--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:08:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1632/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2075.83         -2078.98
2      -2075.80         -2078.71
--------------------------------------
TOTAL    -2075.82         -2078.85
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898384    0.092331    0.371219    1.506353    0.870004   1411.14   1456.07    1.001
r(A<->C){all}   0.181541    0.023680    0.000059    0.488817    0.138377    199.16    221.38    1.002
r(A<->G){all}   0.152221    0.017379    0.000043    0.425796    0.116235    237.96    270.20    1.001
r(A<->T){all}   0.164825    0.017904    0.000065    0.434862    0.132979    220.58    294.56    1.001
r(C<->G){all}   0.162650    0.017586    0.000077    0.420727    0.130573    296.63    308.34    1.002
r(C<->T){all}   0.174249    0.021137    0.000008    0.464906    0.135307    188.83    247.38    1.004
r(G<->T){all}   0.164514    0.019192    0.000068    0.438954    0.130859    208.00    233.66    1.001
pi(A){all}      0.187071    0.000100    0.167222    0.206231    0.187028   1226.41   1271.76    1.000
pi(C){all}      0.320575    0.000135    0.297581    0.342975    0.320574   1365.57   1367.35    1.000
pi(G){all}      0.307208    0.000137    0.284529    0.329793    0.306899   1000.46   1100.29    1.000
pi(T){all}      0.185147    0.000100    0.165988    0.204801    0.184871   1231.71   1334.70    1.000
alpha{1,2}      0.424564    0.243598    0.000130    1.403869    0.246499   1122.48   1175.86    1.000
alpha{3}        0.463468    0.239313    0.000120    1.463145    0.304868   1284.11   1296.48    1.000
pinvar{all}     0.999021    0.000001    0.996901    1.000000    0.999378   1185.33   1213.72    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2012.814506
Model 2: PositiveSelection	-2012.814405
Model 0: one-ratio	-2012.814406
Model 7: beta	-2012.814467
Model 8: beta&w>1	-2012.814405


Model 0 vs 1	1.999999999497959E-4

Model 2 vs 1	2.019999997173727E-4

Model 8 vs 7	1.239999996869301E-4
>C1
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C2
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C3
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C4
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C5
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C6
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=511 

C1              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C2              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C3              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C4              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C5              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C6              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
                **************************************************

C1              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C2              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C3              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C4              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C5              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C6              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
                **************************************************

C1              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C2              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C3              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C4              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C5              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C6              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
                **************************************************

C1              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C2              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C3              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C4              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C5              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C6              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
                **************************************************

C1              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C2              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C3              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C4              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C5              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C6              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
                **************************************************

C1              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C2              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C3              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C4              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C5              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C6              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
                **************************************************

C1              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C2              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C3              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C4              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C5              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C6              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
                **************************************************

C1              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C2              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C3              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C4              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C5              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C6              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
                **************************************************

C1              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C2              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C3              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C4              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C5              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C6              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
                **************************************************

C1              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C2              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C3              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C4              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C5              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C6              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
                **************************************************

C1              TLLPASLQCQP
C2              TLLPASLQCQP
C3              TLLPASLQCQP
C4              TLLPASLQCQP
C5              TLLPASLQCQP
C6              TLLPASLQCQP
                ***********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  511 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  511 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15330]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [15330]--->[15330]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.563 Mb, Max= 31.112 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C2              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C3              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C4              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C5              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
C6              MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
                **************************************************

C1              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C2              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C3              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C4              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C5              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
C6              VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
                **************************************************

C1              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C2              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C3              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C4              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C5              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
C6              NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
                **************************************************

C1              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C2              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C3              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C4              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C5              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
C6              DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
                **************************************************

C1              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C2              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C3              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C4              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C5              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
C6              AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
                **************************************************

C1              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C2              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C3              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C4              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C5              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
C6              PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
                **************************************************

C1              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C2              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C3              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C4              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C5              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
C6              DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
                **************************************************

C1              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C2              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C3              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C4              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C5              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
C6              AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
                **************************************************

C1              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C2              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C3              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C4              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C5              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
C6              IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
                **************************************************

C1              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C2              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C3              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C4              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C5              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
C6              HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
                **************************************************

C1              TLLPASLQCQP
C2              TLLPASLQCQP
C3              TLLPASLQCQP
C4              TLLPASLQCQP
C5              TLLPASLQCQP
C6              TLLPASLQCQP
                ***********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
C2              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
C3              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
C4              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
C5              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
C6              ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
                **************************************************

C1              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
C2              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
C3              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
C4              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
C5              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
C6              AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
                **************************************************

C1              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
C2              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
C3              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
C4              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
C5              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
C6              CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
                **************************************************

C1              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
C2              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
C3              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
C4              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
C5              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
C6              GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
                **************************************************

C1              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
C2              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
C3              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
C4              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
C5              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
C6              GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
                **************************************************

C1              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
C2              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
C3              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
C4              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
C5              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
C6              CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
                **************************************************

C1              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
C2              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
C3              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
C4              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
C5              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
C6              AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
                **************************************************

C1              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
C2              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
C3              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
C4              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
C5              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
C6              ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
                **************************************************

C1              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
C2              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
C3              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
C4              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
C5              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
C6              TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
                **************************************************

C1              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
C2              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
C3              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
C4              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
C5              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
C6              GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
                **************************************************

C1              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
C2              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
C3              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
C4              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
C5              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
C6              GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
                **************************************************

C1              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
C2              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
C3              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
C4              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
C5              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
C6              GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
                **************************************************

C1              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
C2              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
C3              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
C4              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
C5              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
C6              GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
                **************************************************

C1              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
C2              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
C3              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
C4              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
C5              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
C6              CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
                **************************************************

C1              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
C2              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
C3              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
C4              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
C5              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
C6              AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
                **************************************************

C1              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
C2              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
C3              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
C4              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
C5              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
C6              CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
                **************************************************

C1              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
C2              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
C3              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
C4              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
C5              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
C6              GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
                **************************************************

C1              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
C2              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
C3              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
C4              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
C5              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
C6              CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
                **************************************************

C1              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
C2              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
C3              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
C4              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
C5              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
C6              GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
                **************************************************

C1              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
C2              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
C3              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
C4              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
C5              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
C6              CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
                **************************************************

C1              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
C2              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
C3              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
C4              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
C5              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
C6              ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
                **************************************************

C1              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
C2              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
C3              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
C4              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
C5              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
C6              GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
                **************************************************

C1              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
C2              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
C3              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
C4              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
C5              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
C6              TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
                **************************************************

C1              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
C2              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
C3              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
C4              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
C5              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
C6              ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
                **************************************************

C1              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
C2              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
C3              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
C4              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
C5              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
C6              ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
                **************************************************

C1              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
C2              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
C3              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
C4              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
C5              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
C6              TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
                **************************************************

C1              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
C2              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
C3              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
C4              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
C5              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
C6              ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
                **************************************************

C1              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
C2              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
C3              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
C4              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
C5              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
C6              CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
                **************************************************

C1              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
C2              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
C3              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
C4              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
C5              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
C6              GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
                **************************************************

C1              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
C2              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
C3              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
C4              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
C5              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
C6              ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
                **************************************************

C1              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
C2              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
C3              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
C4              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
C5              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
C6              ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
                *********************************



>C1
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C2
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C3
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C4
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C5
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C6
ATGGTAGCCATGCCGAGCCTGAGATCGTTGAGCTCGGCGCTGCTTTCGTT
AGGGCTGTTGCTGCAACCGGCAATGACACCGCCGGTGGTTGGTGCCAGCC
CAGAGCAGACTCCTAGCCCGGTGCCGGAGCAGAACTGGGGTAATTGCAGT
GTGTTCCTGTCCGACACTAGCGACATCCCCTCGGCACGGTGTGCAACGGT
GTCGGTGCCGGTCGACTACAACAATCCTGATGGGGTGCACGCCGAATTGG
CGGTCATCCGCGCTCCAGCGACTGGCCAGCGGATCGGATCGCTGCTGTTC
AATCCGGGAGGACCCGGGGCGTCCGCGGTTGACATGGTCGCCGAAATGAT
ACCAGGGCTACAACGTACCGATATTGGCCGTCACTTCGACCTGGTGGGGT
TCGACCCGCGAGGAGTCGGCCACTCAACCCCGGCGCTTCGGTGTCGCACT
GACGTTGAGTTCGACGCGTACCGGACCGAACCGATGGTTGACTACAGCCC
GGCCGGTGTGGCGCACATCGAGCAAGTCTACAAGCAGCTCGCTCAACAGT
GTGTTGCCCGGGTCGGCACCGCATTTTTGGCGAACGTGGGAACTGCCTCG
GCCGCGCGCGACATGGATATAGTTCGCCTGGCTCTGGGAGACGAGCAGAT
CAATTACCTCGGTTATAGCTACGGCACCGAATTGGGTACCGCCTATCTCG
AGCGGTTCAGCGACCATGTGCGGGCGATGGTGCTTGACGGCGCTATTGAC
CCGAGTGTTAGCTCAATCCAGAAAGACATCCAGCAAATGGCCGGATTCCA
GATCGCATTTACCGACTATGCCGCGGACTGCGCCCGCTCGGCGTCCTGTC
CACTGGGCACTGACCCCAGCCAATGGGTCAACCGATACCATGCGCTGATC
GACCCGTTGGTTACCAAGCCGGGTCGGACGTCGGATCCACGCGGCCTGGG
CTACGCTGACGCGACCACCGGCACCATTAATGCGCTCTACACCCCGGTGC
ACTGGAAATACCTGACCAGTGGCTTGCTTGGGCTGCAGCGTGGCACCGAC
GCCGGTGACCTGCTATTGCTCGCCGACGACTACAACGGCCGGGACCGCAA
TGGGCACTACACCAACGACCAGGACGCGTTTAACGCGATCCGCTGCGTCG
ACGCGCCGGTGCCAACCGACTCGGCGAGCTGGGTATCGGCCGATCAGCAG
ATACGCCAGGCCGCTCCGTTCCTCAACTACGGGCAATTCACCGGCAACGC
TCCCCGCGATATCTGTGCACTGTGGCCGGTGCCGGCGACATCGATGCCGC
ACCCCGCGCCGCCGGTCGCGCCGGGCAAGGTTGTCGTGGTCTCCACAACG
CACGACCCGGCCACTCCATATCAGGCCGGGGTAGACCTGGCTCGCGAGCT
GAGCAGCCCGCTGATCACCTACGACGGAACCCAGCACACCGCGGTGTTCA
ACGGCGACCAGTGTGTGGATAGCGCGGTGGTGCATTATTTCGTGGACGAG
ACGTTGCTACCGGCGTCCTTACAATGTCAGCCC
>C1
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C2
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C3
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C4
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C5
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP
>C6
MVAMPSLRSLSSALLSLGLLLQPAMTPPVVGASPEQTPSPVPEQNWGNCS
VFLSDTSDIPSARCATVSVPVDYNNPDGVHAELAVIRAPATGQRIGSLLF
NPGGPGASAVDMVAEMIPGLQRTDIGRHFDLVGFDPRGVGHSTPALRCRT
DVEFDAYRTEPMVDYSPAGVAHIEQVYKQLAQQCVARVGTAFLANVGTAS
AARDMDIVRLALGDEQINYLGYSYGTELGTAYLERFSDHVRAMVLDGAID
PSVSSIQKDIQQMAGFQIAFTDYAADCARSASCPLGTDPSQWVNRYHALI
DPLVTKPGRTSDPRGLGYADATTGTINALYTPVHWKYLTSGLLGLQRGTD
AGDLLLLADDYNGRDRNGHYTNDQDAFNAIRCVDAPVPTDSASWVSADQQ
IRQAAPFLNYGQFTGNAPRDICALWPVPATSMPHPAPPVAPGKVVVVSTT
HDPATPYQAGVDLARELSSPLITYDGTQHTAVFNGDQCVDSAVVHYFVDE
TLLPASLQCQP


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1533 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856803
      Setting output file names to "/data/7res/ML1632/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2051327096
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5461409203
      Seed = 2045487364
      Swapseed = 1579856803
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3430.927496 -- -24.965149
         Chain 2 -- -3430.927496 -- -24.965149
         Chain 3 -- -3430.927300 -- -24.965149
         Chain 4 -- -3430.927496 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3430.927300 -- -24.965149
         Chain 2 -- -3430.927300 -- -24.965149
         Chain 3 -- -3430.927300 -- -24.965149
         Chain 4 -- -3430.927496 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3430.927] (-3430.927) (-3430.927) (-3430.927) * [-3430.927] (-3430.927) (-3430.927) (-3430.927) 
        500 -- (-2133.181) (-2109.958) (-2095.140) [-2113.992] * (-2098.186) (-2091.609) [-2085.849] (-2082.333) -- 0:00:00
       1000 -- (-2102.735) (-2092.073) (-2086.119) [-2085.158] * (-2095.794) (-2083.410) (-2091.500) [-2087.180] -- 0:00:00
       1500 -- [-2088.601] (-2090.692) (-2085.152) (-2092.628) * (-2079.778) (-2088.941) (-2091.089) [-2084.380] -- 0:00:00
       2000 -- (-2079.150) (-2100.270) (-2089.049) [-2080.093] * (-2086.026) [-2088.614] (-2081.425) (-2086.789) -- 0:00:00
       2500 -- [-2079.452] (-2083.195) (-2087.954) (-2085.734) * (-2083.375) (-2088.318) [-2087.429] (-2085.250) -- 0:00:00
       3000 -- [-2080.761] (-2083.566) (-2083.873) (-2082.417) * (-2087.083) (-2087.273) (-2086.516) [-2083.448] -- 0:00:00
       3500 -- (-2091.853) (-2086.060) [-2089.097] (-2082.879) * (-2085.575) [-2086.292] (-2083.711) (-2088.293) -- 0:00:00
       4000 -- (-2092.618) (-2090.756) (-2082.598) [-2085.480] * (-2084.075) (-2088.644) (-2090.764) [-2084.895] -- 0:00:00
       4500 -- (-2091.668) [-2083.329] (-2084.623) (-2082.722) * (-2081.589) [-2085.945] (-2093.600) (-2088.254) -- 0:00:00
       5000 -- (-2085.125) (-2089.429) (-2084.772) [-2084.550] * (-2085.338) (-2085.480) (-2085.945) [-2080.601] -- 0:00:00

      Average standard deviation of split frequencies: 0.102479

       5500 -- (-2084.440) (-2092.820) [-2082.470] (-2080.159) * (-2079.595) (-2089.328) (-2082.017) [-2089.698] -- 0:00:00
       6000 -- [-2079.651] (-2091.058) (-2085.680) (-2091.631) * (-2080.458) [-2081.977] (-2082.983) (-2090.941) -- 0:00:00
       6500 -- (-2079.536) (-2087.191) [-2084.888] (-2082.111) * (-2082.721) (-2084.347) (-2085.759) [-2089.767] -- 0:00:00
       7000 -- [-2079.990] (-2093.949) (-2078.737) (-2088.215) * (-2089.870) (-2086.192) (-2079.484) [-2079.818] -- 0:00:00
       7500 -- (-2081.620) [-2087.248] (-2088.042) (-2095.901) * [-2085.488] (-2088.863) (-2088.705) (-2083.596) -- 0:00:00
       8000 -- (-2078.968) [-2083.928] (-2084.857) (-2089.109) * [-2082.735] (-2084.322) (-2087.557) (-2086.084) -- 0:00:00
       8500 -- (-2075.096) (-2093.106) (-2086.136) [-2082.351] * [-2082.902] (-2084.006) (-2094.005) (-2082.848) -- 0:00:00
       9000 -- (-2075.007) (-2080.260) [-2087.238] (-2089.378) * [-2085.698] (-2087.322) (-2083.426) (-2090.171) -- 0:00:00
       9500 -- (-2077.555) [-2085.091] (-2088.469) (-2089.437) * (-2081.359) (-2085.330) [-2082.782] (-2085.849) -- 0:00:00
      10000 -- (-2079.420) (-2086.246) (-2085.999) [-2083.969] * (-2093.207) (-2078.027) (-2092.096) [-2085.160] -- 0:00:00

      Average standard deviation of split frequencies: 0.069448

      10500 -- (-2077.890) [-2083.169] (-2085.239) (-2094.038) * (-2087.460) (-2079.671) (-2080.865) [-2083.040] -- 0:00:00
      11000 -- (-2076.660) (-2084.406) [-2081.344] (-2084.518) * [-2083.752] (-2090.236) (-2089.362) (-2090.372) -- 0:00:00
      11500 -- (-2077.925) (-2086.280) [-2081.291] (-2087.381) * [-2086.849] (-2085.130) (-2089.710) (-2088.787) -- 0:00:00
      12000 -- (-2077.639) (-2084.427) [-2089.749] (-2094.713) * [-2087.942] (-2090.558) (-2088.795) (-2084.779) -- 0:00:00
      12500 -- (-2076.727) [-2081.296] (-2082.995) (-2087.205) * (-2090.214) [-2085.657] (-2093.336) (-2089.679) -- 0:00:00
      13000 -- [-2075.020] (-2087.101) (-2084.900) (-2090.490) * [-2084.783] (-2083.955) (-2087.090) (-2083.422) -- 0:00:00
      13500 -- (-2075.026) (-2083.125) [-2085.991] (-2081.379) * (-2090.544) (-2083.893) [-2087.714] (-2092.626) -- 0:01:13
      14000 -- (-2075.022) (-2088.031) [-2088.407] (-2088.417) * (-2082.032) (-2089.482) [-2082.430] (-2079.067) -- 0:01:10
      14500 -- (-2076.097) [-2085.536] (-2088.573) (-2088.160) * (-2089.600) (-2094.280) [-2084.579] (-2081.658) -- 0:01:07
      15000 -- (-2075.788) (-2079.469) [-2082.960] (-2084.456) * (-2082.709) (-2084.716) [-2082.375] (-2084.899) -- 0:01:05

      Average standard deviation of split frequencies: 0.054274

      15500 -- [-2075.624] (-2081.887) (-2093.801) (-2085.336) * (-2090.149) (-2096.004) (-2086.958) [-2078.903] -- 0:01:03
      16000 -- [-2074.395] (-2086.289) (-2086.177) (-2082.064) * (-2082.173) (-2085.601) (-2088.330) [-2087.420] -- 0:01:01
      16500 -- [-2074.963] (-2081.203) (-2082.045) (-2093.387) * (-2075.437) (-2086.049) (-2087.648) [-2085.846] -- 0:00:59
      17000 -- [-2075.153] (-2082.288) (-2083.757) (-2085.565) * (-2075.083) [-2087.129] (-2089.432) (-2086.698) -- 0:00:57
      17500 -- (-2075.222) [-2086.815] (-2086.252) (-2095.888) * (-2075.083) (-2090.569) [-2083.754] (-2087.994) -- 0:00:56
      18000 -- (-2075.096) (-2091.191) (-2084.571) [-2086.030] * [-2075.324] (-2096.275) (-2088.812) (-2087.138) -- 0:00:54
      18500 -- (-2076.834) (-2090.685) [-2080.730] (-2090.710) * [-2074.241] (-2085.267) (-2083.355) (-2089.142) -- 0:00:53
      19000 -- (-2077.216) (-2084.016) (-2084.128) [-2086.814] * (-2074.217) (-2083.314) [-2087.396] (-2083.465) -- 0:00:51
      19500 -- (-2077.093) (-2083.449) [-2080.094] (-2088.697) * (-2074.434) (-2088.188) [-2083.273] (-2087.281) -- 0:00:50
      20000 -- (-2077.394) (-2083.809) (-2086.128) [-2093.290] * (-2074.606) (-2082.176) [-2083.623] (-2084.218) -- 0:00:49

      Average standard deviation of split frequencies: 0.057625

      20500 -- (-2078.390) (-2091.455) (-2086.002) [-2085.561] * (-2075.581) (-2093.393) [-2081.817] (-2083.899) -- 0:00:47
      21000 -- (-2075.955) (-2082.826) (-2087.766) [-2085.893] * (-2077.280) (-2084.984) (-2085.415) [-2087.340] -- 0:00:46
      21500 -- (-2075.955) (-2089.906) (-2086.566) [-2087.972] * [-2077.336] (-2084.327) (-2085.681) (-2091.246) -- 0:00:45
      22000 -- (-2078.875) [-2085.355] (-2083.194) (-2082.387) * (-2077.812) [-2082.200] (-2091.517) (-2087.920) -- 0:00:44
      22500 -- (-2078.875) [-2088.816] (-2085.739) (-2084.150) * [-2077.835] (-2091.189) (-2084.199) (-2084.217) -- 0:00:43
      23000 -- (-2075.739) [-2084.370] (-2092.853) (-2092.557) * (-2076.567) (-2088.191) [-2084.702] (-2089.461) -- 0:00:42
      23500 -- (-2081.256) (-2084.697) [-2082.818] (-2083.516) * (-2077.001) (-2089.311) [-2083.516] (-2086.909) -- 0:00:41
      24000 -- (-2079.310) [-2084.402] (-2096.653) (-2085.261) * (-2077.016) [-2084.708] (-2083.672) (-2088.540) -- 0:00:40
      24500 -- (-2075.618) (-2083.839) [-2084.974] (-2094.940) * (-2077.150) [-2080.611] (-2081.284) (-2085.049) -- 0:00:39
      25000 -- (-2075.546) (-2084.953) [-2085.759] (-2091.177) * [-2078.252] (-2084.648) (-2085.081) (-2096.395) -- 0:00:39

      Average standard deviation of split frequencies: 0.052666

      25500 -- (-2075.749) [-2083.236] (-2091.666) (-2087.231) * [-2077.922] (-2087.508) (-2088.502) (-2084.136) -- 0:00:38
      26000 -- (-2075.808) [-2085.374] (-2083.409) (-2086.301) * (-2076.095) (-2082.223) [-2085.522] (-2083.610) -- 0:00:37
      26500 -- (-2078.443) (-2089.749) [-2084.862] (-2094.172) * (-2084.034) [-2082.494] (-2085.941) (-2089.630) -- 0:00:36
      27000 -- (-2075.189) (-2091.810) (-2088.476) [-2085.628] * [-2074.918] (-2087.524) (-2087.521) (-2089.818) -- 0:00:36
      27500 -- (-2076.474) [-2079.246] (-2080.206) (-2082.380) * (-2075.496) (-2084.963) (-2093.965) [-2084.919] -- 0:00:35
      28000 -- [-2076.676] (-2087.953) (-2090.755) (-2081.304) * (-2075.496) [-2088.330] (-2083.665) (-2088.208) -- 0:01:09
      28500 -- [-2078.156] (-2082.317) (-2085.714) (-2086.052) * (-2076.187) (-2089.496) [-2084.270] (-2087.109) -- 0:01:08
      29000 -- [-2076.488] (-2087.251) (-2088.989) (-2082.047) * (-2076.187) (-2075.537) (-2085.132) [-2087.952] -- 0:01:06
      29500 -- (-2074.819) (-2083.375) (-2089.008) [-2080.011] * (-2075.640) (-2074.803) (-2087.107) [-2083.926] -- 0:01:05
      30000 -- (-2074.797) [-2087.056] (-2085.144) (-2083.973) * (-2077.949) (-2078.845) (-2086.490) [-2082.831] -- 0:01:04

      Average standard deviation of split frequencies: 0.054206

      30500 -- [-2074.390] (-2090.989) (-2081.728) (-2083.484) * (-2076.955) (-2076.831) (-2084.490) [-2085.061] -- 0:01:03
      31000 -- (-2076.839) (-2086.395) [-2084.855] (-2083.755) * (-2075.273) [-2076.831] (-2085.805) (-2091.971) -- 0:01:02
      31500 -- [-2076.832] (-2084.705) (-2081.496) (-2083.023) * (-2076.120) (-2074.565) (-2093.663) [-2080.342] -- 0:01:01
      32000 -- (-2078.015) (-2087.846) [-2086.314] (-2087.507) * [-2076.300] (-2076.214) (-2090.390) (-2091.410) -- 0:01:00
      32500 -- (-2076.003) (-2079.012) [-2084.070] (-2089.206) * (-2075.427) [-2075.376] (-2084.411) (-2089.803) -- 0:00:59
      33000 -- [-2074.810] (-2084.071) (-2087.856) (-2088.325) * (-2076.597) (-2074.487) [-2083.517] (-2083.223) -- 0:00:58
      33500 -- (-2075.805) [-2084.248] (-2085.443) (-2087.740) * [-2077.124] (-2074.487) (-2086.008) (-2085.545) -- 0:00:57
      34000 -- (-2076.887) [-2088.168] (-2088.190) (-2082.851) * [-2077.104] (-2074.628) (-2085.863) (-2083.394) -- 0:00:56
      34500 -- (-2078.511) [-2085.316] (-2086.332) (-2092.942) * [-2075.236] (-2074.228) (-2081.380) (-2085.988) -- 0:00:55
      35000 -- (-2076.149) (-2087.983) (-2083.531) [-2084.325] * (-2076.692) [-2075.330] (-2083.524) (-2091.063) -- 0:00:55

      Average standard deviation of split frequencies: 0.047140

      35500 -- (-2077.938) [-2084.623] (-2088.874) (-2087.168) * (-2076.821) (-2083.081) [-2084.385] (-2084.608) -- 0:00:54
      36000 -- (-2078.632) (-2089.419) [-2083.237] (-2088.721) * [-2075.567] (-2079.745) (-2084.184) (-2081.411) -- 0:00:53
      36500 -- (-2079.812) (-2083.181) (-2081.891) [-2086.001] * (-2074.469) (-2078.429) [-2085.736] (-2087.798) -- 0:00:52
      37000 -- (-2075.758) (-2093.629) [-2080.595] (-2093.126) * (-2074.488) (-2078.259) [-2085.697] (-2085.098) -- 0:00:52
      37500 -- (-2075.737) [-2084.901] (-2086.590) (-2091.747) * (-2075.109) [-2078.321] (-2082.929) (-2088.667) -- 0:00:51
      38000 -- (-2076.509) [-2090.058] (-2092.049) (-2086.531) * [-2074.994] (-2076.342) (-2092.950) (-2087.249) -- 0:00:50
      38500 -- (-2076.123) [-2086.922] (-2083.967) (-2095.079) * (-2074.920) (-2078.785) [-2082.305] (-2091.154) -- 0:00:49
      39000 -- (-2075.913) (-2086.933) [-2082.905] (-2087.553) * (-2077.255) (-2077.381) [-2080.352] (-2086.987) -- 0:00:49
      39500 -- (-2076.724) (-2083.829) [-2085.242] (-2082.165) * (-2074.465) (-2076.408) (-2089.357) [-2082.427] -- 0:00:48
      40000 -- (-2075.300) (-2086.364) [-2086.098] (-2085.673) * (-2075.820) (-2078.804) (-2088.096) [-2085.224] -- 0:00:48

      Average standard deviation of split frequencies: 0.044049

      40500 -- (-2078.642) [-2081.962] (-2085.267) (-2086.063) * (-2076.876) (-2077.491) (-2083.637) [-2085.397] -- 0:00:47
      41000 -- (-2078.920) (-2096.123) (-2093.837) [-2086.292] * (-2076.735) (-2077.546) [-2084.197] (-2086.071) -- 0:00:46
      41500 -- (-2079.064) (-2088.778) [-2084.711] (-2093.697) * (-2075.059) (-2079.726) [-2077.913] (-2095.357) -- 0:00:46
      42000 -- (-2075.014) (-2087.827) (-2086.314) [-2085.292] * [-2075.133] (-2077.407) (-2085.043) (-2087.627) -- 0:00:45
      42500 -- [-2074.537] (-2079.517) (-2083.294) (-2090.328) * [-2074.699] (-2079.214) (-2088.647) (-2085.691) -- 0:00:45
      43000 -- [-2075.070] (-2084.614) (-2086.734) (-2086.427) * (-2075.459) (-2077.618) [-2080.156] (-2086.113) -- 0:01:06
      43500 -- (-2074.477) [-2089.395] (-2088.393) (-2092.516) * (-2075.459) [-2080.025] (-2090.630) (-2085.869) -- 0:01:05
      44000 -- (-2075.042) [-2084.075] (-2083.678) (-2082.976) * (-2075.459) (-2077.646) (-2089.895) [-2083.829] -- 0:01:05
      44500 -- [-2075.658] (-2082.292) (-2082.963) (-2089.704) * (-2075.458) [-2076.757] (-2082.822) (-2087.323) -- 0:01:04
      45000 -- (-2076.614) (-2086.093) [-2080.638] (-2086.969) * (-2074.464) (-2078.255) [-2084.029] (-2082.206) -- 0:01:03

      Average standard deviation of split frequencies: 0.037088

      45500 -- (-2078.960) (-2092.300) [-2080.377] (-2092.399) * (-2075.727) [-2076.277] (-2079.467) (-2088.267) -- 0:01:02
      46000 -- (-2076.778) (-2086.228) [-2085.485] (-2086.084) * (-2076.334) (-2080.153) (-2085.487) [-2084.990] -- 0:01:02
      46500 -- (-2076.312) (-2083.955) [-2080.188] (-2085.271) * (-2079.423) (-2076.292) (-2086.710) [-2080.126] -- 0:01:01
      47000 -- [-2075.103] (-2086.341) (-2080.820) (-2091.906) * (-2077.795) [-2076.596] (-2082.916) (-2086.230) -- 0:01:00
      47500 -- (-2078.029) (-2086.450) [-2081.861] (-2082.434) * (-2076.727) (-2077.204) (-2085.516) [-2078.742] -- 0:01:00
      48000 -- [-2076.025] (-2087.180) (-2083.227) (-2083.797) * (-2074.735) (-2078.129) (-2088.202) [-2077.582] -- 0:00:59
      48500 -- [-2078.060] (-2089.893) (-2086.060) (-2082.470) * [-2074.777] (-2078.857) (-2086.183) (-2077.589) -- 0:00:58
      49000 -- (-2076.360) (-2081.036) (-2086.185) [-2084.542] * (-2074.688) (-2078.313) (-2080.100) [-2078.853] -- 0:00:58
      49500 -- (-2078.572) [-2092.064] (-2083.286) (-2086.317) * [-2074.901] (-2077.806) (-2080.117) (-2079.028) -- 0:00:57
      50000 -- [-2079.951] (-2087.576) (-2097.309) (-2082.859) * (-2077.750) (-2080.805) (-2077.196) [-2075.717] -- 0:00:57

      Average standard deviation of split frequencies: 0.038147

      50500 -- (-2080.498) [-2086.707] (-2078.223) (-2084.839) * [-2075.434] (-2075.829) (-2077.585) (-2082.256) -- 0:00:56
      51000 -- [-2076.322] (-2085.909) (-2080.687) (-2086.433) * (-2076.602) (-2075.894) (-2078.854) [-2076.277] -- 0:00:55
      51500 -- [-2076.658] (-2087.203) (-2084.399) (-2083.134) * [-2075.856] (-2076.040) (-2075.100) (-2079.940) -- 0:00:55
      52000 -- (-2079.226) [-2075.291] (-2075.650) (-2086.126) * (-2076.232) [-2076.578] (-2074.837) (-2078.566) -- 0:00:54
      52500 -- (-2077.290) (-2075.230) (-2076.799) [-2081.884] * (-2075.263) [-2076.990] (-2075.000) (-2077.397) -- 0:00:54
      53000 -- (-2084.570) (-2074.597) [-2078.263] (-2091.499) * [-2077.979] (-2076.969) (-2075.303) (-2076.189) -- 0:00:53
      53500 -- (-2082.890) (-2075.062) (-2075.364) [-2086.662] * (-2077.416) [-2075.052] (-2074.925) (-2076.921) -- 0:00:53
      54000 -- (-2079.880) (-2078.754) (-2075.988) [-2085.813] * [-2077.130] (-2075.157) (-2076.642) (-2076.712) -- 0:00:52
      54500 -- (-2078.417) (-2075.938) (-2076.478) [-2080.791] * [-2074.723] (-2075.032) (-2082.652) (-2077.034) -- 0:00:52
      55000 -- (-2082.439) (-2074.910) [-2078.790] (-2083.672) * (-2076.025) (-2075.681) (-2081.239) [-2077.184] -- 0:00:51

      Average standard deviation of split frequencies: 0.037460

      55500 -- [-2076.330] (-2076.175) (-2077.222) (-2079.968) * (-2077.012) (-2077.751) (-2077.855) [-2078.544] -- 0:00:51
      56000 -- [-2078.371] (-2078.609) (-2075.188) (-2092.315) * (-2079.232) (-2080.544) [-2075.675] (-2077.600) -- 0:00:50
      56500 -- [-2076.765] (-2075.480) (-2075.393) (-2087.578) * (-2079.500) (-2079.868) [-2075.345] (-2076.386) -- 0:00:50
      57000 -- (-2079.346) (-2075.621) (-2076.933) [-2088.765] * (-2079.397) (-2079.971) (-2075.417) [-2076.500] -- 0:00:49
      57500 -- (-2079.092) (-2077.141) (-2076.776) [-2081.547] * [-2076.171] (-2076.074) (-2075.355) (-2075.807) -- 0:00:49
      58000 -- (-2075.504) (-2076.319) (-2077.435) [-2079.608] * (-2077.816) (-2074.580) [-2077.243] (-2074.782) -- 0:01:04
      58500 -- (-2077.429) (-2076.003) [-2076.433] (-2086.737) * (-2078.157) [-2074.810] (-2077.422) (-2074.408) -- 0:01:04
      59000 -- (-2078.879) (-2077.339) (-2075.394) [-2086.143] * (-2079.824) (-2081.854) [-2076.280] (-2074.493) -- 0:01:03
      59500 -- (-2077.029) (-2075.966) [-2075.324] (-2086.091) * (-2082.865) (-2075.363) (-2076.281) [-2074.619] -- 0:01:03
      60000 -- (-2074.974) (-2077.618) [-2075.841] (-2088.353) * (-2079.051) (-2074.839) [-2080.042] (-2075.498) -- 0:01:02

      Average standard deviation of split frequencies: 0.030264

      60500 -- [-2075.420] (-2075.516) (-2075.665) (-2098.930) * (-2077.961) (-2075.301) (-2075.713) [-2080.925] -- 0:01:02
      61000 -- [-2074.745] (-2075.860) (-2076.449) (-2084.061) * [-2076.155] (-2075.550) (-2077.962) (-2080.496) -- 0:01:01
      61500 -- (-2074.501) (-2076.068) [-2076.950] (-2083.081) * [-2076.735] (-2075.177) (-2076.301) (-2081.214) -- 0:01:01
      62000 -- (-2074.513) [-2078.285] (-2079.033) (-2083.827) * [-2076.723] (-2075.175) (-2077.052) (-2078.500) -- 0:01:00
      62500 -- (-2076.923) [-2076.393] (-2077.268) (-2080.735) * [-2080.863] (-2075.401) (-2078.431) (-2076.260) -- 0:01:00
      63000 -- (-2077.936) [-2075.598] (-2076.041) (-2083.496) * (-2080.729) [-2075.723] (-2082.995) (-2075.395) -- 0:00:59
      63500 -- (-2077.208) [-2075.335] (-2075.680) (-2079.054) * [-2075.448] (-2075.210) (-2080.354) (-2075.313) -- 0:00:58
      64000 -- (-2076.386) [-2075.729] (-2077.733) (-2080.489) * (-2078.342) (-2076.496) [-2077.523] (-2076.372) -- 0:00:58
      64500 -- (-2077.377) (-2075.730) (-2077.632) [-2079.310] * [-2075.991] (-2081.273) (-2077.476) (-2076.792) -- 0:00:58
      65000 -- (-2077.723) (-2075.730) (-2078.114) [-2076.500] * (-2080.790) (-2082.301) [-2078.947] (-2076.026) -- 0:00:57

      Average standard deviation of split frequencies: 0.025713

      65500 -- [-2074.702] (-2080.927) (-2076.043) (-2079.334) * [-2075.879] (-2080.089) (-2078.777) (-2076.460) -- 0:00:57
      66000 -- (-2074.951) (-2084.073) (-2074.798) [-2080.315] * (-2077.597) (-2077.806) [-2077.308] (-2076.451) -- 0:00:56
      66500 -- (-2075.427) (-2077.749) (-2075.342) [-2077.608] * (-2077.498) [-2077.832] (-2077.139) (-2080.720) -- 0:00:56
      67000 -- (-2076.307) (-2078.521) [-2075.344] (-2078.468) * (-2076.791) [-2077.470] (-2076.041) (-2081.551) -- 0:00:55
      67500 -- [-2076.153] (-2074.907) (-2077.924) (-2080.818) * (-2075.697) [-2077.824] (-2076.511) (-2080.133) -- 0:00:55
      68000 -- (-2076.739) (-2074.907) (-2074.521) [-2079.445] * (-2075.627) [-2080.273] (-2079.259) (-2074.840) -- 0:00:54
      68500 -- (-2077.265) (-2075.399) (-2074.200) [-2079.725] * (-2077.675) (-2077.145) (-2078.322) [-2075.218] -- 0:00:54
      69000 -- [-2076.471] (-2074.963) (-2074.851) (-2081.761) * (-2075.028) (-2077.658) [-2076.493] (-2076.727) -- 0:00:53
      69500 -- [-2077.288] (-2074.357) (-2074.954) (-2077.131) * [-2076.167] (-2077.651) (-2076.588) (-2076.727) -- 0:00:53
      70000 -- (-2077.348) [-2075.362] (-2074.466) (-2077.997) * (-2075.358) [-2074.990] (-2079.038) (-2074.800) -- 0:00:53

      Average standard deviation of split frequencies: 0.026350

      70500 -- (-2076.171) [-2075.959] (-2074.466) (-2077.467) * (-2074.805) (-2074.738) [-2077.108] (-2074.610) -- 0:00:52
      71000 -- (-2074.982) [-2075.239] (-2076.604) (-2079.052) * [-2075.823] (-2075.228) (-2074.932) (-2075.413) -- 0:00:52
      71500 -- [-2081.061] (-2075.515) (-2079.835) (-2080.789) * (-2077.934) [-2075.199] (-2074.932) (-2079.000) -- 0:00:51
      72000 -- [-2075.666] (-2077.544) (-2076.033) (-2079.705) * (-2076.427) (-2075.102) (-2077.438) [-2078.075] -- 0:00:51
      72500 -- [-2077.387] (-2076.957) (-2080.716) (-2082.677) * [-2078.152] (-2076.989) (-2075.743) (-2077.447) -- 0:00:51
      73000 -- [-2077.259] (-2076.174) (-2075.462) (-2078.348) * (-2079.722) (-2074.762) [-2075.423] (-2077.173) -- 0:00:50
      73500 -- (-2079.015) (-2076.019) (-2075.970) [-2080.504] * (-2077.586) (-2078.222) (-2075.539) [-2077.710] -- 0:01:03
      74000 -- (-2075.250) (-2079.983) [-2076.464] (-2078.448) * [-2077.705] (-2076.613) (-2075.418) (-2081.126) -- 0:01:02
      74500 -- (-2075.608) (-2083.907) (-2076.209) [-2077.556] * (-2078.188) (-2075.601) (-2075.017) [-2077.567] -- 0:01:02
      75000 -- (-2075.416) [-2076.407] (-2076.549) (-2077.556) * (-2076.943) (-2078.215) [-2075.275] (-2076.789) -- 0:01:01

      Average standard deviation of split frequencies: 0.023505

      75500 -- (-2075.580) [-2075.849] (-2077.663) (-2076.836) * [-2077.848] (-2076.628) (-2076.999) (-2076.409) -- 0:01:01
      76000 -- (-2074.853) [-2076.324] (-2076.458) (-2076.309) * (-2078.047) (-2076.917) [-2075.147] (-2077.456) -- 0:01:00
      76500 -- [-2076.518] (-2077.553) (-2075.208) (-2074.893) * [-2075.708] (-2076.898) (-2078.541) (-2075.547) -- 0:01:00
      77000 -- [-2076.546] (-2075.216) (-2075.268) (-2074.893) * (-2074.945) (-2076.663) [-2075.072] (-2075.421) -- 0:00:59
      77500 -- (-2078.613) (-2077.228) (-2076.356) [-2078.431] * (-2076.216) (-2075.672) [-2074.696] (-2076.265) -- 0:00:59
      78000 -- (-2078.646) (-2075.942) (-2075.031) [-2077.189] * (-2076.073) [-2075.361] (-2075.697) (-2076.574) -- 0:00:59
      78500 -- (-2081.044) (-2076.044) (-2078.091) [-2077.140] * [-2076.021] (-2075.436) (-2078.505) (-2076.212) -- 0:00:58
      79000 -- (-2076.965) [-2075.719] (-2076.536) (-2080.508) * (-2076.356) [-2075.400] (-2078.397) (-2076.760) -- 0:00:58
      79500 -- (-2076.968) (-2075.786) (-2075.382) [-2076.645] * (-2075.612) (-2076.638) (-2082.644) [-2075.756] -- 0:00:57
      80000 -- [-2075.768] (-2074.627) (-2075.130) (-2076.216) * (-2078.401) [-2075.213] (-2076.531) (-2077.750) -- 0:00:57

      Average standard deviation of split frequencies: 0.026451

      80500 -- (-2075.655) (-2076.308) [-2075.357] (-2075.969) * [-2076.709] (-2075.283) (-2077.296) (-2075.776) -- 0:00:57
      81000 -- (-2078.955) [-2075.284] (-2078.442) (-2077.024) * (-2076.531) [-2075.136] (-2075.343) (-2075.667) -- 0:00:56
      81500 -- (-2077.451) (-2074.851) [-2076.384] (-2079.032) * (-2078.533) (-2075.414) (-2076.414) [-2075.998] -- 0:00:56
      82000 -- (-2077.223) (-2076.751) (-2076.141) [-2080.786] * (-2078.675) (-2075.324) (-2077.632) [-2077.162] -- 0:00:55
      82500 -- (-2080.916) (-2076.169) [-2078.410] (-2075.770) * (-2077.968) (-2077.012) [-2076.284] (-2075.911) -- 0:00:55
      83000 -- (-2075.504) (-2075.473) [-2076.696] (-2075.888) * (-2077.539) (-2074.978) [-2076.411] (-2075.905) -- 0:00:55
      83500 -- (-2076.190) (-2076.428) [-2075.292] (-2075.676) * (-2077.774) (-2075.812) (-2076.015) [-2075.942] -- 0:00:54
      84000 -- (-2080.203) [-2075.900] (-2078.486) (-2075.309) * (-2078.283) (-2075.257) [-2076.516] (-2077.173) -- 0:00:54
      84500 -- (-2075.145) (-2076.203) [-2075.478] (-2075.726) * (-2076.059) (-2075.122) [-2076.724] (-2078.054) -- 0:00:54
      85000 -- (-2075.263) [-2074.327] (-2077.613) (-2075.699) * (-2075.816) (-2074.600) [-2076.095] (-2076.394) -- 0:00:53

      Average standard deviation of split frequencies: 0.023657

      85500 -- (-2074.670) (-2076.994) [-2074.927] (-2077.590) * (-2075.889) [-2074.600] (-2080.056) (-2075.445) -- 0:00:53
      86000 -- (-2075.047) (-2076.647) [-2074.907] (-2077.315) * (-2075.273) (-2074.962) [-2077.528] (-2075.497) -- 0:00:53
      86500 -- (-2077.218) (-2076.553) (-2077.495) [-2076.995] * [-2075.410] (-2076.041) (-2075.991) (-2076.228) -- 0:00:52
      87000 -- [-2075.973] (-2077.831) (-2075.084) (-2074.899) * [-2075.359] (-2074.663) (-2075.725) (-2082.140) -- 0:00:52
      87500 -- (-2077.174) (-2078.743) [-2075.948] (-2076.765) * (-2075.592) [-2075.656] (-2075.419) (-2077.201) -- 0:00:52
      88000 -- [-2076.709] (-2080.534) (-2075.123) (-2078.876) * (-2075.346) (-2074.709) [-2076.343] (-2085.633) -- 0:00:51
      88500 -- (-2075.888) (-2075.326) [-2075.467] (-2078.250) * [-2074.621] (-2075.185) (-2076.827) (-2078.552) -- 0:01:01
      89000 -- (-2075.881) [-2076.574] (-2075.472) (-2077.017) * (-2075.502) (-2075.205) [-2074.804] (-2077.714) -- 0:01:01
      89500 -- (-2080.684) (-2080.073) [-2075.561] (-2077.639) * (-2075.502) (-2078.941) [-2074.919] (-2077.376) -- 0:01:01
      90000 -- (-2078.817) (-2076.533) [-2075.561] (-2079.091) * [-2076.140] (-2078.704) (-2079.995) (-2078.632) -- 0:01:00

      Average standard deviation of split frequencies: 0.019703

      90500 -- (-2076.597) [-2076.417] (-2075.561) (-2076.165) * [-2075.106] (-2078.885) (-2076.567) (-2081.211) -- 0:01:00
      91000 -- [-2076.413] (-2076.239) (-2075.561) (-2077.554) * [-2074.727] (-2079.499) (-2077.550) (-2078.613) -- 0:00:59
      91500 -- [-2075.175] (-2074.954) (-2076.486) (-2075.611) * (-2074.727) (-2077.101) [-2078.798] (-2077.310) -- 0:00:59
      92000 -- (-2075.519) (-2075.091) [-2075.974] (-2075.608) * [-2076.552] (-2077.218) (-2080.804) (-2078.144) -- 0:00:59
      92500 -- [-2076.944] (-2076.531) (-2077.534) (-2078.996) * (-2075.362) (-2075.986) (-2078.376) [-2075.938] -- 0:00:58
      93000 -- (-2075.023) (-2075.372) (-2078.906) [-2076.316] * [-2075.353] (-2075.512) (-2078.376) (-2075.898) -- 0:00:58
      93500 -- (-2075.200) [-2074.711] (-2081.602) (-2076.316) * [-2075.352] (-2078.684) (-2076.284) (-2075.897) -- 0:00:58
      94000 -- [-2077.047] (-2074.713) (-2080.705) (-2074.890) * [-2076.014] (-2076.151) (-2075.120) (-2076.279) -- 0:00:57
      94500 -- (-2075.920) [-2075.226] (-2077.155) (-2074.528) * (-2077.554) [-2078.660] (-2078.272) (-2077.339) -- 0:00:57
      95000 -- [-2077.993] (-2076.609) (-2078.795) (-2074.525) * (-2079.215) [-2080.903] (-2077.829) (-2077.667) -- 0:00:57

      Average standard deviation of split frequencies: 0.023002

      95500 -- (-2084.731) [-2077.787] (-2077.691) (-2074.581) * (-2079.920) (-2080.809) [-2075.848] (-2075.518) -- 0:00:56
      96000 -- (-2084.173) (-2076.778) (-2078.565) [-2074.612] * [-2077.964] (-2076.610) (-2076.309) (-2074.969) -- 0:00:56
      96500 -- (-2078.412) (-2074.966) [-2076.799] (-2078.589) * (-2078.385) (-2075.741) (-2077.234) [-2074.921] -- 0:00:56
      97000 -- (-2077.748) (-2075.914) (-2077.274) [-2077.395] * (-2074.591) (-2078.616) (-2075.847) [-2076.203] -- 0:00:55
      97500 -- (-2075.038) [-2075.916] (-2077.813) (-2075.692) * (-2075.062) [-2075.134] (-2077.727) (-2076.169) -- 0:00:55
      98000 -- (-2078.424) (-2078.150) [-2077.424] (-2076.252) * [-2075.029] (-2075.019) (-2074.538) (-2075.580) -- 0:00:55
      98500 -- (-2074.364) (-2080.416) (-2075.378) [-2076.213] * (-2076.907) (-2077.095) (-2074.539) [-2076.737] -- 0:00:54
      99000 -- (-2075.827) [-2074.174] (-2074.934) (-2075.672) * (-2075.541) (-2074.961) [-2074.565] (-2080.469) -- 0:00:54
      99500 -- [-2076.557] (-2075.444) (-2076.974) (-2075.465) * (-2076.063) (-2078.233) [-2075.106] (-2079.190) -- 0:00:54
      100000 -- [-2076.830] (-2078.751) (-2076.332) (-2074.251) * [-2075.686] (-2076.860) (-2076.466) (-2079.442) -- 0:00:54

      Average standard deviation of split frequencies: 0.023934

      100500 -- (-2078.096) (-2076.557) (-2078.621) [-2074.266] * (-2075.715) [-2076.459] (-2075.864) (-2078.088) -- 0:00:53
      101000 -- (-2078.905) [-2075.904] (-2078.608) (-2076.582) * (-2076.888) [-2074.833] (-2076.176) (-2078.849) -- 0:00:53
      101500 -- (-2076.916) (-2075.426) [-2078.621] (-2076.671) * (-2079.309) (-2074.668) [-2078.159] (-2075.819) -- 0:00:53
      102000 -- (-2077.213) (-2077.694) [-2076.350] (-2077.706) * (-2076.525) (-2074.957) [-2076.431] (-2075.227) -- 0:00:52
      102500 -- (-2075.626) (-2080.014) [-2076.825] (-2077.812) * [-2077.743] (-2075.245) (-2074.850) (-2077.468) -- 0:00:52
      103000 -- [-2075.371] (-2079.024) (-2079.994) (-2076.648) * [-2077.523] (-2075.222) (-2075.134) (-2079.792) -- 0:00:52
      103500 -- [-2076.589] (-2075.428) (-2076.105) (-2075.229) * [-2076.873] (-2079.353) (-2075.134) (-2075.754) -- 0:01:00
      104000 -- (-2077.893) (-2076.764) [-2076.366] (-2074.534) * (-2078.869) (-2079.399) [-2074.423] (-2074.996) -- 0:01:00
      104500 -- (-2078.251) [-2076.878] (-2076.619) (-2075.541) * [-2077.852] (-2075.663) (-2075.850) (-2076.909) -- 0:00:59
      105000 -- (-2077.278) [-2077.512] (-2074.520) (-2075.100) * (-2077.004) [-2075.349] (-2076.181) (-2077.763) -- 0:00:59

      Average standard deviation of split frequencies: 0.023126

      105500 -- (-2076.243) (-2075.584) (-2075.307) [-2075.534] * (-2076.184) (-2075.684) [-2080.807] (-2077.053) -- 0:00:59
      106000 -- (-2075.716) (-2075.462) [-2077.230] (-2075.890) * (-2076.227) (-2077.958) (-2075.525) [-2077.485] -- 0:00:59
      106500 -- (-2074.639) [-2075.420] (-2076.919) (-2077.839) * (-2077.354) (-2078.000) (-2075.524) [-2074.987] -- 0:00:58
      107000 -- [-2074.867] (-2075.143) (-2075.733) (-2077.544) * (-2077.810) (-2074.450) (-2075.457) [-2074.987] -- 0:00:58
      107500 -- (-2074.899) (-2075.651) (-2076.797) [-2076.939] * [-2077.451] (-2076.834) (-2078.947) (-2074.772) -- 0:00:58
      108000 -- [-2077.910] (-2075.945) (-2078.016) (-2077.592) * (-2077.927) (-2077.144) (-2077.286) [-2078.813] -- 0:00:57
      108500 -- (-2078.163) [-2078.984] (-2076.927) (-2076.068) * (-2077.617) (-2075.058) [-2075.370] (-2076.637) -- 0:00:57
      109000 -- [-2076.537] (-2077.463) (-2076.352) (-2076.221) * (-2076.622) (-2077.122) (-2081.098) [-2076.160] -- 0:00:57
      109500 -- (-2077.143) [-2077.378] (-2075.920) (-2078.344) * (-2078.051) (-2078.161) [-2080.915] (-2077.088) -- 0:00:56
      110000 -- (-2076.924) [-2074.848] (-2075.680) (-2077.297) * [-2075.778] (-2079.163) (-2078.653) (-2075.523) -- 0:00:56

      Average standard deviation of split frequencies: 0.023002

      110500 -- [-2075.196] (-2076.378) (-2077.505) (-2076.652) * (-2078.009) (-2081.498) (-2077.629) [-2076.746] -- 0:00:56
      111000 -- (-2076.687) (-2076.163) (-2076.003) [-2075.940] * (-2076.582) [-2080.128] (-2076.566) (-2077.533) -- 0:00:56
      111500 -- [-2074.994] (-2075.020) (-2075.865) (-2084.869) * (-2077.414) (-2080.073) [-2078.063] (-2078.459) -- 0:00:55
      112000 -- (-2074.982) (-2076.264) [-2075.145] (-2077.006) * [-2077.065] (-2074.712) (-2076.318) (-2079.038) -- 0:00:55
      112500 -- (-2074.254) [-2076.681] (-2075.241) (-2075.109) * [-2076.701] (-2076.494) (-2078.179) (-2076.009) -- 0:00:55
      113000 -- (-2074.423) [-2078.667] (-2075.203) (-2075.382) * (-2075.522) (-2076.935) [-2077.286] (-2079.514) -- 0:00:54
      113500 -- (-2075.940) [-2080.021] (-2075.509) (-2075.382) * (-2074.901) (-2076.963) (-2076.057) [-2076.752] -- 0:00:54
      114000 -- (-2076.998) (-2075.234) [-2075.406] (-2075.800) * [-2075.480] (-2078.659) (-2079.247) (-2076.934) -- 0:00:54
      114500 -- (-2075.373) [-2075.952] (-2075.987) (-2075.794) * (-2075.963) [-2081.623] (-2075.817) (-2077.270) -- 0:00:54
      115000 -- (-2077.395) (-2075.033) [-2076.574] (-2082.684) * (-2077.611) (-2076.394) [-2079.212] (-2077.044) -- 0:00:53

      Average standard deviation of split frequencies: 0.022886

      115500 -- (-2077.273) (-2078.264) [-2075.285] (-2078.413) * [-2075.548] (-2077.321) (-2075.932) (-2076.285) -- 0:00:53
      116000 -- (-2077.159) (-2078.570) (-2074.821) [-2075.768] * [-2076.661] (-2079.933) (-2075.420) (-2076.266) -- 0:00:53
      116500 -- [-2077.402] (-2077.323) (-2075.407) (-2076.431) * (-2076.803) [-2081.144] (-2075.789) (-2076.708) -- 0:00:53
      117000 -- (-2074.315) (-2080.010) [-2074.797] (-2077.592) * (-2075.396) [-2078.919] (-2074.216) (-2076.701) -- 0:00:52
      117500 -- (-2076.077) (-2082.626) [-2075.110] (-2076.075) * (-2075.399) [-2078.482] (-2074.226) (-2076.709) -- 0:00:52
      118000 -- [-2075.937] (-2078.357) (-2075.737) (-2078.670) * (-2076.360) (-2077.380) [-2076.289] (-2076.243) -- 0:00:52
      118500 -- (-2077.020) (-2079.285) [-2076.661] (-2078.366) * (-2077.382) (-2075.061) [-2076.936] (-2078.250) -- 0:00:59
      119000 -- (-2076.862) (-2079.577) [-2074.968] (-2078.612) * [-2074.781] (-2075.631) (-2078.101) (-2077.200) -- 0:00:59
      119500 -- [-2077.896] (-2081.562) (-2075.707) (-2078.865) * (-2077.250) (-2078.956) [-2075.777] (-2080.282) -- 0:00:58
      120000 -- (-2076.632) (-2077.888) [-2075.520] (-2078.903) * [-2075.981] (-2077.722) (-2075.934) (-2077.579) -- 0:00:58

      Average standard deviation of split frequencies: 0.024091

      120500 -- [-2077.605] (-2076.004) (-2076.455) (-2077.041) * (-2077.186) (-2076.329) (-2077.114) [-2077.111] -- 0:00:58
      121000 -- [-2078.072] (-2077.305) (-2084.999) (-2076.974) * [-2078.954] (-2076.331) (-2075.152) (-2076.145) -- 0:00:58
      121500 -- [-2077.045] (-2075.001) (-2082.594) (-2075.898) * (-2077.288) (-2080.693) (-2077.917) [-2075.959] -- 0:00:57
      122000 -- [-2076.288] (-2074.775) (-2081.381) (-2076.300) * (-2077.248) (-2081.670) [-2076.505] (-2076.323) -- 0:00:57
      122500 -- [-2076.899] (-2075.807) (-2078.148) (-2075.981) * (-2075.927) [-2078.095] (-2075.882) (-2076.457) -- 0:00:57
      123000 -- [-2077.118] (-2079.730) (-2078.711) (-2076.359) * (-2074.966) (-2076.393) (-2075.333) [-2078.129] -- 0:00:57
      123500 -- [-2075.807] (-2078.994) (-2077.525) (-2076.849) * [-2076.183] (-2076.236) (-2075.551) (-2080.379) -- 0:00:56
      124000 -- (-2076.403) (-2076.322) (-2077.994) [-2075.156] * (-2077.792) [-2075.978] (-2077.063) (-2078.426) -- 0:00:56
      124500 -- (-2076.137) (-2077.023) (-2081.749) [-2076.364] * (-2076.782) [-2079.249] (-2076.910) (-2078.073) -- 0:00:56
      125000 -- [-2074.931] (-2075.941) (-2077.547) (-2077.927) * (-2080.620) (-2075.869) [-2079.098] (-2080.506) -- 0:00:56

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-2076.465) (-2075.418) [-2078.293] (-2077.565) * (-2079.197) (-2077.868) [-2076.155] (-2079.602) -- 0:00:55
      126000 -- (-2077.843) (-2075.475) [-2075.967] (-2076.360) * (-2077.615) (-2079.637) (-2075.729) [-2076.441] -- 0:00:55
      126500 -- (-2077.901) (-2075.360) (-2076.294) [-2075.349] * (-2076.596) (-2078.282) [-2075.043] (-2077.316) -- 0:00:55
      127000 -- (-2078.879) [-2076.577] (-2076.902) (-2075.976) * (-2077.018) [-2075.102] (-2075.173) (-2078.347) -- 0:00:54
      127500 -- (-2082.811) (-2079.105) (-2077.548) [-2078.210] * [-2074.176] (-2075.308) (-2079.161) (-2079.558) -- 0:00:54
      128000 -- (-2074.721) (-2078.170) [-2076.391] (-2078.223) * (-2075.083) (-2077.540) [-2075.736] (-2079.719) -- 0:00:54
      128500 -- (-2076.170) (-2079.022) [-2077.829] (-2075.476) * (-2075.270) (-2076.031) (-2077.495) [-2077.715] -- 0:00:54
      129000 -- (-2076.370) (-2076.410) [-2077.353] (-2074.730) * [-2074.773] (-2075.171) (-2076.208) (-2075.002) -- 0:00:54
      129500 -- (-2075.991) [-2077.705] (-2076.633) (-2074.747) * [-2075.530] (-2077.825) (-2077.349) (-2075.967) -- 0:00:53
      130000 -- (-2076.722) [-2075.341] (-2080.535) (-2074.773) * (-2074.934) [-2078.011] (-2074.722) (-2078.003) -- 0:00:53

      Average standard deviation of split frequencies: 0.022648

      130500 -- (-2076.357) (-2077.340) (-2079.083) [-2075.776] * (-2075.978) (-2076.201) (-2074.613) [-2075.369] -- 0:00:53
      131000 -- (-2076.871) [-2077.580] (-2082.060) (-2076.164) * (-2080.131) [-2076.085] (-2074.829) (-2074.799) -- 0:00:53
      131500 -- (-2075.675) [-2077.478] (-2081.796) (-2075.315) * (-2078.554) [-2075.638] (-2075.496) (-2075.298) -- 0:00:52
      132000 -- (-2075.663) (-2076.050) [-2077.070] (-2078.445) * (-2077.835) (-2076.032) [-2081.986] (-2074.957) -- 0:00:52
      132500 -- (-2075.940) (-2075.805) [-2076.375] (-2078.974) * [-2080.277] (-2075.377) (-2075.040) (-2074.742) -- 0:00:52
      133000 -- [-2075.576] (-2076.170) (-2080.552) (-2077.228) * (-2076.281) [-2075.692] (-2079.122) (-2074.859) -- 0:00:52
      133500 -- (-2075.577) [-2075.170] (-2080.229) (-2075.344) * (-2077.728) [-2082.123] (-2079.586) (-2074.783) -- 0:00:58
      134000 -- (-2075.886) (-2075.977) [-2077.638] (-2075.338) * [-2079.046] (-2079.247) (-2077.852) (-2075.798) -- 0:00:58
      134500 -- (-2077.826) [-2077.368] (-2075.057) (-2074.677) * (-2076.103) (-2076.408) [-2074.965] (-2077.694) -- 0:00:57
      135000 -- (-2075.956) (-2075.170) (-2076.551) [-2075.738] * [-2077.259] (-2076.322) (-2074.874) (-2077.590) -- 0:00:57

      Average standard deviation of split frequencies: 0.022530

      135500 -- (-2075.483) [-2074.415] (-2076.790) (-2080.105) * (-2076.753) (-2075.788) [-2075.193] (-2076.961) -- 0:00:57
      136000 -- (-2075.418) [-2075.435] (-2077.920) (-2074.494) * (-2080.595) [-2075.738] (-2078.391) (-2075.887) -- 0:00:57
      136500 -- (-2077.612) (-2076.207) [-2077.727] (-2076.129) * [-2075.953] (-2075.477) (-2077.852) (-2075.531) -- 0:00:56
      137000 -- (-2078.550) (-2074.659) (-2075.728) [-2075.234] * [-2077.674] (-2076.591) (-2075.805) (-2082.351) -- 0:00:56
      137500 -- [-2079.147] (-2076.754) (-2076.533) (-2075.285) * (-2076.255) (-2078.478) [-2076.114] (-2078.426) -- 0:00:56
      138000 -- (-2077.498) [-2077.645] (-2078.037) (-2075.091) * (-2076.204) (-2076.907) (-2075.342) [-2075.999] -- 0:00:56
      138500 -- (-2075.617) (-2077.630) (-2079.964) [-2075.493] * (-2077.423) (-2077.299) (-2074.658) [-2078.103] -- 0:00:55
      139000 -- (-2076.100) [-2075.874] (-2075.308) (-2076.284) * (-2075.888) (-2075.896) [-2075.983] (-2077.286) -- 0:00:55
      139500 -- (-2078.323) [-2075.883] (-2079.236) (-2076.205) * (-2077.938) [-2076.005] (-2075.869) (-2076.728) -- 0:00:55
      140000 -- (-2080.228) (-2074.521) (-2077.661) [-2076.365] * (-2077.554) (-2075.151) [-2076.477] (-2077.093) -- 0:00:55

      Average standard deviation of split frequencies: 0.024641

      140500 -- (-2077.382) [-2080.940] (-2079.415) (-2077.239) * (-2077.909) [-2076.110] (-2079.074) (-2076.684) -- 0:00:55
      141000 -- (-2077.790) (-2076.392) [-2075.865] (-2076.823) * (-2079.659) [-2078.592] (-2076.238) (-2078.426) -- 0:00:54
      141500 -- (-2077.439) [-2076.937] (-2075.905) (-2077.848) * (-2074.994) (-2077.307) [-2074.792] (-2082.264) -- 0:00:54
      142000 -- (-2074.894) (-2080.682) [-2080.398] (-2077.458) * (-2079.728) (-2077.118) (-2075.028) [-2080.569] -- 0:00:54
      142500 -- (-2075.370) (-2076.726) (-2081.236) [-2077.525] * (-2084.705) (-2078.119) (-2074.954) [-2077.248] -- 0:00:54
      143000 -- [-2075.306] (-2076.178) (-2080.455) (-2076.694) * (-2078.735) (-2076.588) (-2075.641) [-2077.512] -- 0:00:53
      143500 -- (-2075.310) (-2075.578) [-2077.679] (-2076.536) * (-2076.737) (-2076.400) [-2076.295] (-2075.437) -- 0:00:53
      144000 -- [-2075.850] (-2075.578) (-2077.165) (-2078.314) * (-2075.307) [-2076.998] (-2081.299) (-2075.596) -- 0:00:53
      144500 -- (-2075.477) (-2075.578) (-2076.695) [-2075.265] * (-2077.347) (-2077.223) (-2080.382) [-2075.195] -- 0:00:53
      145000 -- [-2075.125] (-2076.574) (-2075.138) (-2075.473) * (-2076.604) (-2076.882) (-2082.686) [-2075.199] -- 0:00:53

      Average standard deviation of split frequencies: 0.026907

      145500 -- (-2074.474) [-2074.440] (-2075.166) (-2078.611) * [-2075.224] (-2075.633) (-2079.157) (-2077.346) -- 0:00:52
      146000 -- [-2075.144] (-2074.278) (-2075.501) (-2077.996) * (-2076.352) [-2079.487] (-2082.239) (-2074.688) -- 0:00:52
      146500 -- (-2075.924) (-2074.446) [-2075.799] (-2079.667) * [-2075.731] (-2079.395) (-2080.206) (-2074.908) -- 0:00:52
      147000 -- (-2075.530) (-2076.445) [-2077.216] (-2077.664) * [-2078.767] (-2077.190) (-2082.819) (-2075.136) -- 0:00:52
      147500 -- (-2074.978) [-2076.990] (-2077.757) (-2084.125) * (-2077.495) [-2077.235] (-2081.302) (-2074.548) -- 0:00:52
      148000 -- (-2076.281) (-2074.593) (-2077.114) [-2077.894] * [-2077.862] (-2077.063) (-2082.173) (-2081.915) -- 0:00:51
      148500 -- (-2076.237) [-2074.893] (-2081.253) (-2075.962) * (-2074.983) [-2077.340] (-2082.137) (-2078.491) -- 0:00:57
      149000 -- (-2074.511) (-2075.396) [-2078.574] (-2076.266) * (-2076.500) [-2078.309] (-2075.390) (-2079.537) -- 0:00:57
      149500 -- [-2075.044] (-2075.213) (-2077.504) (-2075.098) * [-2075.648] (-2078.191) (-2074.722) (-2075.178) -- 0:00:56
      150000 -- (-2077.133) (-2075.679) [-2077.392] (-2075.258) * (-2076.287) (-2078.438) (-2076.248) [-2076.573] -- 0:00:56

      Average standard deviation of split frequencies: 0.025195

      150500 -- (-2077.188) (-2076.002) [-2076.185] (-2075.541) * (-2076.387) (-2076.631) [-2077.098] (-2077.374) -- 0:00:56
      151000 -- (-2077.204) [-2076.091] (-2076.716) (-2078.074) * [-2075.530] (-2078.869) (-2077.796) (-2077.431) -- 0:00:56
      151500 -- (-2075.055) [-2075.794] (-2075.973) (-2075.953) * (-2075.179) (-2075.535) (-2076.005) [-2076.841] -- 0:00:56
      152000 -- (-2075.662) (-2078.009) (-2076.180) [-2077.550] * (-2075.110) (-2077.312) [-2075.704] (-2076.790) -- 0:00:55
      152500 -- (-2076.650) [-2076.445] (-2076.181) (-2078.563) * [-2075.432] (-2077.310) (-2075.911) (-2077.396) -- 0:00:55
      153000 -- [-2076.838] (-2078.581) (-2075.756) (-2077.774) * [-2074.878] (-2075.657) (-2078.028) (-2078.408) -- 0:00:55
      153500 -- (-2079.663) [-2077.596] (-2076.137) (-2077.539) * (-2075.523) [-2074.489] (-2078.716) (-2080.623) -- 0:00:55
      154000 -- (-2078.647) [-2076.596] (-2078.613) (-2077.829) * (-2077.302) [-2075.042] (-2079.590) (-2078.012) -- 0:00:54
      154500 -- (-2075.844) [-2075.447] (-2077.486) (-2077.546) * (-2074.311) [-2077.729] (-2078.056) (-2077.265) -- 0:00:54
      155000 -- [-2076.061] (-2075.011) (-2076.626) (-2075.235) * (-2077.251) [-2076.332] (-2078.008) (-2075.909) -- 0:00:54

      Average standard deviation of split frequencies: 0.024510

      155500 -- (-2075.765) (-2075.610) [-2075.396] (-2075.862) * (-2077.534) (-2076.406) (-2080.011) [-2077.005] -- 0:00:54
      156000 -- (-2077.023) (-2075.322) (-2075.406) [-2076.382] * (-2078.110) [-2075.810] (-2080.021) (-2074.404) -- 0:00:54
      156500 -- [-2076.336] (-2077.458) (-2075.795) (-2080.902) * (-2079.449) (-2074.893) [-2075.814] (-2075.228) -- 0:00:53
      157000 -- [-2077.475] (-2077.039) (-2075.028) (-2079.772) * (-2076.874) (-2074.976) [-2076.548] (-2076.177) -- 0:00:53
      157500 -- (-2079.886) (-2077.909) [-2074.991] (-2078.144) * [-2075.645] (-2075.642) (-2078.045) (-2076.760) -- 0:00:53
      158000 -- [-2081.952] (-2075.123) (-2077.348) (-2077.394) * (-2074.661) (-2074.701) (-2074.847) [-2076.962] -- 0:00:53
      158500 -- (-2079.744) (-2074.602) [-2075.888] (-2078.088) * [-2075.348] (-2077.335) (-2074.933) (-2080.030) -- 0:00:53
      159000 -- [-2078.920] (-2080.522) (-2076.507) (-2075.537) * (-2075.823) (-2074.983) [-2074.925] (-2078.188) -- 0:00:52
      159500 -- (-2078.606) [-2077.912] (-2074.771) (-2074.953) * (-2077.638) (-2078.633) (-2075.099) [-2076.216] -- 0:00:52
      160000 -- (-2077.509) [-2076.881] (-2077.051) (-2077.023) * (-2075.633) [-2079.702] (-2075.087) (-2074.923) -- 0:00:52

      Average standard deviation of split frequencies: 0.026924

      160500 -- (-2083.587) [-2076.938] (-2077.665) (-2075.974) * [-2077.533] (-2077.780) (-2074.879) (-2075.046) -- 0:00:52
      161000 -- (-2077.844) [-2074.730] (-2079.038) (-2076.131) * [-2076.504] (-2074.344) (-2075.682) (-2076.624) -- 0:00:52
      161500 -- (-2079.677) (-2075.262) [-2074.937] (-2078.030) * (-2083.035) [-2074.669] (-2076.048) (-2076.026) -- 0:00:51
      162000 -- (-2078.842) (-2075.579) (-2076.591) [-2076.978] * (-2083.926) (-2074.940) [-2075.787] (-2076.016) -- 0:00:51
      162500 -- [-2077.333] (-2076.421) (-2076.808) (-2078.211) * (-2083.617) (-2075.598) (-2075.648) [-2075.626] -- 0:00:51
      163000 -- [-2078.190] (-2077.408) (-2078.950) (-2077.247) * [-2075.464] (-2075.481) (-2077.985) (-2075.006) -- 0:00:51
      163500 -- (-2079.844) [-2075.509] (-2076.192) (-2074.996) * [-2077.285] (-2077.038) (-2080.245) (-2075.007) -- 0:00:56
      164000 -- (-2078.753) (-2076.459) [-2077.227] (-2078.836) * (-2080.416) (-2076.380) [-2080.351] (-2075.137) -- 0:00:56
      164500 -- (-2078.644) (-2075.903) [-2075.745] (-2075.950) * [-2076.327] (-2074.280) (-2079.387) (-2075.804) -- 0:00:55
      165000 -- [-2074.921] (-2075.210) (-2075.385) (-2077.020) * [-2077.283] (-2077.318) (-2077.165) (-2075.056) -- 0:00:55

      Average standard deviation of split frequencies: 0.025892

      165500 -- (-2074.921) [-2074.898] (-2075.301) (-2075.475) * (-2076.010) (-2076.158) (-2080.920) [-2076.046] -- 0:00:55
      166000 -- [-2075.885] (-2076.026) (-2074.767) (-2076.858) * [-2075.462] (-2076.266) (-2077.278) (-2076.743) -- 0:00:55
      166500 -- [-2075.908] (-2076.314) (-2074.769) (-2076.145) * (-2076.938) (-2076.735) [-2076.531] (-2079.273) -- 0:00:55
      167000 -- (-2076.814) (-2077.365) (-2075.420) [-2076.061] * (-2077.191) (-2075.529) (-2077.249) [-2076.216] -- 0:00:54
      167500 -- (-2074.733) (-2078.752) [-2075.408] (-2076.669) * (-2080.702) [-2075.966] (-2082.644) (-2078.666) -- 0:00:54
      168000 -- (-2076.514) [-2076.806] (-2074.934) (-2077.494) * (-2077.212) [-2075.082] (-2076.809) (-2084.174) -- 0:00:54
      168500 -- [-2076.547] (-2075.576) (-2078.113) (-2078.910) * (-2076.823) (-2076.992) (-2079.440) [-2082.382] -- 0:00:54
      169000 -- (-2076.605) (-2075.561) [-2075.580] (-2078.891) * (-2075.998) (-2080.715) [-2077.662] (-2080.121) -- 0:00:54
      169500 -- (-2076.515) (-2076.715) [-2075.580] (-2076.956) * (-2078.062) (-2079.320) [-2077.899] (-2075.209) -- 0:00:53
      170000 -- [-2078.313] (-2076.500) (-2075.543) (-2076.993) * (-2076.386) (-2075.373) [-2075.647] (-2075.501) -- 0:00:53

      Average standard deviation of split frequencies: 0.024859

      170500 -- (-2081.488) (-2075.449) [-2077.155] (-2079.511) * (-2078.164) [-2075.865] (-2075.295) (-2075.521) -- 0:00:53
      171000 -- (-2077.222) (-2075.944) [-2077.060] (-2078.898) * (-2075.231) (-2075.445) [-2076.005] (-2077.788) -- 0:00:53
      171500 -- (-2079.175) [-2077.548] (-2075.647) (-2077.793) * (-2074.641) [-2075.077] (-2077.325) (-2077.014) -- 0:00:53
      172000 -- [-2074.558] (-2076.620) (-2074.634) (-2075.197) * (-2074.952) (-2075.239) [-2076.731] (-2076.691) -- 0:00:52
      172500 -- [-2075.301] (-2077.126) (-2074.744) (-2075.833) * (-2077.257) [-2074.946] (-2077.668) (-2076.368) -- 0:00:52
      173000 -- (-2075.242) [-2076.746] (-2076.186) (-2078.020) * (-2077.677) [-2074.889] (-2077.749) (-2075.312) -- 0:00:52
      173500 -- (-2077.488) [-2077.301] (-2076.352) (-2077.972) * (-2075.365) (-2075.202) [-2075.965] (-2076.444) -- 0:00:52
      174000 -- (-2077.366) (-2076.204) [-2074.491] (-2075.422) * [-2075.095] (-2075.202) (-2075.744) (-2077.182) -- 0:00:52
      174500 -- (-2075.870) (-2076.300) (-2074.790) [-2075.964] * (-2075.398) (-2074.711) [-2074.458] (-2075.268) -- 0:00:52
      175000 -- [-2075.884] (-2077.650) (-2074.229) (-2075.669) * [-2076.913] (-2074.567) (-2074.880) (-2078.504) -- 0:00:51

      Average standard deviation of split frequencies: 0.023064

      175500 -- (-2074.690) [-2075.686] (-2074.422) (-2074.803) * (-2081.320) (-2074.720) [-2074.871] (-2079.939) -- 0:00:51
      176000 -- (-2074.600) (-2075.956) [-2075.824] (-2076.511) * (-2080.834) [-2074.942] (-2075.862) (-2078.869) -- 0:00:51
      176500 -- (-2077.388) [-2075.286] (-2076.876) (-2076.444) * (-2082.431) (-2076.473) [-2076.956] (-2081.739) -- 0:00:51
      177000 -- (-2077.905) [-2074.868] (-2076.792) (-2076.263) * (-2080.013) (-2076.578) (-2075.770) [-2078.932] -- 0:00:51
      177500 -- (-2077.652) (-2075.689) (-2078.145) [-2077.033] * (-2077.928) [-2075.688] (-2077.982) (-2075.919) -- 0:00:50
      178000 -- (-2075.338) [-2075.531] (-2075.210) (-2075.271) * (-2077.436) (-2076.786) (-2074.108) [-2075.902] -- 0:00:50
      178500 -- (-2076.420) (-2075.485) (-2077.533) [-2075.487] * (-2079.892) (-2080.682) [-2078.459] (-2078.560) -- 0:00:50
      179000 -- (-2075.928) (-2076.973) [-2075.598] (-2076.537) * (-2076.609) (-2077.050) [-2081.943] (-2075.813) -- 0:00:55
      179500 -- (-2076.861) (-2077.479) (-2075.070) [-2075.236] * (-2077.949) (-2077.720) (-2079.353) [-2076.778] -- 0:00:54
      180000 -- (-2075.246) (-2074.937) (-2075.159) [-2077.855] * (-2077.917) (-2077.820) [-2074.950] (-2075.826) -- 0:00:54

      Average standard deviation of split frequencies: 0.021488

      180500 -- (-2075.047) (-2074.886) [-2075.361] (-2077.789) * (-2079.014) (-2077.820) [-2075.320] (-2075.494) -- 0:00:54
      181000 -- [-2075.008] (-2077.335) (-2075.073) (-2076.744) * (-2076.613) (-2076.781) (-2075.295) [-2075.014] -- 0:00:54
      181500 -- (-2074.979) (-2077.715) (-2074.977) [-2075.452] * (-2076.517) (-2076.388) [-2075.110] (-2075.106) -- 0:00:54
      182000 -- [-2077.722] (-2079.536) (-2075.482) (-2076.537) * [-2075.804] (-2075.704) (-2074.397) (-2076.109) -- 0:00:53
      182500 -- (-2079.080) [-2077.320] (-2076.866) (-2076.218) * (-2076.321) (-2075.685) [-2075.699] (-2077.085) -- 0:00:53
      183000 -- (-2075.703) (-2076.289) (-2077.703) [-2076.908] * (-2075.369) (-2077.529) [-2074.951] (-2075.556) -- 0:00:53
      183500 -- (-2075.557) (-2077.042) (-2078.319) [-2074.515] * (-2075.760) (-2074.823) (-2076.415) [-2074.519] -- 0:00:53
      184000 -- (-2076.391) [-2077.668] (-2077.161) (-2076.894) * (-2076.457) (-2075.722) [-2075.449] (-2074.739) -- 0:00:53
      184500 -- (-2076.610) [-2077.450] (-2075.813) (-2077.988) * (-2075.611) [-2077.941] (-2078.251) (-2074.848) -- 0:00:53
      185000 -- [-2076.706] (-2077.269) (-2075.130) (-2075.031) * (-2075.330) (-2077.900) [-2078.077] (-2076.831) -- 0:00:52

      Average standard deviation of split frequencies: 0.019828

      185500 -- (-2076.316) (-2078.515) (-2075.578) [-2075.285] * (-2077.892) (-2075.076) (-2078.538) [-2077.121] -- 0:00:52
      186000 -- (-2078.396) [-2079.069] (-2079.270) (-2075.112) * (-2077.892) [-2075.087] (-2076.933) (-2077.729) -- 0:00:52
      186500 -- (-2082.949) (-2078.428) (-2078.555) [-2074.367] * (-2081.610) [-2074.556] (-2077.464) (-2076.069) -- 0:00:52
      187000 -- [-2079.207] (-2077.760) (-2075.448) (-2074.466) * (-2080.884) (-2076.386) [-2076.548] (-2075.891) -- 0:00:52
      187500 -- [-2077.336] (-2078.861) (-2075.126) (-2074.459) * (-2078.629) (-2075.950) [-2077.635] (-2078.098) -- 0:00:52
      188000 -- (-2076.553) (-2076.781) (-2075.512) [-2074.476] * (-2075.297) [-2075.342] (-2077.393) (-2078.918) -- 0:00:51
      188500 -- (-2076.888) [-2075.760] (-2074.590) (-2074.884) * [-2077.160] (-2074.534) (-2079.111) (-2079.629) -- 0:00:51
      189000 -- (-2077.755) (-2077.097) [-2076.789] (-2080.269) * (-2077.314) (-2076.320) [-2077.386] (-2076.738) -- 0:00:51
      189500 -- [-2076.433] (-2074.555) (-2074.676) (-2077.554) * [-2077.457] (-2078.627) (-2076.871) (-2078.579) -- 0:00:51
      190000 -- (-2078.082) (-2076.385) (-2074.604) [-2075.285] * (-2075.412) (-2077.561) [-2074.839] (-2076.641) -- 0:00:51

      Average standard deviation of split frequencies: 0.019488

      190500 -- (-2080.085) (-2076.988) [-2074.607] (-2075.550) * (-2077.064) (-2076.157) [-2075.019] (-2075.550) -- 0:00:50
      191000 -- (-2076.735) (-2079.676) [-2074.533] (-2077.645) * [-2076.371] (-2078.009) (-2075.236) (-2077.272) -- 0:00:50
      191500 -- (-2077.543) (-2077.668) [-2076.123] (-2079.468) * (-2076.035) (-2078.414) (-2076.283) [-2077.180] -- 0:00:50
      192000 -- [-2076.287] (-2081.145) (-2076.179) (-2080.404) * [-2076.107] (-2080.898) (-2076.557) (-2077.111) -- 0:00:50
      192500 -- (-2077.344) [-2078.859] (-2075.700) (-2075.593) * (-2078.738) [-2078.141] (-2076.128) (-2075.179) -- 0:00:50
      193000 -- (-2077.041) (-2079.937) [-2076.254] (-2080.425) * (-2075.144) [-2078.861] (-2076.004) (-2075.153) -- 0:00:50
      193500 -- (-2076.405) (-2075.896) [-2077.178] (-2078.163) * [-2075.906] (-2076.450) (-2077.647) (-2075.308) -- 0:00:50
      194000 -- (-2076.311) (-2075.908) [-2075.065] (-2075.653) * (-2077.894) (-2075.151) (-2075.450) [-2075.203] -- 0:00:54
      194500 -- (-2076.114) (-2075.941) (-2076.088) [-2075.887] * (-2076.979) (-2077.119) [-2077.003] (-2076.485) -- 0:00:53
      195000 -- (-2077.150) [-2075.801] (-2076.119) (-2080.359) * (-2076.710) (-2078.491) (-2075.631) [-2079.319] -- 0:00:53

      Average standard deviation of split frequencies: 0.018817

      195500 -- (-2079.650) (-2075.984) (-2075.437) [-2075.802] * (-2081.426) (-2078.710) [-2075.866] (-2078.792) -- 0:00:53
      196000 -- (-2075.720) (-2074.887) [-2074.358] (-2075.989) * (-2075.599) (-2079.771) [-2075.516] (-2077.174) -- 0:00:53
      196500 -- (-2076.514) (-2074.547) [-2074.441] (-2074.999) * (-2076.901) (-2077.637) [-2075.513] (-2079.331) -- 0:00:53
      197000 -- (-2075.090) [-2074.534] (-2074.979) (-2076.231) * (-2077.595) [-2077.173] (-2077.129) (-2075.227) -- 0:00:52
      197500 -- [-2075.085] (-2078.391) (-2075.599) (-2076.057) * (-2081.668) (-2076.970) (-2075.671) [-2075.505] -- 0:00:52
      198000 -- (-2075.140) (-2076.993) (-2075.601) [-2077.818] * (-2078.052) (-2076.858) (-2075.388) [-2075.161] -- 0:00:52
      198500 -- [-2074.544] (-2076.966) (-2074.986) (-2078.065) * (-2077.781) (-2074.652) [-2075.233] (-2076.601) -- 0:00:52
      199000 -- (-2076.085) (-2077.746) [-2075.051] (-2076.110) * (-2080.226) [-2074.448] (-2074.902) (-2076.869) -- 0:00:52
      199500 -- (-2075.174) (-2077.992) (-2077.132) [-2075.599] * (-2075.603) (-2074.733) (-2076.666) [-2074.748] -- 0:00:52
      200000 -- (-2076.805) [-2075.489] (-2076.184) (-2079.066) * (-2075.917) [-2075.103] (-2077.797) (-2076.048) -- 0:00:51

      Average standard deviation of split frequencies: 0.017688

      200500 -- (-2076.789) [-2079.906] (-2076.184) (-2079.331) * [-2075.550] (-2074.642) (-2076.728) (-2076.262) -- 0:00:51
      201000 -- [-2077.038] (-2081.034) (-2075.016) (-2077.758) * (-2076.073) (-2080.141) (-2076.521) [-2077.217] -- 0:00:51
      201500 -- (-2076.327) (-2081.038) [-2074.679] (-2075.936) * [-2076.892] (-2076.842) (-2075.628) (-2077.844) -- 0:00:51
      202000 -- (-2077.960) (-2080.897) [-2076.547] (-2076.029) * (-2077.362) [-2075.107] (-2076.891) (-2078.256) -- 0:00:51
      202500 -- (-2077.189) [-2078.856] (-2080.776) (-2077.445) * (-2075.320) (-2075.195) [-2076.848] (-2077.060) -- 0:00:51
      203000 -- (-2076.785) (-2078.564) (-2077.965) [-2076.797] * (-2075.939) [-2076.223] (-2076.307) (-2077.250) -- 0:00:51
      203500 -- [-2076.344] (-2077.463) (-2077.750) (-2077.243) * (-2076.506) (-2075.747) (-2075.043) [-2074.945] -- 0:00:50
      204000 -- (-2075.201) [-2076.689] (-2078.410) (-2077.243) * (-2076.507) (-2075.372) (-2075.043) [-2074.704] -- 0:00:50
      204500 -- (-2076.365) (-2076.348) (-2077.066) [-2077.308] * [-2075.655] (-2075.259) (-2077.679) (-2075.367) -- 0:00:50
      205000 -- (-2078.850) (-2076.478) (-2077.271) [-2076.516] * (-2076.026) (-2074.438) [-2075.064] (-2076.090) -- 0:00:50

      Average standard deviation of split frequencies: 0.015764

      205500 -- (-2074.856) (-2080.309) (-2078.113) [-2074.568] * [-2076.016] (-2076.648) (-2075.508) (-2074.863) -- 0:00:50
      206000 -- [-2074.191] (-2078.862) (-2076.636) (-2074.851) * (-2076.767) (-2076.641) [-2076.045] (-2074.832) -- 0:00:50
      206500 -- (-2074.304) [-2076.758] (-2077.132) (-2074.622) * (-2076.862) (-2076.606) (-2076.982) [-2078.223] -- 0:00:49
      207000 -- (-2076.980) (-2077.013) (-2077.143) [-2074.454] * (-2076.055) (-2075.004) [-2075.200] (-2078.266) -- 0:00:49
      207500 -- (-2075.423) (-2076.089) (-2077.965) [-2075.204] * (-2082.334) (-2074.724) [-2074.912] (-2074.365) -- 0:00:49
      208000 -- (-2075.329) (-2078.078) (-2077.927) [-2075.398] * (-2075.341) (-2075.054) (-2074.837) [-2074.599] -- 0:00:49
      208500 -- (-2080.204) (-2080.620) [-2075.836] (-2075.792) * (-2075.689) (-2075.397) [-2074.837] (-2077.983) -- 0:00:53
      209000 -- (-2077.129) (-2078.533) (-2078.712) [-2077.284] * [-2075.888] (-2075.372) (-2076.913) (-2076.437) -- 0:00:52
      209500 -- (-2074.958) (-2075.859) (-2076.007) [-2075.094] * (-2075.492) (-2075.010) [-2078.496] (-2074.851) -- 0:00:52
      210000 -- (-2077.035) [-2079.576] (-2075.439) (-2078.047) * (-2075.852) (-2074.516) (-2075.639) [-2075.882] -- 0:00:52

      Average standard deviation of split frequencies: 0.016907

      210500 -- (-2078.376) (-2076.688) (-2076.514) [-2075.104] * (-2075.430) (-2076.308) [-2075.661] (-2076.219) -- 0:00:52
      211000 -- (-2075.229) [-2075.946] (-2075.799) (-2075.557) * (-2078.493) (-2076.376) [-2076.620] (-2079.200) -- 0:00:52
      211500 -- (-2076.561) (-2080.628) (-2075.599) [-2075.004] * [-2077.613] (-2078.082) (-2076.317) (-2074.891) -- 0:00:52
      212000 -- (-2076.643) (-2077.659) [-2077.594] (-2074.816) * [-2077.581] (-2078.331) (-2076.370) (-2076.761) -- 0:00:52
      212500 -- (-2075.440) (-2078.502) [-2076.284] (-2074.476) * [-2075.553] (-2080.595) (-2076.515) (-2076.505) -- 0:00:51
      213000 -- (-2078.037) [-2076.589] (-2078.444) (-2075.961) * [-2075.414] (-2081.646) (-2076.403) (-2075.347) -- 0:00:51
      213500 -- (-2076.595) [-2077.387] (-2078.028) (-2074.907) * (-2074.851) [-2081.547] (-2077.711) (-2074.900) -- 0:00:51
      214000 -- (-2077.915) (-2076.869) [-2076.054] (-2074.907) * (-2074.851) (-2075.655) [-2074.411] (-2076.646) -- 0:00:51
      214500 -- (-2074.878) (-2076.194) (-2077.293) [-2075.445] * (-2076.193) (-2075.652) (-2076.563) [-2074.757] -- 0:00:51
      215000 -- (-2079.605) [-2075.192] (-2077.279) (-2075.882) * (-2074.683) (-2075.592) (-2078.446) [-2075.291] -- 0:00:51

      Average standard deviation of split frequencies: 0.018608

      215500 -- [-2074.390] (-2075.758) (-2079.723) (-2075.882) * (-2074.775) (-2075.534) (-2075.901) [-2075.294] -- 0:00:50
      216000 -- [-2075.155] (-2076.898) (-2077.733) (-2076.253) * (-2077.950) (-2074.766) [-2075.336] (-2074.888) -- 0:00:50
      216500 -- (-2076.022) [-2075.351] (-2076.800) (-2075.815) * (-2076.611) (-2075.590) [-2077.590] (-2075.409) -- 0:00:50
      217000 -- (-2078.614) (-2075.853) (-2074.642) [-2075.811] * (-2078.074) (-2075.196) (-2075.137) [-2076.020] -- 0:00:50
      217500 -- [-2075.554] (-2076.359) (-2074.426) (-2078.739) * (-2078.259) [-2074.958] (-2078.629) (-2076.924) -- 0:00:50
      218000 -- (-2076.674) (-2075.778) [-2075.534] (-2077.317) * [-2076.280] (-2075.350) (-2077.580) (-2076.127) -- 0:00:50
      218500 -- [-2076.802] (-2074.816) (-2076.216) (-2078.600) * (-2074.767) (-2088.334) [-2075.157] (-2076.139) -- 0:00:50
      219000 -- [-2075.681] (-2077.476) (-2076.316) (-2078.520) * (-2077.962) [-2076.948] (-2075.117) (-2075.995) -- 0:00:49
      219500 -- (-2076.657) [-2076.264] (-2076.189) (-2079.461) * [-2074.889] (-2076.564) (-2079.001) (-2077.787) -- 0:00:49
      220000 -- [-2076.190] (-2075.102) (-2076.253) (-2078.882) * (-2077.047) (-2075.719) (-2077.543) [-2076.773] -- 0:00:49

      Average standard deviation of split frequencies: 0.019226

      220500 -- (-2074.735) (-2076.838) [-2076.671] (-2079.635) * (-2081.785) (-2076.022) (-2077.044) [-2076.708] -- 0:00:49
      221000 -- (-2074.911) [-2092.187] (-2076.886) (-2078.044) * (-2079.063) (-2075.443) [-2075.389] (-2075.549) -- 0:00:49
      221500 -- (-2076.605) [-2079.357] (-2076.662) (-2079.625) * (-2077.433) (-2081.706) [-2075.095] (-2078.561) -- 0:00:49
      222000 -- [-2074.709] (-2077.216) (-2077.771) (-2079.893) * [-2078.957] (-2079.251) (-2075.803) (-2076.485) -- 0:00:49
      222500 -- (-2074.994) (-2075.692) (-2077.831) [-2076.833] * (-2079.717) (-2078.209) [-2075.879] (-2075.745) -- 0:00:48
      223000 -- (-2074.904) (-2076.134) (-2075.687) [-2076.923] * [-2076.208] (-2080.722) (-2075.741) (-2076.361) -- 0:00:48
      223500 -- (-2077.564) (-2078.399) [-2076.929] (-2078.804) * [-2074.658] (-2079.441) (-2075.848) (-2075.280) -- 0:00:52
      224000 -- [-2078.661] (-2077.937) (-2076.838) (-2078.603) * (-2078.066) (-2078.430) (-2078.007) [-2079.709] -- 0:00:51
      224500 -- (-2077.503) (-2077.047) [-2075.616] (-2078.669) * (-2074.899) (-2079.241) (-2076.532) [-2081.638] -- 0:00:51
      225000 -- (-2076.453) (-2076.553) [-2075.852] (-2078.288) * [-2075.941] (-2082.683) (-2076.969) (-2079.633) -- 0:00:51

      Average standard deviation of split frequencies: 0.016932

      225500 -- (-2077.761) (-2075.641) (-2077.177) [-2077.257] * (-2076.598) (-2077.861) [-2074.511] (-2077.139) -- 0:00:51
      226000 -- (-2080.475) [-2079.494] (-2076.176) (-2075.954) * (-2076.256) (-2078.141) [-2075.683] (-2076.571) -- 0:00:51
      226500 -- (-2077.399) [-2077.333] (-2076.196) (-2074.415) * (-2076.762) (-2077.475) [-2076.610] (-2077.498) -- 0:00:51
      227000 -- (-2078.034) (-2078.259) [-2077.200] (-2074.431) * (-2076.475) (-2077.475) [-2075.258] (-2078.506) -- 0:00:51
      227500 -- (-2078.134) (-2077.696) (-2076.556) [-2074.395] * (-2080.149) (-2077.633) [-2075.413] (-2075.396) -- 0:00:50
      228000 -- (-2080.245) (-2074.911) [-2075.822] (-2076.860) * (-2079.358) [-2076.099] (-2074.637) (-2075.068) -- 0:00:50
      228500 -- (-2078.173) [-2074.718] (-2076.261) (-2075.531) * (-2080.958) (-2076.636) (-2074.721) [-2078.951] -- 0:00:50
      229000 -- (-2077.150) [-2075.430] (-2077.210) (-2076.935) * [-2079.411] (-2076.178) (-2075.271) (-2075.702) -- 0:00:50
      229500 -- (-2079.692) [-2076.120] (-2077.281) (-2076.863) * [-2077.645] (-2075.134) (-2075.147) (-2075.862) -- 0:00:50
      230000 -- (-2077.343) (-2081.571) [-2076.164] (-2079.288) * [-2076.159] (-2075.978) (-2075.205) (-2077.411) -- 0:00:50

      Average standard deviation of split frequencies: 0.017191

      230500 -- (-2077.268) (-2078.081) [-2076.265] (-2076.190) * (-2075.907) (-2075.767) (-2075.431) [-2079.593] -- 0:00:50
      231000 -- (-2076.836) [-2079.019] (-2077.649) (-2075.486) * [-2075.888] (-2078.468) (-2076.986) (-2078.575) -- 0:00:49
      231500 -- (-2076.770) [-2076.916] (-2076.923) (-2076.061) * (-2075.951) (-2078.628) (-2076.771) [-2076.525] -- 0:00:49
      232000 -- (-2076.182) (-2076.252) (-2075.934) [-2078.368] * (-2075.472) [-2076.602] (-2076.297) (-2077.142) -- 0:00:49
      232500 -- (-2077.255) (-2075.716) (-2075.125) [-2076.289] * [-2076.640] (-2077.314) (-2075.785) (-2075.697) -- 0:00:49
      233000 -- [-2082.828] (-2077.813) (-2075.735) (-2075.399) * (-2075.844) (-2074.923) [-2075.760] (-2077.207) -- 0:00:49
      233500 -- [-2076.580] (-2076.553) (-2074.984) (-2075.796) * (-2077.475) (-2074.315) [-2075.312] (-2075.623) -- 0:00:49
      234000 -- (-2075.728) (-2076.520) [-2078.710] (-2075.955) * [-2075.854] (-2074.780) (-2075.203) (-2075.604) -- 0:00:49
      234500 -- (-2077.102) [-2075.298] (-2075.256) (-2075.538) * (-2079.571) [-2076.125] (-2074.936) (-2074.453) -- 0:00:48
      235000 -- (-2081.685) (-2076.922) (-2076.334) [-2075.143] * (-2077.280) [-2077.287] (-2074.819) (-2075.016) -- 0:00:48

      Average standard deviation of split frequencies: 0.015862

      235500 -- (-2081.247) [-2077.964] (-2077.062) (-2075.350) * (-2074.983) [-2076.956] (-2075.155) (-2075.017) -- 0:00:48
      236000 -- (-2077.330) [-2076.512] (-2076.175) (-2076.819) * [-2074.606] (-2075.653) (-2074.476) (-2078.468) -- 0:00:48
      236500 -- (-2078.088) (-2078.496) (-2083.760) [-2074.816] * [-2074.721] (-2075.683) (-2074.626) (-2078.506) -- 0:00:48
      237000 -- (-2076.732) (-2077.330) (-2075.839) [-2080.271] * (-2076.986) (-2076.504) [-2074.518] (-2082.581) -- 0:00:48
      237500 -- (-2075.900) [-2076.572] (-2075.467) (-2076.049) * (-2077.874) (-2077.514) [-2075.404] (-2080.137) -- 0:00:48
      238000 -- (-2080.822) (-2076.117) [-2077.105] (-2077.539) * (-2079.619) [-2076.014] (-2078.256) (-2078.917) -- 0:00:48
      238500 -- (-2078.816) (-2076.135) [-2078.517] (-2077.539) * (-2078.446) (-2075.671) [-2078.233] (-2077.198) -- 0:00:51
      239000 -- (-2079.798) [-2076.223] (-2077.436) (-2074.648) * [-2076.481] (-2077.388) (-2078.614) (-2079.065) -- 0:00:50
      239500 -- [-2078.793] (-2076.669) (-2076.655) (-2074.616) * (-2076.430) (-2077.386) [-2075.259] (-2079.289) -- 0:00:50
      240000 -- (-2081.901) (-2075.193) (-2075.658) [-2076.853] * (-2078.531) [-2075.634] (-2075.192) (-2078.568) -- 0:00:50

      Average standard deviation of split frequencies: 0.014057

      240500 -- (-2080.897) (-2076.577) (-2075.906) [-2075.486] * [-2079.865] (-2077.209) (-2074.475) (-2079.333) -- 0:00:50
      241000 -- (-2078.255) (-2080.211) [-2074.471] (-2075.789) * (-2077.417) [-2076.407] (-2076.349) (-2076.795) -- 0:00:50
      241500 -- (-2078.088) [-2075.872] (-2074.642) (-2074.238) * (-2077.599) (-2077.766) (-2079.072) [-2079.473] -- 0:00:50
      242000 -- (-2077.837) (-2077.713) (-2075.314) [-2076.196] * [-2077.721] (-2078.326) (-2080.014) (-2077.097) -- 0:00:50
      242500 -- [-2077.259] (-2077.448) (-2077.657) (-2075.004) * (-2078.033) [-2075.141] (-2077.725) (-2076.777) -- 0:00:49
      243000 -- (-2076.584) (-2078.575) [-2074.509] (-2075.012) * [-2077.060] (-2076.923) (-2076.071) (-2076.622) -- 0:00:49
      243500 -- (-2078.910) (-2078.345) (-2074.409) [-2074.613] * (-2076.437) (-2075.928) [-2076.141] (-2074.490) -- 0:00:49
      244000 -- (-2076.841) (-2076.935) [-2075.967] (-2075.498) * (-2076.306) [-2076.599] (-2078.353) (-2075.453) -- 0:00:49
      244500 -- [-2075.178] (-2082.722) (-2076.542) (-2075.472) * (-2076.171) (-2076.999) (-2076.270) [-2074.987] -- 0:00:49
      245000 -- (-2074.475) [-2078.592] (-2079.148) (-2076.457) * (-2078.712) (-2075.241) (-2074.651) [-2074.681] -- 0:00:49

      Average standard deviation of split frequencies: 0.013414

      245500 -- [-2079.725] (-2085.058) (-2076.809) (-2078.385) * (-2077.589) [-2075.684] (-2074.605) (-2075.253) -- 0:00:49
      246000 -- [-2079.574] (-2083.967) (-2076.780) (-2076.735) * (-2077.856) (-2075.589) [-2074.433] (-2075.220) -- 0:00:49
      246500 -- [-2077.364] (-2075.320) (-2077.266) (-2075.595) * (-2079.840) [-2075.531] (-2075.122) (-2080.313) -- 0:00:48
      247000 -- [-2080.056] (-2075.417) (-2077.335) (-2074.911) * [-2075.328] (-2075.737) (-2076.618) (-2076.594) -- 0:00:48
      247500 -- (-2077.219) (-2075.342) [-2077.408] (-2075.731) * (-2077.912) (-2075.473) (-2080.109) [-2077.644] -- 0:00:48
      248000 -- [-2077.210] (-2075.329) (-2079.300) (-2075.562) * (-2078.118) [-2074.813] (-2074.844) (-2076.738) -- 0:00:48
      248500 -- (-2077.479) (-2076.207) [-2075.812] (-2077.500) * (-2078.614) (-2074.530) (-2075.783) [-2074.953] -- 0:00:48
      249000 -- (-2079.394) [-2075.283] (-2075.189) (-2076.486) * (-2078.167) (-2076.161) (-2077.691) [-2074.258] -- 0:00:48
      249500 -- (-2081.117) (-2074.375) (-2076.036) [-2076.450] * [-2081.565] (-2076.092) (-2077.329) (-2075.200) -- 0:00:48
      250000 -- [-2081.130] (-2074.346) (-2078.902) (-2077.986) * (-2077.029) [-2076.234] (-2076.080) (-2077.793) -- 0:00:48

      Average standard deviation of split frequencies: 0.014381

      250500 -- [-2082.633] (-2074.956) (-2080.786) (-2076.074) * (-2079.141) (-2075.641) [-2075.128] (-2079.242) -- 0:00:47
      251000 -- [-2079.889] (-2074.996) (-2077.352) (-2077.462) * [-2076.003] (-2075.769) (-2077.129) (-2079.473) -- 0:00:47
      251500 -- (-2080.950) [-2074.845] (-2077.405) (-2076.501) * (-2075.111) (-2079.646) [-2076.664] (-2079.155) -- 0:00:47
      252000 -- (-2081.512) [-2074.560] (-2074.194) (-2075.749) * [-2075.494] (-2077.131) (-2076.287) (-2077.290) -- 0:00:47
      252500 -- [-2074.614] (-2077.901) (-2077.486) (-2077.813) * (-2077.874) [-2075.021] (-2075.307) (-2077.293) -- 0:00:47
      253000 -- [-2076.311] (-2078.895) (-2074.425) (-2076.237) * (-2076.326) [-2074.944] (-2075.747) (-2082.711) -- 0:00:47
      253500 -- (-2076.458) (-2080.595) (-2074.425) [-2077.184] * (-2076.952) [-2075.905] (-2076.048) (-2079.254) -- 0:00:47
      254000 -- (-2075.895) (-2076.949) [-2074.425] (-2076.818) * (-2078.367) (-2075.131) (-2077.462) [-2080.476] -- 0:00:49
      254500 -- (-2075.393) (-2078.617) (-2074.708) [-2075.727] * (-2076.558) [-2076.480] (-2080.384) (-2079.900) -- 0:00:49
      255000 -- (-2075.503) [-2076.342] (-2077.216) (-2076.874) * (-2078.078) [-2074.786] (-2083.173) (-2081.816) -- 0:00:49

      Average standard deviation of split frequencies: 0.014962

      255500 -- [-2076.974] (-2076.011) (-2074.474) (-2078.347) * (-2076.558) [-2074.753] (-2079.024) (-2078.570) -- 0:00:49
      256000 -- (-2079.105) [-2076.158] (-2074.325) (-2075.445) * (-2075.359) (-2076.320) [-2076.233] (-2077.146) -- 0:00:49
      256500 -- (-2077.105) (-2075.279) [-2074.822] (-2076.214) * [-2078.382] (-2077.059) (-2077.069) (-2077.775) -- 0:00:49
      257000 -- (-2076.593) (-2077.569) [-2074.823] (-2077.447) * (-2077.291) (-2076.184) [-2077.422] (-2077.558) -- 0:00:49
      257500 -- (-2078.631) (-2078.286) (-2074.471) [-2075.472] * (-2075.151) (-2080.469) (-2077.322) [-2078.352] -- 0:00:49
      258000 -- (-2075.798) (-2075.813) (-2077.209) [-2075.251] * (-2076.553) (-2083.358) (-2077.945) [-2079.406] -- 0:00:48
      258500 -- (-2077.415) [-2075.184] (-2079.562) (-2077.742) * (-2076.921) (-2076.010) [-2077.989] (-2075.947) -- 0:00:48
      259000 -- [-2078.525] (-2077.412) (-2077.060) (-2076.642) * (-2076.285) (-2074.699) (-2077.135) [-2075.276] -- 0:00:48
      259500 -- (-2080.262) (-2078.349) (-2076.392) [-2076.368] * (-2077.651) (-2075.624) (-2077.088) [-2077.178] -- 0:00:48
      260000 -- [-2078.934] (-2077.118) (-2079.946) (-2074.934) * [-2075.221] (-2075.717) (-2078.161) (-2080.422) -- 0:00:48

      Average standard deviation of split frequencies: 0.013676

      260500 -- (-2078.998) [-2075.169] (-2076.249) (-2074.498) * (-2076.806) (-2075.376) [-2075.865] (-2075.894) -- 0:00:48
      261000 -- (-2076.160) [-2076.133] (-2074.949) (-2074.712) * (-2078.060) [-2075.938] (-2078.470) (-2075.772) -- 0:00:48
      261500 -- [-2076.694] (-2074.928) (-2074.634) (-2074.963) * [-2077.364] (-2077.732) (-2078.760) (-2075.412) -- 0:00:48
      262000 -- [-2076.045] (-2078.051) (-2076.637) (-2074.885) * (-2078.433) (-2076.529) (-2077.351) [-2076.308] -- 0:00:47
      262500 -- (-2076.161) [-2076.202] (-2076.694) (-2074.980) * (-2077.296) (-2077.854) (-2076.590) [-2078.523] -- 0:00:47
      263000 -- [-2081.872] (-2076.117) (-2080.243) (-2076.135) * (-2076.060) (-2077.003) (-2077.282) [-2078.857] -- 0:00:47
      263500 -- (-2081.332) (-2076.313) (-2077.541) [-2077.000] * (-2075.600) (-2075.442) (-2077.655) [-2079.032] -- 0:00:47
      264000 -- (-2078.310) [-2078.007] (-2078.906) (-2075.523) * (-2075.442) (-2080.004) (-2075.074) [-2078.042] -- 0:00:47
      264500 -- (-2075.718) [-2075.436] (-2075.129) (-2076.920) * (-2075.467) (-2076.682) [-2076.224] (-2077.368) -- 0:00:47
      265000 -- (-2076.574) (-2076.262) [-2075.007] (-2076.130) * (-2077.812) (-2076.799) [-2076.478] (-2077.497) -- 0:00:47

      Average standard deviation of split frequencies: 0.013291

      265500 -- (-2075.662) (-2076.756) (-2078.423) [-2078.552] * [-2074.913] (-2076.549) (-2075.734) (-2076.994) -- 0:00:47
      266000 -- [-2075.108] (-2075.751) (-2076.633) (-2076.696) * (-2076.633) (-2074.692) (-2075.817) [-2077.676] -- 0:00:46
      266500 -- (-2078.681) [-2078.671] (-2075.863) (-2075.460) * (-2080.486) [-2074.994] (-2075.853) (-2075.008) -- 0:00:46
      267000 -- (-2075.789) (-2078.359) (-2077.652) [-2076.193] * (-2077.888) (-2075.432) (-2076.108) [-2074.933] -- 0:00:46
      267500 -- [-2075.787] (-2077.281) (-2077.188) (-2075.156) * [-2076.406] (-2076.538) (-2076.108) (-2079.143) -- 0:00:46
      268000 -- (-2077.431) (-2076.394) (-2076.740) [-2076.463] * (-2078.277) [-2077.524] (-2077.855) (-2078.154) -- 0:00:46
      268500 -- [-2078.059] (-2079.158) (-2075.535) (-2076.427) * (-2077.233) (-2074.933) (-2080.682) [-2078.507] -- 0:00:46
      269000 -- [-2074.934] (-2079.112) (-2074.659) (-2077.457) * (-2076.965) [-2075.360] (-2077.927) (-2077.987) -- 0:00:48
      269500 -- [-2077.825] (-2077.701) (-2077.263) (-2076.894) * [-2077.221] (-2075.027) (-2076.452) (-2076.363) -- 0:00:48
      270000 -- (-2077.151) (-2078.293) (-2075.848) [-2077.505] * (-2080.148) [-2075.097] (-2075.669) (-2078.526) -- 0:00:48

      Average standard deviation of split frequencies: 0.014695

      270500 -- (-2075.510) [-2078.157] (-2076.091) (-2074.969) * [-2077.609] (-2076.163) (-2074.864) (-2078.286) -- 0:00:48
      271000 -- (-2076.754) (-2074.359) (-2074.521) [-2074.816] * (-2079.584) (-2077.396) [-2074.973] (-2077.200) -- 0:00:48
      271500 -- [-2075.346] (-2074.771) (-2076.072) (-2075.854) * (-2075.361) (-2074.929) (-2077.072) [-2079.760] -- 0:00:48
      272000 -- (-2079.113) [-2075.270] (-2076.107) (-2082.073) * (-2075.688) (-2076.699) [-2076.686] (-2083.935) -- 0:00:48
      272500 -- (-2079.299) (-2074.529) [-2075.702] (-2078.098) * [-2078.903] (-2076.084) (-2078.237) (-2076.795) -- 0:00:48
      273000 -- (-2080.230) [-2075.231] (-2077.159) (-2077.582) * (-2078.319) (-2077.267) [-2075.450] (-2076.142) -- 0:00:47
      273500 -- (-2074.793) [-2074.655] (-2074.755) (-2079.644) * (-2077.426) [-2077.781] (-2075.960) (-2076.595) -- 0:00:47
      274000 -- (-2074.918) (-2075.309) [-2080.080] (-2077.669) * (-2077.510) [-2074.658] (-2078.233) (-2075.540) -- 0:00:47
      274500 -- (-2075.817) (-2078.284) [-2076.216] (-2079.513) * (-2077.464) [-2075.718] (-2077.906) (-2075.954) -- 0:00:47
      275000 -- [-2077.174] (-2075.807) (-2078.054) (-2075.620) * (-2076.777) (-2076.182) (-2076.882) [-2076.330] -- 0:00:47

      Average standard deviation of split frequencies: 0.015774

      275500 -- (-2079.407) [-2076.174] (-2076.395) (-2075.651) * (-2080.004) [-2074.732] (-2074.565) (-2078.011) -- 0:00:47
      276000 -- (-2081.367) (-2077.700) (-2077.128) [-2075.165] * (-2076.255) (-2075.275) (-2074.565) [-2076.555] -- 0:00:47
      276500 -- (-2075.255) [-2076.950] (-2077.349) (-2074.995) * (-2077.122) [-2075.692] (-2076.528) (-2075.992) -- 0:00:47
      277000 -- [-2076.158] (-2078.946) (-2077.567) (-2075.026) * (-2079.004) [-2077.095] (-2075.985) (-2074.917) -- 0:00:46
      277500 -- [-2075.344] (-2079.770) (-2075.154) (-2075.106) * (-2077.548) (-2076.560) [-2075.792] (-2074.999) -- 0:00:46
      278000 -- [-2074.385] (-2079.229) (-2075.972) (-2075.080) * [-2078.267] (-2077.197) (-2075.084) (-2075.027) -- 0:00:46
      278500 -- (-2076.382) [-2077.318] (-2075.330) (-2074.946) * (-2079.682) (-2076.972) (-2076.764) [-2075.667] -- 0:00:46
      279000 -- (-2077.147) (-2075.263) (-2075.176) [-2077.135] * (-2080.405) (-2075.662) (-2078.775) [-2079.752] -- 0:00:46
      279500 -- (-2074.797) (-2077.289) (-2077.150) [-2078.301] * [-2076.843] (-2075.858) (-2076.088) (-2078.885) -- 0:00:46
      280000 -- (-2075.536) [-2076.257] (-2075.164) (-2074.678) * (-2076.681) (-2075.841) [-2076.809] (-2080.513) -- 0:00:46

      Average standard deviation of split frequencies: 0.016481

      280500 -- [-2075.694] (-2074.853) (-2075.682) (-2075.159) * [-2078.007] (-2076.348) (-2077.375) (-2078.395) -- 0:00:46
      281000 -- (-2075.313) (-2075.299) (-2078.355) [-2075.089] * (-2078.641) [-2074.997] (-2077.352) (-2076.324) -- 0:00:46
      281500 -- (-2076.431) (-2078.467) [-2075.802] (-2075.837) * (-2076.411) (-2075.251) [-2080.045] (-2078.394) -- 0:00:45
      282000 -- [-2075.961] (-2081.911) (-2077.857) (-2076.034) * [-2075.094] (-2075.251) (-2080.570) (-2078.621) -- 0:00:45
      282500 -- [-2078.102] (-2077.185) (-2076.668) (-2075.948) * [-2075.111] (-2075.614) (-2077.154) (-2075.760) -- 0:00:45
      283000 -- [-2078.009] (-2081.312) (-2076.063) (-2074.384) * (-2076.012) (-2076.338) [-2077.800] (-2077.338) -- 0:00:45
      283500 -- (-2076.247) (-2076.326) [-2075.162] (-2079.399) * (-2080.285) (-2075.266) (-2078.742) [-2075.368] -- 0:00:48
      284000 -- (-2074.519) (-2076.020) [-2078.286] (-2075.723) * (-2080.968) [-2075.192] (-2075.621) (-2077.516) -- 0:00:47
      284500 -- (-2078.829) (-2074.942) (-2078.338) [-2078.140] * [-2076.282] (-2074.674) (-2075.959) (-2077.459) -- 0:00:47
      285000 -- (-2077.909) (-2081.357) [-2079.148] (-2078.438) * (-2076.379) [-2075.338] (-2079.495) (-2077.462) -- 0:00:47

      Average standard deviation of split frequencies: 0.015998

      285500 -- (-2077.082) (-2076.116) [-2075.553] (-2081.498) * [-2075.558] (-2075.983) (-2076.748) (-2077.653) -- 0:00:47
      286000 -- [-2075.158] (-2077.165) (-2077.359) (-2079.752) * (-2078.229) (-2080.143) (-2077.910) [-2076.700] -- 0:00:47
      286500 -- [-2077.899] (-2074.841) (-2076.691) (-2077.258) * [-2074.974] (-2078.616) (-2076.117) (-2077.015) -- 0:00:47
      287000 -- (-2075.645) (-2075.285) [-2079.107] (-2078.327) * (-2076.010) (-2076.524) [-2075.000] (-2079.856) -- 0:00:47
      287500 -- (-2078.581) [-2075.812] (-2075.979) (-2081.891) * (-2081.135) [-2076.406] (-2075.327) (-2074.822) -- 0:00:47
      288000 -- (-2078.251) (-2075.189) [-2075.545] (-2078.852) * (-2077.288) (-2079.462) (-2074.809) [-2079.691] -- 0:00:46
      288500 -- [-2078.464] (-2074.981) (-2080.130) (-2078.144) * (-2075.710) (-2079.922) (-2076.298) [-2078.215] -- 0:00:46
      289000 -- [-2077.120] (-2075.392) (-2079.338) (-2077.248) * (-2076.619) (-2075.585) [-2075.658] (-2075.089) -- 0:00:46
      289500 -- (-2080.929) (-2075.873) [-2075.208] (-2078.179) * [-2076.291] (-2076.668) (-2074.928) (-2075.398) -- 0:00:46
      290000 -- (-2077.669) (-2075.884) [-2075.521] (-2076.161) * (-2075.377) (-2079.511) [-2074.362] (-2080.696) -- 0:00:46

      Average standard deviation of split frequencies: 0.015932

      290500 -- (-2075.297) (-2078.556) [-2076.273] (-2076.233) * [-2077.458] (-2079.833) (-2079.107) (-2076.581) -- 0:00:46
      291000 -- (-2075.025) (-2076.445) (-2077.116) [-2074.956] * (-2078.442) (-2079.378) (-2078.031) [-2078.249] -- 0:00:46
      291500 -- [-2075.123] (-2075.953) (-2076.067) (-2075.251) * (-2078.270) (-2078.660) (-2075.813) [-2077.024] -- 0:00:46
      292000 -- (-2075.123) (-2077.464) [-2075.837] (-2074.700) * (-2077.418) [-2076.834] (-2076.865) (-2074.775) -- 0:00:46
      292500 -- (-2075.117) [-2075.356] (-2077.067) (-2075.591) * (-2079.668) [-2077.715] (-2075.003) (-2074.977) -- 0:00:45
      293000 -- (-2076.566) (-2075.396) [-2077.123] (-2074.897) * (-2076.163) (-2077.717) [-2074.371] (-2074.891) -- 0:00:45
      293500 -- (-2074.558) (-2075.768) [-2080.009] (-2075.073) * (-2075.587) [-2077.522] (-2075.342) (-2075.463) -- 0:00:45
      294000 -- [-2075.019] (-2076.684) (-2078.308) (-2074.807) * (-2075.275) (-2076.801) [-2075.477] (-2075.726) -- 0:00:45
      294500 -- [-2078.599] (-2075.782) (-2078.991) (-2074.474) * [-2074.823] (-2081.300) (-2075.392) (-2078.647) -- 0:00:45
      295000 -- (-2074.811) (-2074.769) (-2078.913) [-2076.500] * (-2077.344) [-2081.080] (-2075.888) (-2077.009) -- 0:00:45

      Average standard deviation of split frequencies: 0.016324

      295500 -- (-2074.866) (-2075.046) [-2079.776] (-2075.309) * (-2077.518) (-2077.787) [-2077.793] (-2075.967) -- 0:00:45
      296000 -- (-2075.168) [-2075.528] (-2082.085) (-2080.886) * (-2078.063) (-2080.915) (-2074.874) [-2077.531] -- 0:00:45
      296500 -- (-2075.168) (-2078.995) (-2078.066) [-2080.505] * (-2076.105) (-2077.464) (-2074.889) [-2077.520] -- 0:00:45
      297000 -- (-2075.759) (-2079.053) (-2077.990) [-2078.012] * [-2076.322] (-2080.800) (-2074.465) (-2077.297) -- 0:00:44
      297500 -- (-2075.601) (-2078.011) (-2075.694) [-2081.397] * [-2075.121] (-2078.280) (-2079.847) (-2076.306) -- 0:00:44
      298000 -- [-2075.918] (-2077.378) (-2082.009) (-2077.238) * (-2076.866) (-2078.824) [-2081.591] (-2076.399) -- 0:00:44
      298500 -- [-2074.953] (-2079.443) (-2086.380) (-2076.976) * (-2076.286) (-2078.004) [-2075.579] (-2075.908) -- 0:00:47
      299000 -- [-2077.043] (-2078.961) (-2086.239) (-2074.564) * [-2077.287] (-2082.699) (-2076.540) (-2077.226) -- 0:00:46
      299500 -- (-2077.021) (-2078.667) [-2076.953] (-2078.412) * (-2076.809) [-2075.676] (-2077.772) (-2075.415) -- 0:00:46
      300000 -- (-2077.553) (-2079.250) [-2077.445] (-2075.593) * [-2075.838] (-2076.631) (-2077.025) (-2077.022) -- 0:00:46

      Average standard deviation of split frequencies: 0.016463

      300500 -- (-2075.442) (-2078.162) [-2076.763] (-2076.247) * (-2076.726) [-2078.146] (-2078.919) (-2075.020) -- 0:00:46
      301000 -- (-2076.053) [-2075.784] (-2074.744) (-2078.323) * (-2076.159) (-2076.754) [-2074.811] (-2077.851) -- 0:00:46
      301500 -- [-2076.106] (-2075.779) (-2078.000) (-2075.206) * (-2077.784) (-2074.713) [-2078.066] (-2076.029) -- 0:00:46
      302000 -- [-2076.161] (-2078.525) (-2077.850) (-2075.308) * (-2078.848) (-2075.990) [-2077.330] (-2075.631) -- 0:00:46
      302500 -- [-2079.248] (-2076.688) (-2077.137) (-2076.925) * (-2076.016) (-2076.511) [-2079.217] (-2075.017) -- 0:00:46
      303000 -- (-2076.200) [-2076.250] (-2084.290) (-2075.488) * (-2075.211) (-2078.034) [-2075.143] (-2075.017) -- 0:00:46
      303500 -- [-2077.646] (-2078.199) (-2080.562) (-2074.332) * (-2074.899) [-2078.593] (-2074.968) (-2075.239) -- 0:00:45
      304000 -- [-2077.028] (-2077.576) (-2076.954) (-2078.347) * (-2074.951) (-2076.919) [-2074.943] (-2077.737) -- 0:00:45
      304500 -- (-2077.428) (-2078.614) (-2077.115) [-2075.901] * (-2076.409) (-2077.759) (-2079.260) [-2078.537] -- 0:00:45
      305000 -- (-2077.543) (-2078.356) [-2075.194] (-2076.480) * (-2075.533) (-2077.588) [-2076.116] (-2078.512) -- 0:00:45

      Average standard deviation of split frequencies: 0.017037

      305500 -- (-2076.628) [-2078.557] (-2075.598) (-2082.462) * (-2075.654) (-2077.399) [-2075.079] (-2079.255) -- 0:00:45
      306000 -- [-2079.692] (-2076.153) (-2075.598) (-2079.526) * [-2075.030] (-2077.796) (-2077.628) (-2077.814) -- 0:00:45
      306500 -- (-2079.408) (-2076.445) (-2077.384) [-2075.735] * (-2074.859) (-2075.024) [-2077.567] (-2078.216) -- 0:00:45
      307000 -- (-2075.035) (-2076.190) [-2076.726] (-2075.889) * (-2075.232) [-2075.329] (-2075.361) (-2075.855) -- 0:00:45
      307500 -- (-2075.311) (-2075.613) (-2076.396) [-2078.010] * (-2075.842) [-2075.978] (-2079.001) (-2075.929) -- 0:00:45
      308000 -- (-2075.565) (-2075.567) (-2078.183) [-2075.408] * (-2077.667) [-2075.506] (-2079.382) (-2077.911) -- 0:00:44
      308500 -- (-2079.168) (-2079.807) [-2077.531] (-2079.794) * (-2076.680) (-2075.248) (-2077.391) [-2077.364] -- 0:00:44
      309000 -- (-2079.306) [-2077.667] (-2076.865) (-2081.219) * [-2076.693] (-2075.661) (-2076.173) (-2077.712) -- 0:00:44
      309500 -- (-2074.447) [-2076.798] (-2075.860) (-2076.666) * (-2075.830) [-2074.600] (-2075.877) (-2077.983) -- 0:00:44
      310000 -- (-2079.351) (-2076.432) (-2077.350) [-2076.364] * (-2075.354) (-2077.965) [-2075.391] (-2078.735) -- 0:00:44

      Average standard deviation of split frequencies: 0.017495

      310500 -- (-2075.953) (-2075.768) [-2075.173] (-2076.381) * (-2076.750) (-2076.463) [-2075.060] (-2077.014) -- 0:00:44
      311000 -- (-2078.432) [-2075.279] (-2075.222) (-2075.024) * [-2074.848] (-2079.490) (-2079.503) (-2077.874) -- 0:00:44
      311500 -- (-2076.927) (-2076.469) (-2075.549) [-2076.145] * (-2077.428) (-2078.013) (-2079.423) [-2076.074] -- 0:00:44
      312000 -- (-2075.553) [-2075.760] (-2075.775) (-2081.265) * [-2075.465] (-2077.382) (-2079.243) (-2076.551) -- 0:00:44
      312500 -- (-2075.798) (-2075.204) [-2075.892] (-2080.728) * (-2075.346) [-2076.799] (-2082.662) (-2078.412) -- 0:00:44
      313000 -- [-2075.615] (-2075.813) (-2075.812) (-2075.850) * [-2077.325] (-2076.140) (-2076.270) (-2076.093) -- 0:00:43
      313500 -- (-2077.719) (-2077.592) [-2076.125] (-2077.952) * (-2076.611) (-2075.015) [-2078.406] (-2078.571) -- 0:00:45
      314000 -- (-2074.786) (-2075.519) (-2076.125) [-2075.640] * (-2077.370) (-2074.862) (-2076.470) [-2077.892] -- 0:00:45
      314500 -- (-2077.754) (-2075.570) [-2075.096] (-2074.745) * (-2075.751) (-2075.487) [-2074.593] (-2076.343) -- 0:00:45
      315000 -- (-2075.790) [-2076.024] (-2075.610) (-2076.945) * (-2077.661) (-2075.273) [-2076.292] (-2080.233) -- 0:00:45

      Average standard deviation of split frequencies: 0.016936

      315500 -- (-2075.832) [-2075.169] (-2077.149) (-2083.411) * (-2079.875) (-2074.615) [-2076.072] (-2079.407) -- 0:00:45
      316000 -- (-2076.181) (-2075.721) [-2075.441] (-2078.994) * (-2079.357) [-2074.824] (-2078.758) (-2075.849) -- 0:00:45
      316500 -- (-2075.722) [-2077.502] (-2076.629) (-2077.358) * (-2078.331) [-2077.459] (-2077.936) (-2075.711) -- 0:00:45
      317000 -- (-2075.344) (-2076.552) [-2076.697] (-2077.192) * [-2076.678] (-2075.558) (-2078.928) (-2075.167) -- 0:00:45
      317500 -- (-2075.345) [-2076.265] (-2078.320) (-2077.035) * (-2077.288) [-2075.180] (-2078.881) (-2076.001) -- 0:00:45
      318000 -- [-2075.355] (-2076.912) (-2081.180) (-2075.401) * [-2078.738] (-2074.670) (-2079.041) (-2076.150) -- 0:00:45
      318500 -- [-2075.310] (-2077.622) (-2080.914) (-2075.706) * (-2077.265) [-2076.498] (-2080.707) (-2074.505) -- 0:00:44
      319000 -- (-2076.893) [-2078.533] (-2076.859) (-2075.464) * [-2076.658] (-2075.374) (-2081.603) (-2074.507) -- 0:00:44
      319500 -- (-2076.747) (-2078.074) [-2076.422] (-2075.964) * (-2076.155) (-2075.762) (-2080.785) [-2074.507] -- 0:00:44
      320000 -- (-2075.924) (-2079.492) [-2076.186] (-2076.808) * (-2076.856) [-2075.708] (-2080.797) (-2074.500) -- 0:00:44

      Average standard deviation of split frequencies: 0.017209

      320500 -- (-2080.392) (-2080.088) (-2081.553) [-2075.320] * (-2077.306) [-2075.190] (-2080.691) (-2074.464) -- 0:00:44
      321000 -- [-2075.213] (-2079.292) (-2075.845) (-2078.106) * (-2075.426) (-2075.751) (-2078.606) [-2074.222] -- 0:00:44
      321500 -- (-2075.416) (-2076.359) [-2077.211] (-2076.840) * (-2077.663) (-2076.906) (-2076.199) [-2074.222] -- 0:00:44
      322000 -- [-2080.216] (-2076.604) (-2077.966) (-2077.782) * (-2081.144) (-2075.553) (-2074.767) [-2075.421] -- 0:00:44
      322500 -- (-2078.011) (-2077.328) (-2080.215) [-2074.941] * (-2080.555) [-2076.922] (-2074.956) (-2078.478) -- 0:00:44
      323000 -- (-2077.962) [-2076.333] (-2074.443) (-2074.992) * (-2076.948) [-2076.546] (-2074.828) (-2077.988) -- 0:00:44
      323500 -- [-2079.481] (-2075.917) (-2075.135) (-2075.152) * (-2075.243) [-2077.030] (-2074.866) (-2075.480) -- 0:00:43
      324000 -- (-2075.433) (-2076.102) [-2078.781] (-2075.782) * (-2074.974) (-2077.010) [-2075.453] (-2076.153) -- 0:00:43
      324500 -- (-2077.255) (-2075.446) [-2079.295] (-2074.867) * (-2076.611) (-2078.245) [-2074.778] (-2075.928) -- 0:00:43
      325000 -- (-2074.784) (-2075.043) (-2076.220) [-2078.461] * (-2074.903) (-2075.431) (-2077.905) [-2076.944] -- 0:00:43

      Average standard deviation of split frequencies: 0.016629

      325500 -- (-2080.151) (-2074.774) [-2075.533] (-2076.213) * [-2075.638] (-2076.637) (-2077.431) (-2076.497) -- 0:00:43
      326000 -- (-2077.215) (-2076.659) [-2075.751] (-2075.363) * (-2074.988) (-2076.377) [-2075.752] (-2076.618) -- 0:00:43
      326500 -- (-2074.710) [-2076.301] (-2081.070) (-2079.301) * [-2074.988] (-2075.964) (-2076.317) (-2076.227) -- 0:00:43
      327000 -- [-2074.269] (-2075.529) (-2077.983) (-2076.453) * (-2077.330) [-2081.011] (-2075.514) (-2080.473) -- 0:00:43
      327500 -- [-2074.245] (-2077.561) (-2074.654) (-2078.784) * (-2077.609) [-2078.152] (-2075.342) (-2079.536) -- 0:00:43
      328000 -- (-2076.426) (-2078.473) (-2074.655) [-2080.314] * (-2075.450) [-2078.170] (-2075.220) (-2075.134) -- 0:00:43
      328500 -- (-2077.300) (-2081.066) (-2083.759) [-2075.908] * [-2075.604] (-2076.074) (-2077.335) (-2074.520) -- 0:00:44
      329000 -- (-2077.290) (-2089.357) [-2079.258] (-2076.470) * (-2075.523) (-2076.115) (-2080.455) [-2075.835] -- 0:00:44
      329500 -- (-2079.426) (-2076.058) [-2076.304] (-2077.151) * (-2075.788) (-2075.729) (-2077.351) [-2076.305] -- 0:00:44
      330000 -- (-2078.348) [-2075.075] (-2074.788) (-2074.955) * (-2078.284) [-2075.458] (-2075.734) (-2076.405) -- 0:00:44

      Average standard deviation of split frequencies: 0.016236

      330500 -- (-2076.347) (-2076.068) [-2076.271] (-2075.297) * (-2075.136) (-2077.562) (-2077.169) [-2075.728] -- 0:00:44
      331000 -- (-2078.821) (-2074.522) [-2076.362] (-2078.464) * (-2077.177) (-2077.204) (-2075.783) [-2074.998] -- 0:00:44
      331500 -- (-2077.769) (-2075.429) (-2078.785) [-2075.899] * (-2080.199) [-2076.466] (-2076.406) (-2079.992) -- 0:00:44
      332000 -- (-2078.236) [-2074.798] (-2075.893) (-2075.892) * [-2079.249] (-2077.915) (-2078.152) (-2077.166) -- 0:00:44
      332500 -- (-2080.588) (-2074.800) (-2076.081) [-2075.892] * (-2076.864) [-2074.571] (-2077.507) (-2076.474) -- 0:00:44
      333000 -- [-2076.832] (-2075.027) (-2075.372) (-2075.184) * (-2076.678) [-2075.236] (-2075.154) (-2075.558) -- 0:00:44
      333500 -- (-2074.590) (-2075.095) [-2078.246] (-2074.764) * (-2076.394) [-2074.931] (-2074.219) (-2075.628) -- 0:00:43
      334000 -- (-2075.042) [-2075.543] (-2075.424) (-2076.123) * (-2079.868) [-2074.931] (-2075.561) (-2076.366) -- 0:00:43
      334500 -- (-2074.942) (-2075.236) [-2077.676] (-2074.983) * (-2080.644) (-2074.304) (-2075.640) [-2079.673] -- 0:00:43
      335000 -- (-2074.912) (-2076.798) [-2077.577] (-2075.061) * (-2075.450) (-2074.313) (-2076.865) [-2077.619] -- 0:00:43

      Average standard deviation of split frequencies: 0.015589

      335500 -- (-2075.070) (-2077.537) (-2081.497) [-2076.337] * [-2075.774] (-2074.804) (-2075.933) (-2080.481) -- 0:00:43
      336000 -- (-2076.870) [-2074.588] (-2076.784) (-2075.253) * (-2076.049) (-2075.273) [-2075.964] (-2078.603) -- 0:00:43
      336500 -- (-2076.359) (-2074.871) [-2076.205] (-2075.253) * (-2077.903) [-2074.660] (-2076.145) (-2081.602) -- 0:00:43
      337000 -- (-2076.319) (-2075.406) [-2075.675] (-2077.171) * (-2078.999) (-2078.377) (-2078.885) [-2082.991] -- 0:00:43
      337500 -- [-2075.335] (-2075.369) (-2075.135) (-2076.428) * (-2076.369) (-2077.342) (-2078.808) [-2077.512] -- 0:00:43
      338000 -- [-2076.635] (-2074.894) (-2075.101) (-2076.720) * [-2078.825] (-2076.656) (-2079.885) (-2074.446) -- 0:00:43
      338500 -- (-2076.680) [-2076.710] (-2075.180) (-2077.641) * (-2082.051) [-2077.964] (-2080.505) (-2074.607) -- 0:00:42
      339000 -- [-2078.669] (-2080.582) (-2075.348) (-2078.763) * (-2084.082) (-2078.728) [-2075.473] (-2074.912) -- 0:00:42
      339500 -- (-2076.369) [-2075.878] (-2074.545) (-2077.216) * (-2076.095) (-2076.790) [-2076.157] (-2075.158) -- 0:00:42
      340000 -- (-2075.862) [-2076.412] (-2075.404) (-2077.245) * (-2076.148) [-2077.042] (-2076.668) (-2075.126) -- 0:00:42

      Average standard deviation of split frequencies: 0.015791

      340500 -- [-2076.076] (-2077.008) (-2075.313) (-2075.299) * (-2075.880) (-2075.932) (-2077.097) [-2081.209] -- 0:00:42
      341000 -- (-2081.266) (-2076.269) [-2076.229] (-2082.053) * (-2076.535) (-2077.542) [-2077.620] (-2078.023) -- 0:00:42
      341500 -- (-2075.248) (-2079.736) [-2075.009] (-2081.799) * (-2075.222) (-2075.360) (-2077.870) [-2075.897] -- 0:00:42
      342000 -- (-2075.845) (-2079.581) [-2075.213] (-2077.533) * [-2076.727] (-2076.185) (-2077.492) (-2077.948) -- 0:00:42
      342500 -- (-2082.501) [-2077.454] (-2078.296) (-2076.625) * [-2077.299] (-2077.693) (-2077.323) (-2075.258) -- 0:00:42
      343000 -- (-2076.604) (-2076.463) (-2075.277) [-2075.904] * (-2075.423) (-2078.630) (-2076.474) [-2080.094] -- 0:00:42
      343500 -- (-2076.953) [-2077.724] (-2075.829) (-2076.708) * (-2075.423) [-2077.901] (-2075.734) (-2075.975) -- 0:00:43
      344000 -- [-2078.543] (-2076.309) (-2075.562) (-2076.545) * (-2075.501) (-2080.067) [-2076.168] (-2075.361) -- 0:00:43
      344500 -- (-2075.925) [-2076.401] (-2076.321) (-2076.675) * (-2078.584) (-2079.661) [-2076.900] (-2076.304) -- 0:00:43
      345000 -- [-2076.786] (-2078.171) (-2076.237) (-2076.181) * (-2074.258) [-2075.723] (-2078.487) (-2076.164) -- 0:00:43

      Average standard deviation of split frequencies: 0.016274

      345500 -- (-2075.809) (-2077.926) (-2076.022) [-2076.193] * (-2074.706) (-2078.510) (-2080.735) [-2076.854] -- 0:00:43
      346000 -- [-2076.101] (-2076.943) (-2074.732) (-2074.634) * (-2077.129) [-2078.969] (-2078.370) (-2076.323) -- 0:00:43
      346500 -- (-2074.643) (-2076.197) [-2074.245] (-2077.346) * (-2079.763) (-2080.832) (-2076.322) [-2075.828] -- 0:00:43
      347000 -- (-2077.573) (-2075.128) [-2076.881] (-2075.991) * (-2078.353) (-2078.549) (-2077.331) [-2077.236] -- 0:00:43
      347500 -- [-2077.478] (-2075.295) (-2081.150) (-2075.159) * (-2077.868) [-2077.704] (-2078.518) (-2076.752) -- 0:00:43
      348000 -- (-2080.353) (-2075.088) [-2078.175] (-2079.153) * (-2080.884) (-2079.023) [-2076.213] (-2078.566) -- 0:00:43
      348500 -- (-2079.125) (-2075.487) (-2077.139) [-2080.684] * [-2076.711] (-2076.750) (-2074.376) (-2077.030) -- 0:00:42
      349000 -- (-2079.201) (-2075.132) [-2075.914] (-2076.846) * (-2075.831) [-2075.624] (-2081.054) (-2078.214) -- 0:00:42
      349500 -- (-2076.728) [-2075.082] (-2076.999) (-2078.590) * [-2075.509] (-2075.386) (-2075.965) (-2075.615) -- 0:0