.019315 0.131246 0.158561 2
13 433 0.144237 0.005182 0.140573 0.147901 2
14 432 0.143904 0.001884 0.142572 0.145237 2
15 423 0.140906 0.000471 0.140573 0.141239 2
16 422 0.140573 0.008480 0.134577 0.146569 2
17 419 0.139574 0.002355 0.137908 0.141239 2
18 416 0.138574 0.004711 0.135243 0.141905 2
19 414 0.137908 0.012248 0.129247 0.146569 2
20 403 0.134244 0.004240 0.131246 0.137242 2
21 402 0.133911 0.006595 0.129247 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100778 0.010676 0.000031 0.303830 0.068343 1.000 2
length{all}[2] 0.098626 0.009740 0.000010 0.283302 0.068580 1.000 2
length{all}[3] 0.099548 0.009346 0.000016 0.295012 0.071170 1.000 2
length{all}[4] 0.099507 0.009508 0.000051 0.285587 0.071304 1.000 2
length{all}[5] 0.101064 0.010538 0.000030 0.300826 0.069801 1.000 2
length{all}[6] 0.098784 0.010121 0.000008 0.304380 0.067458 1.000 2
length{all}[7] 0.101584 0.011142 0.000054 0.319712 0.068007 1.000 2
length{all}[8] 0.109847 0.012027 0.000131 0.329352 0.075237 1.007 2
length{all}[9] 0.097007 0.011899 0.000017 0.300650 0.064022 1.003 2
length{all}[10] 0.095511 0.010348 0.000657 0.301356 0.057988 0.998 2
length{all}[11] 0.102326 0.009001 0.000640 0.287747 0.071732 0.999 2
length{all}[12] 0.099788 0.011563 0.000383 0.338891 0.062292 0.998 2
length{all}[13] 0.099710 0.009746 0.000009 0.307876 0.064445 1.000 2
length{all}[14] 0.104544 0.011807 0.000050 0.311117 0.071524 0.999 2
length{all}[15] 0.100940 0.009673 0.000040 0.299996 0.068165 0.998 2
length{all}[16] 0.106601 0.011262 0.000052 0.302845 0.078953 1.000 2
length{all}[17] 0.094267 0.010126 0.000366 0.281033 0.062359 0.998 2
length{all}[18] 0.091330 0.007766 0.000083 0.275511 0.063992 0.998 2
length{all}[19] 0.105338 0.013100 0.000270 0.304920 0.072408 0.999 2
length{all}[20] 0.098681 0.010150 0.000287 0.313421 0.066956 0.998 2
length{all}[21] 0.101900 0.010447 0.000427 0.307048 0.071630 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006501
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 288
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 96 / 96 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 96 / 96 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063065 0.080704 0.075981 0.049802 0.075793 0.046369 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -414.714305
Iterating by ming2
Initial: fx= 414.714305
x= 0.06307 0.08070 0.07598 0.04980 0.07579 0.04637 0.30000 1.30000
1 h-m-p 0.0000 0.0005 231.5529 +++ 388.395817 m 0.0005 14 | 1/8
2 h-m-p 0.0039 0.0246 26.4086 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 213.0890 ++ 386.751281 m 0.0000 46 | 2/8
4 h-m-p 0.0003 0.0616 21.4023 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 190.5418 ++ 381.652759 m 0.0001 76 | 3/8
6 h-m-p 0.0013 0.0848 17.4494 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 165.3161 ++ 377.961186 m 0.0001 107 | 4/8
8 h-m-p 0.0014 0.1106 13.4762 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 135.2844 ++ 377.924658 m 0.0000 138 | 5/8
10 h-m-p 0.0003 0.1639 9.2107 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 95.6211 ++ 377.466229 m 0.0001 168 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ---C 377.466229 0 0.0063 182 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 ------N 377.466229 0 0.0000 201
Out..
lnL = -377.466229
202 lfun, 202 eigenQcodon, 1212 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090002 0.086924 0.076046 0.065366 0.106305 0.073915 0.299939 0.766297 0.205810
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.559275
np = 9
lnL0 = -420.504202
Iterating by ming2
Initial: fx= 420.504202
x= 0.09000 0.08692 0.07605 0.06537 0.10630 0.07392 0.29994 0.76630 0.20581
1 h-m-p 0.0000 0.0008 196.5945 ++++ 387.395914 m 0.0008 16 | 1/9
2 h-m-p 0.0000 0.0002 213.1150 ++ 383.430758 m 0.0002 28 | 2/9
3 h-m-p 0.0000 0.0002 99.4293 ++ 382.428808 m 0.0002 40 | 3/9
4 h-m-p 0.0000 0.0000 1174.0597 ++ 379.243839 m 0.0000 52 | 4/9
5 h-m-p 0.0000 0.0000 980.2144 ++ 378.690902 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 4972.0045 ++ 377.466167 m 0.0000 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 377.466167 m 8.0000 88 | 6/9
8 h-m-p 0.0133 6.6726 0.1511 ----------Y 377.466167 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0015 +++++ 377.466164 m 8.0000 131 | 6/9
10 h-m-p 0.0623 4.2852 0.1947 -----------Y 377.466164 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0011 +++++ 377.466162 m 8.0000 175 | 6/9
12 h-m-p 0.0384 3.4740 0.2346 -----------Y 377.466162 0 0.0000 201 | 6/9
13 h-m-p 0.0160 8.0000 0.0213 +++++ 377.466105 m 8.0000 219 | 6/9
14 h-m-p 0.6182 3.5601 0.2759 ----------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0007 +++++ 377.466100 m 8.0000 266 | 6/9
16 h-m-p 0.0615 8.0000 0.0968 -------------Y 377.466100 0 0.0000 294 | 6/9
17 h-m-p 0.0160 8.0000 0.0009 +++++ 377.466096 m 8.0000 312 | 6/9
18 h-m-p 0.0475 7.8365 0.1538 -------------Y 377.466096 0 0.0000 340 | 6/9
19 h-m-p 0.0154 7.6957 0.0030 +++++ 377.466084 m 7.6957 358 | 7/9
20 h-m-p 0.0869 0.4344 0.0406 ++ 377.466078 m 0.4344 373 | 8/9
21 h-m-p 0.0384 0.6722 0.3966 +++ 377.466061 m 0.6722 388 | 9/9
22 h-m-p 0.0160 8.0000 0.0000 Y 377.466061 0 0.0160 401 | 9/9
23 h-m-p 0.0160 8.0000 0.0000 Y 377.466061 0 0.0160 413
Out..
lnL = -377.466061
414 lfun, 1242 eigenQcodon, 4968 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052452 0.037000 0.076951 0.070975 0.077037 0.068464 0.000100 1.153354 0.509069 0.479293 1.416497
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.239810
np = 11
lnL0 = -412.559208
Iterating by ming2
Initial: fx= 412.559208
x= 0.05245 0.03700 0.07695 0.07097 0.07704 0.06846 0.00011 1.15335 0.50907 0.47929 1.41650
1 h-m-p 0.0000 0.0000 216.8457 ++ 412.002025 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 136.9127 ++++ 392.023369 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0002 269.9399 ++ 385.336085 m 0.0002 46 | 3/11
4 h-m-p 0.0010 0.0051 38.2046 ++ 378.667150 m 0.0051 60 | 4/11
5 h-m-p 0.0000 0.0000 2893.8449 ++ 378.165047 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 552.3192 ++ 377.758107 m 0.0001 88 | 6/11
7 h-m-p 0.0019 0.1224 8.6390 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 133.0880 ++ 377.470484 m 0.0000 126 | 7/11
9 h-m-p 0.0020 0.9883 1.3520 ------------.. | 7/11
10 h-m-p 0.0000 0.0000 94.4020 ++ 377.466197 m 0.0000 164 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 Y 377.466197 0 0.0358 178 | 8/11
12 h-m-p 0.0693 8.0000 0.0000 ------------C 377.466197 0 0.0000 207
Out..
lnL = -377.466197
208 lfun, 832 eigenQcodon, 3744 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -377.472338 S = -377.464748 -0.002902
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:03
did 20 / 46 patterns 0:03
did 30 / 46 patterns 0:03
did 40 / 46 patterns 0:03
did 46 / 46 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107549 0.102983 0.042188 0.090333 0.048170 0.075986 0.000100 0.350366 1.632946
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 25.730158
np = 9
lnL0 = -416.824801
Iterating by ming2
Initial: fx= 416.824801
x= 0.10755 0.10298 0.04219 0.09033 0.04817 0.07599 0.00011 0.35037 1.63295
1 h-m-p 0.0000 0.0000 190.1348 ++ 416.730967 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0135 27.0589 +++++ 411.190480 m 0.0135 29 | 2/9
3 h-m-p 0.0005 0.0023 123.8437 ++ 399.685576 m 0.0023 41 | 3/9
4 h-m-p 0.0003 0.0014 47.3229 ++ 396.229123 m 0.0014 53 | 4/9
5 h-m-p 0.0004 0.0021 24.3179 ++ 396.190360 m 0.0021 65 | 5/9
6 h-m-p 0.0001 0.0006 104.3653 ++ 392.254653 m 0.0006 77 | 6/9
7 h-m-p 0.0014 0.0070 22.7328 ++ 390.230862 m 0.0070 89 | 7/9
8 h-m-p 0.0975 8.0000 1.3017 --------------.. | 7/9
9 h-m-p 0.0000 0.0021 73.6868 ++++ 377.466061 m 0.0021 127 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 377.466061 0 1.6000 139 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 377.466061 0 1.6000 152
Out..
lnL = -377.466061
153 lfun, 1683 eigenQcodon, 9180 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103326 0.077775 0.076392 0.060222 0.099872 0.088270 0.000100 0.900000 0.258364 1.146891 1.299850
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.872231
np = 11
lnL0 = -417.206537
Iterating by ming2
Initial: fx= 417.206537
x= 0.10333 0.07778 0.07639 0.06022 0.09987 0.08827 0.00011 0.90000 0.25836 1.14689 1.29985
1 h-m-p 0.0000 0.0000 165.9659 ++ 417.134697 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0017 161.8135 ++++ 390.155509 m 0.0017 32 | 2/11
3 h-m-p 0.0000 0.0001 959.2111 ++ 383.272538 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0007 30.9662 ++ 382.757409 m 0.0007 60 | 4/11
5 h-m-p 0.0000 0.0000 1959.7859 ++ 382.130982 m 0.0000 74 | 5/11
6 h-m-p 0.0016 0.0082 9.3642 ++ 380.115169 m 0.0082 88 | 6/11
7 h-m-p 0.0000 0.0000 3110.7893 ++ 379.894443 m 0.0000 102 | 7/11
8 h-m-p 0.0000 0.0001 1730.4507 ++ 377.466167 m 0.0001 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0002 ++ 377.466167 m 8.0000 130 | 8/11
10 h-m-p 0.0089 4.4501 0.2005 -------------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0003 +++++ 377.466166 m 8.0000 178 | 8/11
12 h-m-p 0.0112 4.4162 0.1851 ----------Y 377.466166 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0011 +++++ 377.466164 m 8.0000 225 | 8/11
14 h-m-p 0.0479 4.6164 0.1911 -------------C 377.466164 0 0.0000 255 | 8/11
15 h-m-p 0.0160 8.0000 0.0009 +++++ 377.466162 m 8.0000 275 | 8/11
16 h-m-p 0.0376 4.0140 0.1898 -----------Y 377.466162 0 0.0000 303 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 ----N 377.466162 0 0.0000 324 | 8/11
18 h-m-p 0.0160 8.0000 0.0030 +++++ 377.466156 m 8.0000 344 | 8/11
19 h-m-p 0.1261 4.9626 0.1897 -------------Y 377.466156 0 0.0000 374 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 -----Y 377.466156 0 0.0000 396 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 377.466156 m 8.0000 416 | 8/11
22 h-m-p 0.0101 5.0337 0.2020 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0003 +++++ 377.466155 m 8.0000 464 | 8/11
24 h-m-p 0.0158 5.2159 0.1637 ------------N 377.466155 0 0.0000 493 | 8/11
25 h-m-p 0.0160 8.0000 0.0128 +++++ 377.466108 m 8.0000 513 | 8/11
26 h-m-p 0.5137 4.9154 0.1996 --------------C 377.466108 0 0.0000 544 | 8/11
27 h-m-p 0.0160 8.0000 0.0028 +++++ 377.466093 m 8.0000 564 | 8/11
28 h-m-p 0.1668 8.0000 0.1341 ---------------.. | 8/11
29 h-m-p 0.0160 8.0000 0.0008 +++++ 377.466088 m 8.0000 614 | 8/11
30 h-m-p 0.0636 8.0000 0.1031 --------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0009 +++++ 377.466081 m 8.0000 663 | 8/11
32 h-m-p 0.0701 8.0000 0.0998 --------------.. | 8/11
33 h-m-p 0.0160 8.0000 0.0009 +++++ 377.466074 m 8.0000 712 | 8/11
34 h-m-p 0.0781 8.0000 0.0964 --------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0010 +++++ 377.466065 m 8.0000 761 | 8/11
36 h-m-p 0.0881 8.0000 0.0927 --------------.. | 8/11
37 h-m-p 0.0061 3.0472 0.0011 +++++ 377.466061 m 3.0472 810 | 9/11
38 h-m-p 1.6000 8.0000 0.0000 Y 377.466061 0 1.6000 827 | 9/11
39 h-m-p 0.0341 8.0000 0.0000 -------Y 377.466061 0 0.0000 850
Out..
lnL = -377.466061
851 lfun, 10212 eigenQcodon, 56166 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -377.498278 S = -377.466561 -0.013992
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:19
did 20 / 46 patterns 0:19
did 30 / 46 patterns 0:19
did 40 / 46 patterns 0:19
did 46 / 46 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96
NC_011896_1_WP_010908429_1_1703_MLBR_RS08065 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
NC_002677_1_NP_302108_1_980_ML1607 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET
**************************************************
NC_011896_1_WP_010908429_1_1703_MLBR_RS08065 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
NC_002677_1_NP_302108_1_980_ML1607 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030 AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
**********************************************
>NC_011896_1_WP_010908429_1_1703_MLBR_RS08065 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT >NC_002677_1_NP_302108_1_980_ML1607 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT >NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT >NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT >NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT >NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030 ATGACGACCCACAAGGCTATGACTCGAGTCCAGTTGGAGGCGATGGGCGA GGTGTTCGCGGTGGATAACCTGACGAGGATGGGGTTGCGGGGTTTGCACT GCAACTGGCGTTGTCGCTATGGCGAATGCGATGTGATCGCTTCCGAGACG GCCCACCGCACGGTGGTGTCGAGGCTAAGATCCATAGCGGCTACGGTTAT GGAGGGCTCGCGCAGGTCAGCGCCCGAGCAGAAGGTTCGTTGGCTGCGTT GGTTGGCTGGTTTATGGCCGGCGAATCAAGACGAATTT
>NC_011896_1_WP_010908429_1_1703_MLBR_RS08065 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF >NC_002677_1_NP_302108_1_980_ML1607 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF >NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF >NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF >NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF >NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030 MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASET AHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
#NEXUS
[ID: 5448277417]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908429_1_1703_MLBR_RS08065
NC_002677_1_NP_302108_1_980_ML1607
NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790
NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385
NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820
NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908429_1_1703_MLBR_RS08065,
2 NC_002677_1_NP_302108_1_980_ML1607,
3 NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790,
4 NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385,
5 NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820,
6 NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06834302,2:0.06857996,3:0.07116951,4:0.07130443,5:0.06980144,6:0.06745824);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06834302,2:0.06857996,3:0.07116951,4:0.07130443,5:0.06980144,6:0.06745824);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.62 -394.63
2 -390.60 -395.00
--------------------------------------
TOTAL -390.61 -394.83
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1607/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898012 0.090087 0.366441 1.483847 0.870130 1277.07 1362.65 1.000
r(A<->C){all} 0.163706 0.020485 0.000011 0.461322 0.123866 128.64 191.47 1.003
r(A<->G){all} 0.174655 0.021276 0.000064 0.474495 0.134779 202.12 224.97 1.000
r(A<->T){all} 0.169908 0.021360 0.000077 0.459273 0.131684 222.98 230.92 1.002
r(C<->G){all} 0.164915 0.018676 0.000015 0.442295 0.127004 196.10 199.90 1.006
r(C<->T){all} 0.164712 0.020209 0.000007 0.448557 0.126708 185.66 198.41 1.010
r(G<->T){all} 0.162105 0.018823 0.000007 0.431085 0.124892 188.06 276.22 1.001
pi(A){all} 0.188399 0.000540 0.146031 0.236961 0.187837 1164.96 1278.56 1.000
pi(C){all} 0.226211 0.000585 0.178264 0.271718 0.225784 1283.23 1324.82 1.000
pi(G){all} 0.366239 0.000796 0.313485 0.421524 0.366110 1082.11 1240.89 1.000
pi(T){all} 0.219152 0.000594 0.172697 0.266847 0.219326 1080.27 1178.14 1.001
alpha{1,2} 0.411381 0.221647 0.000129 1.345447 0.245221 1301.82 1332.70 1.000
alpha{3} 0.461645 0.225800 0.000166 1.476337 0.307520 983.51 1054.78 1.000
pinvar{all} 0.994342 0.000045 0.981647 0.999995 0.996460 959.24 1057.26 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1607/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 96
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 1 1 1 1 1 1 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 5 5 5 5 5 5 | ACG 5 5 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 1 1 1 1 1 1 | GCC 1 1 1 1 1 1 | GAC 1 1 1 1 1 1 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 5 5 5 5 5 5 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908429_1_1703_MLBR_RS08065
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
#2: NC_002677_1_NP_302108_1_980_ML1607
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
#3: NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
#4: NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
#5: NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
#6: NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 6 | TCC 12 | TAC 0 | TGC 12
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 18
CTC 0 | CCC 6 | CAC 18 | CGC 18
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 6
CTG 12 | CCG 6 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 6 | ACC 6 | AAC 12 | AGC 0
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 30 | ACG 30 | AAG 12 | AGG 18
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 12
GTC 6 | GCC 6 | GAC 6 | GGC 18
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 0
GTG 30 | GCG 30 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20833 C:0.19792 A:0.23958 G:0.35417
position 2: T:0.26042 C:0.25000 A:0.22917 G:0.26042
position 3: T:0.18750 C:0.22917 A:0.09375 G:0.48958
Average T:0.21875 C:0.22569 A:0.18750 G:0.36806
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -377.466229 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299939 1.299850
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908429_1_1703_MLBR_RS08065: 0.000004, NC_002677_1_NP_302108_1_980_ML1607: 0.000004, NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790: 0.000004, NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385: 0.000004, NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820: 0.000004, NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29994
omega (dN/dS) = 1.29985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 231.9 56.1 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -377.466061 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908429_1_1703_MLBR_RS08065: 0.000004, NC_002677_1_NP_302108_1_980_ML1607: 0.000004, NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790: 0.000004, NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385: 0.000004, NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820: 0.000004, NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -377.466197 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.566560 0.265327 0.000001 1.496894
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908429_1_1703_MLBR_RS08065: 0.000004, NC_002677_1_NP_302108_1_980_ML1607: 0.000004, NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790: 0.000004, NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385: 0.000004, NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820: 0.000004, NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.56656 0.26533 0.16811
w: 0.00000 1.00000 1.49689
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
7..2 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
7..3 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
7..4 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
7..5 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
7..6 0.000 233.6 54.4 0.5170 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908429_1_1703_MLBR_RS08065)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908429_1_1703_MLBR_RS08065)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -377.466061 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.452906
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908429_1_1703_MLBR_RS08065: 0.000004, NC_002677_1_NP_302108_1_980_ML1607: 0.000004, NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790: 0.000004, NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385: 0.000004, NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820: 0.000004, NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.45291
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -377.466061 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.109678 1.374773
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908429_1_1703_MLBR_RS08065: 0.000004, NC_002677_1_NP_302108_1_980_ML1607: 0.000004, NZ_LVXE01000006_1_WP_010908429_1_2327_A3216_RS03790: 0.000004, NZ_LYPH01000002_1_WP_010908429_1_296_A8144_RS01385: 0.000004, NZ_CP029543_1_WP_010908429_1_1734_DIJ64_RS08820: 0.000004, NZ_AP014567_1_WP_010908429_1_1776_JK2ML_RS09030: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.10968
(p1 = 0.00001) w = 1.37477
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.37477
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 233.6 54.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908429_1_1703_MLBR_RS08065)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:19
Model 1: NearlyNeutral -377.466061 Model 2: PositiveSelection -377.466197 Model 0: one-ratio -377.466229 Model 7: beta -377.466061 Model 8: beta&w>1 -377.466061 Model 0 vs 1 3.359999999474894E-4 Model 2 vs 1 2.7199999999538704E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
