--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:10:37 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1633/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2196.20         -2200.14
2      -2196.39         -2199.44
--------------------------------------
TOTAL    -2196.29         -2199.85
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.886080    0.088176    0.329732    1.451095    0.849566   1465.24   1483.12    1.000
r(A<->C){all}   0.225082    0.027538    0.000244    0.538408    0.191796     66.72    159.82    1.002
r(A<->G){all}   0.161158    0.020084    0.000020    0.447298    0.118404    200.10    226.38    1.000
r(A<->T){all}   0.160341    0.019200    0.000042    0.435961    0.125750    263.79    278.76    1.001
r(C<->G){all}   0.136396    0.015263    0.000049    0.384528    0.099136     93.67    240.25    1.005
r(C<->T){all}   0.143539    0.017312    0.000006    0.423032    0.105371    175.52    181.64    1.000
r(G<->T){all}   0.173484    0.021154    0.000130    0.461711    0.137154    196.50    197.57    1.001
pi(A){all}      0.184572    0.000092    0.166016    0.202862    0.184670   1095.58   1116.28    1.000
pi(C){all}      0.296693    0.000128    0.273844    0.317953    0.296719   1148.60   1159.32    1.000
pi(G){all}      0.317829    0.000131    0.295503    0.340261    0.317785    999.95   1070.63    1.000
pi(T){all}      0.200906    0.000100    0.180810    0.219837    0.200666   1222.52   1241.71    1.000
alpha{1,2}      0.308311    0.137392    0.000216    1.103001    0.189209   1005.14   1217.54    1.003
alpha{3}        0.423354    0.236513    0.000107    1.391062    0.249701   1093.26   1155.28    1.002
pinvar{all}     0.997956    0.000003    0.994724    0.999958    0.998436   1173.25   1267.67    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2050.930659
Model 2: PositiveSelection	-2050.699152
Model 0: one-ratio	-2050.699139
Model 7: beta	-2050.930659
Model 8: beta&w>1	-2050.699152


Model 0 vs 1	0.46304000000054657

Model 2 vs 1	0.4630139999999301

Model 8 vs 7	0.4630139999999301
>C1
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C2
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C3
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C4
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C5
VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
DDYVTEYLIGGTTPPSGAKCooooooooooooooo
>C6
VSMALSYRDKIARMLLIGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
DDYVTEYLIGGTTPPSGAKCooooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=550 

C1              VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
C2              VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
C3              VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
C4              VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
C5              ---------------VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
C6              ---------------VSMALSYRDKIARMLLIGTAIAAVALVLAGCVRVV
                               ****************:******************

C1              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
C2              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
C3              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
C4              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
C5              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
C6              SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
                **************************************************

C1              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
C2              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
C3              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
C4              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
C5              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
C6              VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
                **************************************************

C1              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
C2              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
C3              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
C4              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
C5              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
C6              LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
                **************************************************

C1              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
C2              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
C3              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
C4              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
C5              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
C6              IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
                **************************************************

C1              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
C2              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
C3              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
C4              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
C5              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
C6              AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
                **************************************************

C1              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
C2              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
C3              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
C4              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
C5              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
C6              LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
                **************************************************

C1              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
C2              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
C3              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
C4              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
C5              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
C6              GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
                **************************************************

C1              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
C2              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
C3              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
C4              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
C5              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
C6              DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
                **************************************************

C1              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
C2              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
C3              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
C4              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
C5              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
C6              WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
                **************************************************

C1              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC---------------
C2              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC---------------
C3              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC---------------
C4              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC---------------
C5              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKCooooooooooooooo
C6              DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKCooooooooooooooo
                ***********************************               




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  535 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  535 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16590]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16590]--->[16214]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.573 Mb, Max= 31.152 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
C2              VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
C3              VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
C4              VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
C5              VSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
C6              VSMALSYRDKIARMLLIGTAIAAVALVLAGCVRVVSGRALMAGPKLGEPV
                ****************:*********************************

C1              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
C2              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
C3              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
C4              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
C5              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
C6              AWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDDVAALAMIRFPATGDR
                **************************************************

C1              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
C2              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
C3              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
C4              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
C5              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
C6              MGSLVINPGGPGESGIEAALGVVQTLPKRVRERFDLVGFDPRGVGASRPA
                **************************************************

C1              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
C2              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
C3              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
C4              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
C5              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
C6              VWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQFIGRCIAKMGKIFLEN
                **************************************************

C1              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
C2              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
C3              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
C4              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
C5              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
C6              IGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGAAYAEAYPQNVRSMIL
                **************************************************

C1              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
C2              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
C3              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
C4              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
C5              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
C6              DGAVDPNADPIEADLRQAKGFQDAFNNYAADCARKLSCPLGADPAKAVDV
                **************************************************

C1              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
C2              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
C3              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
C4              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
C5              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
C6              YHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIVGTIMTLYSPTLWHHL
                **************************************************

C1              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
C2              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
C3              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
C4              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
C5              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
C6              TDGLSELVDHRGDTLLALADMYMRRDSQGHYTNATDARVAVNCVDQPPIT
                **************************************************

C1              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
C2              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
C3              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
C4              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
C5              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
C6              DRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAFWPVPPTSKPHIVSAP
                **************************************************

C1              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
C2              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
C3              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
C4              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
C5              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
C6              GLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCV
                **************************************************

C1              DDYVTEYLIGGTTPPSGAKC
C2              DDYVTEYLIGGTTPPSGAKC
C3              DDYVTEYLIGGTTPPSGAKC
C4              DDYVTEYLIGGTTPPSGAKC
C5              DDYVTEYLIGGTTPPSGAKC
C6              DDYVTEYLIGGTTPPSGAKC
                ********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.81 C1	 C6	 99.81
TOP	    5    0	 99.81 C6	 C1	 99.81
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.81 C2	 C6	 99.81
TOP	    5    1	 99.81 C6	 C2	 99.81
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.81 C3	 C6	 99.81
TOP	    5    2	 99.81 C6	 C3	 99.81
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.81 C4	 C6	 99.81
TOP	    5    3	 99.81 C6	 C4	 99.81
BOT	    4    5	 99.81 C5	 C6	 99.81
TOP	    5    4	 99.81 C6	 C5	 99.81
AVG	 0	 C1	  *	 99.96
AVG	 1	 C2	  *	 99.96
AVG	 2	 C3	  *	 99.96
AVG	 3	 C4	  *	 99.96
AVG	 4	 C5	  *	 99.96
AVG	 5	 C6	  *	 99.81
TOT	 TOT	  *	 99.94
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
C2              GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
C3              GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
C4              GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
C5              ---------------------------------------------GTGAG
C6              ---------------------------------------------GTGAG
                                                             *****

C1              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
C2              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
C3              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
C4              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
C5              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
C6              CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGATTGGGA
                *******************************************.******

C1              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
C2              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
C3              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
C4              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
C5              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
C6              CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
                **************************************************

C1              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
C2              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
C3              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
C4              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
C5              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
C6              AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
                **************************************************

C1              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
C2              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
C3              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
C4              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
C5              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
C6              GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
                **************************************************

C1              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
C2              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
C3              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
C4              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
C5              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
C6              TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
                **************************************************

C1              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
C2              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
C3              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
C4              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
C5              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
C6              GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
                **************************************************

C1              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
C2              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
C3              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
C4              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
C5              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
C6              TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
                **************************************************

C1              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
C2              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
C3              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
C4              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
C5              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
C6              CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
                **************************************************

C1              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
C2              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
C3              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
C4              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
C5              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
C6              CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
                **************************************************

C1              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
C2              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
C3              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
C4              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
C5              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
C6              GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
                **************************************************

C1              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
C2              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
C3              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
C4              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
C5              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
C6              ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
                **************************************************

C1              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
C2              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
C3              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
C4              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
C5              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
C6              ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
                **************************************************

C1              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
C2              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
C3              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
C4              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
C5              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
C6              GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
                **************************************************

C1              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
C2              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
C3              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
C4              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
C5              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
C6              ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
                **************************************************

C1              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
C2              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
C3              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
C4              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
C5              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
C6              GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
                **************************************************

C1              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
C2              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
C3              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
C4              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
C5              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
C6              CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
                **************************************************

C1              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
C2              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
C3              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
C4              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
C5              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
C6              AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
                **************************************************

C1              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
C2              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
C3              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
C4              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
C5              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
C6              CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
                **************************************************

C1              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
C2              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
C3              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
C4              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
C5              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
C6              CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
                **************************************************

C1              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
C2              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
C3              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
C4              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
C5              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
C6              CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
                **************************************************

C1              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
C2              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
C3              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
C4              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
C5              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
C6              GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
                **************************************************

C1              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
C2              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
C3              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
C4              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
C5              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
C6              CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
                **************************************************

C1              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
C2              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
C3              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
C4              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
C5              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
C6              CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
                **************************************************

C1              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
C2              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
C3              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
C4              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
C5              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
C6              GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
                **************************************************

C1              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
C2              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
C3              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
C4              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
C5              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
C6              GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
                **************************************************

C1              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
C2              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
C3              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
C4              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
C5              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
C6              TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
                **************************************************

C1              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
C2              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
C3              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
C4              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
C5              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
C6              TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
                **************************************************

C1              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
C2              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
C3              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
C4              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
C5              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
C6              GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
                **************************************************

C1              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
C2              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
C3              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
C4              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
C5              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
C6              AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
                **************************************************

C1              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
C2              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
C3              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
C4              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
C5              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
C6              GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
                **************************************************

C1              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
C2              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
C3              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
C4              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
C5              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
C6              CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
                **************************************************

C1              AGTGC---------------------------------------------
C2              AGTGC---------------------------------------------
C3              AGTGC---------------------------------------------
C4              AGTGC---------------------------------------------
C5              AGTGC---------------------------------------------
C6              AGTGC---------------------------------------------
                *****                                             



>C1
GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C2
GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C3
GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C4
GTGACGGCCGCTCACCAGGAACCGAAGCCCTCTCTGGCAGCATATGTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C5
---------------------------------------------GTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGCTTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C6
---------------------------------------------GTGAG
CATGGCCCTGTCTTATCGTGACAAGATCGCGCGTATGCTGCTGATTGGGA
CTGCGATCGCGGCCGTAGCGCTGGTTCTCGCTGGCTGTGTCCGTGTTGTT
AGCGGGCGTGCTCTGATGGCTGGGCCGAAACTGGGCGAGCCGGTGGCGTG
GGCACCGTGTCGTCCTAGCAACCCCGCGGTGAAACTCCCCGGTGGCGCGT
TGTGCGGAAAGCTTGCCGTGCCGGTCGACTATGACCACCACGATGATGAT
GTAGCGGCGCTGGCGATGATTCGCTTTCCCGCGACCGGTGACAGGATGGG
TTCGCTGGTCATCAACCCTGGGGGGCCCGGCGAGTCCGGCATCGAGGCTG
CGTTGGGCGTTGTTCAGACGTTGCCGAAGCGGGTTCGCGAACGTTTTGAC
CTGGTTGGGTTTGACCCCCGTGGGGTGGGAGCATCGAGGCCCGCGGTCTG
GTGTAACTCCGATGCCGACAACGACCGGTTGCGATCCGAGTCCCAGGTCG
ACTACAGCCCGGCGGGTGTGGCACACATCGAGGATGAGACTAAGCAGTTC
ATCGGTCGTTGTATCGCCAAGATGGGCAAGATATTCCTGGAAAACATCGG
GACGGTCAACGTCGCCAAGGATCTCGATGCCATCCGGGCAGCGTTGGGTG
ACGACAAGCTGACCTATCTCGGCTATTCGTACGGTACCCGGATCGGTGCG
GCCTACGCTGAAGCCTATCCGCAGAACGTGCGTTCGATGATTCTCGATGG
CGCTGTCGACCCCAACGCCGATCCCATCGAGGCGGATCTGCGCCAGGCCA
AGGGATTCCAAGACGCGTTCAACAACTATGCCGCAGACTGTGCGAGGAAA
CTGTCTTGCCCGCTTGGCGCCGACCCGGCCAAAGCCGTCGACGTCTATCA
CAACTTGGTCAACCCGCTGGTCGACCCCAATAACCCGATGGTTAGCAGGC
CCGCACCGACGAAGGACCCGCGCGGGTTGAGTTATAGCGATGCGATCGTA
GGCACCATCATGACGCTGTACTCGCCCACGCTGTGGCACCACCTCACCGA
CGGTCTTTCCGAGCTGGTCGACCATCGCGGAGATACCCTGCTTGCCTTGG
CTGATATGTACATGCGTCGTGACTCGCAAGGCCATTACACTAACGCCACC
GATGCACGGGTGGCAGTTAATTGCGTTGATCAGCCCCCGATTACGGACCG
GGCTAAGGTCATAGATGAAGATCGCCGTTCACGGGAGGTTGCACCTTTCA
TGAGCTACGGGAAGTTCACCGGTGACGCGCCGCTGGGCACTTGCGCGTTC
TGGCCGGTACCACCGACCAGCAAGCCGCACATTGTCTCGGCGCCCGGCTT
GGCGCCGACAGTGGTGGTGTCGACCACTCATGATCCGGCGACACCGTATA
AGGCCGGGGTAGATTTGGCGAACCAGCTTCGGGGTTCGTTGCTCACATTT
GACGGAACCCAGCACACCGTGGTTTTCCAAGGCGACAGCTGCGTTGACGA
CTACGTGACGGAGTATCTGATTGGCGGCACCACGCCGCCGAGCGGGGCGA
AGTGC---------------------------------------------
>C1
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C2
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C3
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C4
VTAAHQEPKPSLAAYVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C5
oooooooooooooooVSMALSYRDKIARMLLLGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC
>C6
oooooooooooooooVSMALSYRDKIARMLLIGTAIAAVALVLAGCVRVV
SGRALMAGPKLGEPVAWAPCRPSNPAVKLPGGALCGKLAVPVDYDHHDDD
VAALAMIRFPATGDRMGSLVINPGGPGESGIEAALGVVQTLPKRVRERFD
LVGFDPRGVGASRPAVWCNSDADNDRLRSESQVDYSPAGVAHIEDETKQF
IGRCIAKMGKIFLENIGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGA
AYAEAYPQNVRSMILDGAVDPNADPIEADLRQAKGFQDAFNNYAADCARK
LSCPLGADPAKAVDVYHNLVNPLVDPNNPMVSRPAPTKDPRGLSYSDAIV
GTIMTLYSPTLWHHLTDGLSELVDHRGDTLLALADMYMRRDSQGHYTNAT
DARVAVNCVDQPPITDRAKVIDEDRRSREVAPFMSYGKFTGDAPLGTCAF
WPVPPTSKPHIVSAPGLAPTVVVSTTHDPATPYKAGVDLANQLRGSLLTF
DGTQHTVVFQGDSCVDDYVTEYLIGGTTPPSGAKC


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1650 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579856897
      Setting output file names to "/data/7res/ML1633/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 893898918
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5862563082
      Seed = 1019562808
      Swapseed = 1579856897
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 10 unique site patterns
      Division 2 has 8 unique site patterns
      Division 3 has 9 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3586.859842 -- -24.965149
         Chain 2 -- -3586.867394 -- -24.965149
         Chain 3 -- -3586.700716 -- -24.965149
         Chain 4 -- -3586.699166 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3586.699370 -- -24.965149
         Chain 2 -- -3586.700915 -- -24.965149
         Chain 3 -- -3582.834961 -- -24.965149
         Chain 4 -- -3582.834961 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3586.860] (-3586.867) (-3586.701) (-3586.699) * [-3586.699] (-3586.701) (-3582.835) (-3582.835) 
        500 -- (-2213.323) [-2209.068] (-2216.918) (-2230.555) * (-2226.362) (-2211.969) [-2226.672] (-2212.393) -- 0:00:00
       1000 -- (-2204.175) (-2206.660) (-2212.591) [-2210.328] * (-2212.971) [-2204.032] (-2214.026) (-2212.967) -- 0:00:00
       1500 -- [-2209.867] (-2206.753) (-2202.837) (-2208.341) * [-2205.628] (-2200.053) (-2201.621) (-2196.455) -- 0:00:00
       2000 -- [-2200.479] (-2202.959) (-2201.371) (-2197.536) * (-2200.760) (-2201.751) [-2199.043] (-2205.401) -- 0:00:00
       2500 -- (-2206.192) [-2198.014] (-2199.388) (-2203.179) * (-2206.091) [-2198.794] (-2206.064) (-2204.899) -- 0:00:00
       3000 -- (-2198.532) (-2206.310) (-2201.650) [-2200.637] * [-2200.306] (-2200.425) (-2200.153) (-2197.711) -- 0:00:00
       3500 -- (-2201.274) (-2198.688) (-2201.575) [-2205.444] * (-2197.908) [-2198.457] (-2199.180) (-2204.089) -- 0:00:00
       4000 -- (-2197.107) (-2201.029) [-2200.729] (-2199.565) * (-2208.913) (-2202.613) (-2209.541) [-2201.170] -- 0:00:00
       4500 -- (-2201.312) (-2203.486) [-2200.218] (-2205.547) * (-2205.672) (-2203.177) (-2202.838) [-2204.195] -- 0:00:00
       5000 -- [-2201.101] (-2204.726) (-2203.219) (-2198.855) * (-2202.802) (-2200.075) [-2197.278] (-2198.063) -- 0:00:00

      Average standard deviation of split frequencies: 0.114280

       5500 -- (-2197.948) [-2196.190] (-2199.247) (-2201.807) * (-2201.717) [-2201.468] (-2211.463) (-2202.003) -- 0:00:00
       6000 -- (-2206.883) (-2204.230) [-2199.805] (-2203.976) * (-2199.885) [-2203.301] (-2197.016) (-2208.555) -- 0:00:00
       6500 -- (-2198.602) (-2202.807) [-2201.032] (-2199.994) * (-2201.767) (-2204.145) (-2201.125) [-2198.064] -- 0:00:00
       7000 -- (-2207.366) (-2200.387) (-2203.925) [-2198.120] * (-2203.207) (-2197.387) [-2197.415] (-2203.034) -- 0:00:00
       7500 -- (-2198.723) (-2203.922) (-2203.014) [-2200.376] * (-2213.763) (-2199.049) [-2201.924] (-2200.404) -- 0:00:00
       8000 -- (-2198.482) (-2201.043) [-2197.712] (-2200.879) * [-2198.673] (-2198.248) (-2196.948) (-2197.371) -- 0:00:00
       8500 -- (-2201.704) (-2205.892) [-2194.586] (-2202.439) * (-2204.283) (-2194.679) (-2200.048) [-2200.373] -- 0:01:56
       9000 -- (-2201.279) (-2210.928) [-2200.654] (-2197.386) * (-2203.675) (-2194.350) [-2196.175] (-2199.507) -- 0:01:50
       9500 -- (-2206.070) (-2204.056) (-2200.780) [-2195.509] * (-2206.105) (-2194.073) (-2200.705) [-2200.357] -- 0:01:44
      10000 -- (-2204.106) [-2201.484] (-2194.617) (-2203.092) * (-2208.101) (-2198.759) [-2200.116] (-2209.945) -- 0:01:39

      Average standard deviation of split frequencies: 0.088388

      10500 -- [-2197.899] (-2210.521) (-2202.869) (-2196.767) * [-2200.895] (-2202.813) (-2199.694) (-2200.230) -- 0:01:34
      11000 -- (-2200.371) (-2200.114) [-2197.312] (-2195.713) * (-2196.518) (-2199.619) [-2195.162] (-2198.874) -- 0:01:29
      11500 -- (-2208.066) (-2199.218) [-2202.452] (-2201.309) * (-2209.337) (-2200.400) [-2199.252] (-2199.803) -- 0:01:25
      12000 -- (-2205.885) (-2207.167) (-2201.379) [-2200.904] * (-2203.701) (-2201.323) [-2206.377] (-2199.453) -- 0:01:22
      12500 -- (-2204.818) (-2199.288) (-2197.465) [-2200.640] * [-2199.712] (-2198.645) (-2199.205) (-2200.388) -- 0:01:19
      13000 -- (-2202.561) (-2202.697) [-2199.468] (-2196.872) * (-2206.735) (-2198.455) (-2203.024) [-2200.528] -- 0:01:15
      13500 -- (-2205.359) [-2207.197] (-2211.359) (-2197.565) * [-2198.274] (-2195.959) (-2197.015) (-2197.220) -- 0:01:13
      14000 -- (-2201.851) [-2197.578] (-2196.803) (-2209.043) * [-2198.443] (-2196.055) (-2204.783) (-2197.571) -- 0:01:10
      14500 -- (-2207.899) (-2201.422) [-2197.537] (-2199.816) * [-2195.443] (-2195.193) (-2206.037) (-2194.969) -- 0:01:07
      15000 -- (-2199.568) (-2204.563) [-2198.427] (-2200.688) * (-2201.679) (-2198.433) [-2205.122] (-2196.606) -- 0:01:05

      Average standard deviation of split frequencies: 0.070711

      15500 -- (-2209.041) (-2202.681) [-2195.805] (-2202.014) * (-2209.935) (-2202.894) (-2201.584) [-2198.032] -- 0:01:03
      16000 -- (-2195.716) (-2205.135) (-2195.976) [-2202.244] * (-2200.641) (-2201.103) [-2197.532] (-2198.264) -- 0:01:01
      16500 -- (-2203.504) (-2200.190) (-2202.310) [-2205.101] * (-2200.061) [-2197.845] (-2200.993) (-2198.853) -- 0:00:59
      17000 -- (-2203.323) [-2198.904] (-2198.044) (-2206.891) * [-2206.117] (-2197.531) (-2200.435) (-2196.622) -- 0:00:57
      17500 -- (-2203.240) (-2196.158) [-2201.662] (-2198.051) * (-2199.947) (-2197.314) [-2202.788] (-2196.657) -- 0:00:56
      18000 -- (-2202.936) [-2197.500] (-2198.161) (-2207.004) * (-2198.535) (-2197.652) [-2198.084] (-2196.452) -- 0:00:54
      18500 -- (-2206.136) (-2200.972) (-2202.660) [-2199.426] * (-2205.004) (-2197.550) [-2203.946] (-2196.618) -- 0:00:53
      19000 -- (-2205.339) (-2199.081) (-2205.554) [-2197.217] * [-2198.986] (-2197.944) (-2207.116) (-2198.305) -- 0:00:51
      19500 -- (-2196.065) (-2208.093) [-2197.751] (-2207.730) * [-2198.886] (-2199.505) (-2203.069) (-2197.752) -- 0:00:50
      20000 -- (-2196.783) (-2212.491) [-2202.414] (-2194.294) * [-2201.515] (-2197.946) (-2196.873) (-2197.004) -- 0:01:38

      Average standard deviation of split frequencies: 0.046887

      20500 -- [-2198.073] (-2199.595) (-2205.645) (-2200.119) * [-2201.882] (-2199.576) (-2208.158) (-2198.485) -- 0:01:35
      21000 -- (-2196.689) (-2200.306) (-2210.886) [-2196.614] * [-2203.388] (-2198.749) (-2207.760) (-2197.494) -- 0:01:33
      21500 -- (-2202.276) [-2200.556] (-2206.337) (-2206.991) * [-2201.824] (-2199.959) (-2201.299) (-2199.205) -- 0:01:31
      22000 -- [-2205.611] (-2199.826) (-2210.145) (-2201.045) * [-2201.749] (-2198.210) (-2198.266) (-2198.202) -- 0:01:28
      22500 -- (-2208.293) [-2196.474] (-2200.373) (-2201.139) * (-2202.353) (-2199.370) [-2198.639] (-2200.290) -- 0:01:26
      23000 -- (-2205.404) (-2200.745) [-2205.504] (-2198.226) * (-2204.834) (-2198.643) [-2199.109] (-2201.586) -- 0:01:24
      23500 -- (-2203.490) [-2201.243] (-2202.917) (-2197.222) * (-2209.807) [-2201.582] (-2200.484) (-2201.044) -- 0:01:23
      24000 -- (-2202.887) (-2202.201) (-2198.519) [-2202.072] * [-2201.682] (-2197.354) (-2209.115) (-2200.569) -- 0:01:21
      24500 -- (-2212.170) (-2199.998) (-2207.603) [-2201.167] * (-2209.043) (-2198.037) [-2198.232] (-2198.081) -- 0:01:19
      25000 -- [-2205.647] (-2202.065) (-2197.287) (-2195.455) * (-2205.661) (-2197.409) [-2198.574] (-2198.658) -- 0:01:18

      Average standard deviation of split frequencies: 0.038734

      25500 -- (-2200.372) (-2198.255) (-2201.009) [-2197.750] * [-2201.230] (-2198.156) (-2202.250) (-2201.985) -- 0:01:16
      26000 -- (-2199.526) [-2203.356] (-2199.754) (-2194.451) * (-2198.133) (-2195.603) (-2196.651) [-2199.469] -- 0:01:14
      26500 -- (-2199.821) (-2205.859) [-2200.537] (-2199.342) * [-2196.913] (-2196.790) (-2202.103) (-2198.837) -- 0:01:13
      27000 -- [-2198.903] (-2199.958) (-2200.362) (-2199.251) * (-2204.222) [-2196.297] (-2198.489) (-2206.486) -- 0:01:12
      27500 -- [-2203.224] (-2201.673) (-2196.693) (-2207.883) * [-2203.236] (-2198.224) (-2198.185) (-2200.854) -- 0:01:10
      28000 -- [-2198.757] (-2199.917) (-2203.503) (-2205.831) * (-2200.421) (-2197.601) [-2194.995] (-2197.339) -- 0:01:09
      28500 -- (-2205.972) [-2211.177] (-2198.259) (-2199.553) * (-2196.469) (-2197.948) (-2201.332) [-2198.705] -- 0:01:08
      29000 -- (-2200.121) (-2210.225) (-2201.200) [-2197.816] * (-2211.135) (-2198.609) (-2203.254) [-2196.671] -- 0:01:06
      29500 -- (-2203.726) (-2209.700) (-2206.156) [-2197.010] * [-2202.073] (-2195.842) (-2199.734) (-2198.305) -- 0:01:05
      30000 -- (-2210.881) (-2206.529) (-2196.882) [-2201.516] * (-2208.186) [-2195.461] (-2202.147) (-2197.837) -- 0:01:04

      Average standard deviation of split frequencies: 0.045347

      30500 -- (-2206.909) [-2207.697] (-2206.435) (-2201.182) * (-2199.962) (-2196.784) [-2197.990] (-2197.815) -- 0:01:03
      31000 -- (-2206.151) [-2204.799] (-2194.626) (-2201.677) * (-2213.836) (-2196.703) [-2208.936] (-2198.460) -- 0:01:33
      31500 -- (-2216.038) (-2203.355) [-2197.662] (-2196.992) * [-2200.195] (-2198.961) (-2201.005) (-2201.456) -- 0:01:32
      32000 -- (-2205.547) (-2203.747) [-2197.999] (-2197.227) * (-2204.528) (-2196.759) [-2209.952] (-2196.517) -- 0:01:30
      32500 -- (-2201.905) [-2196.526] (-2197.528) (-2207.197) * (-2213.335) (-2199.876) [-2199.141] (-2199.570) -- 0:01:29
      33000 -- [-2204.012] (-2196.638) (-2202.576) (-2203.403) * (-2198.555) (-2198.873) [-2203.614] (-2201.600) -- 0:01:27
      33500 -- (-2203.695) (-2196.829) [-2202.378] (-2203.784) * [-2198.569] (-2196.430) (-2199.600) (-2199.876) -- 0:01:26
      34000 -- (-2208.591) (-2197.733) [-2197.925] (-2202.393) * (-2197.430) [-2199.524] (-2200.666) (-2196.416) -- 0:01:25
      34500 -- (-2202.869) (-2199.708) (-2199.869) [-2201.563] * (-2197.774) (-2199.901) [-2201.761] (-2198.265) -- 0:01:23
      35000 -- [-2202.811] (-2199.558) (-2203.184) (-2200.667) * (-2198.551) (-2200.146) [-2198.401] (-2196.815) -- 0:01:22

      Average standard deviation of split frequencies: 0.034919

      35500 -- [-2200.869] (-2196.797) (-2199.454) (-2197.028) * [-2195.757] (-2200.287) (-2197.093) (-2197.143) -- 0:01:21
      36000 -- (-2211.125) (-2196.647) [-2199.011] (-2199.308) * (-2196.146) (-2200.135) (-2202.873) [-2199.878] -- 0:01:20
      36500 -- (-2203.412) (-2198.373) (-2198.286) [-2195.714] * [-2196.629] (-2200.457) (-2200.929) (-2197.080) -- 0:01:19
      37000 -- (-2199.812) (-2197.576) (-2200.672) [-2199.142] * (-2194.892) (-2197.498) [-2199.664] (-2196.819) -- 0:01:18
      37500 -- (-2201.943) [-2195.925] (-2203.750) (-2200.860) * (-2195.683) (-2199.462) [-2198.273] (-2196.986) -- 0:01:17
      38000 -- (-2204.038) (-2194.860) (-2198.418) [-2198.943] * (-2196.425) (-2197.438) (-2198.267) [-2197.546] -- 0:01:15
      38500 -- (-2200.090) [-2196.999] (-2202.198) (-2200.822) * [-2195.479] (-2198.604) (-2208.930) (-2200.053) -- 0:01:14
      39000 -- [-2199.355] (-2204.812) (-2200.936) (-2203.182) * (-2197.317) (-2196.753) [-2197.099] (-2197.594) -- 0:01:13
      39500 -- (-2201.486) (-2204.331) (-2198.632) [-2199.294] * (-2198.083) (-2199.644) [-2199.947] (-2197.074) -- 0:01:12
      40000 -- (-2202.943) (-2197.430) (-2197.375) [-2194.948] * (-2198.258) (-2200.273) (-2200.542) [-2197.946] -- 0:01:12

      Average standard deviation of split frequencies: 0.037216

      40500 -- (-2197.826) (-2194.963) [-2200.824] (-2198.760) * (-2200.358) (-2198.936) (-2202.222) [-2199.406] -- 0:01:11
      41000 -- (-2196.867) (-2195.453) [-2201.479] (-2205.383) * (-2199.373) (-2197.102) [-2201.090] (-2197.793) -- 0:01:10
      41500 -- (-2198.161) (-2197.119) [-2201.999] (-2202.609) * (-2201.015) (-2199.998) (-2207.125) [-2199.180] -- 0:01:09
      42000 -- (-2200.853) (-2195.886) [-2199.613] (-2200.759) * (-2199.807) (-2195.452) (-2199.298) [-2201.246] -- 0:01:08
      42500 -- (-2200.259) [-2198.195] (-2203.588) (-2201.228) * (-2199.288) (-2197.844) [-2197.389] (-2197.662) -- 0:01:30
      43000 -- (-2198.238) [-2199.226] (-2207.677) (-2203.473) * (-2202.884) [-2198.784] (-2197.421) (-2197.114) -- 0:01:29
      43500 -- [-2199.420] (-2198.028) (-2203.596) (-2202.010) * (-2197.016) [-2196.993] (-2195.964) (-2197.091) -- 0:01:27
      44000 -- (-2197.880) (-2196.344) (-2197.310) [-2201.375] * [-2197.592] (-2199.303) (-2197.474) (-2199.659) -- 0:01:26
      44500 -- (-2197.101) (-2196.885) (-2204.191) [-2202.034] * (-2197.258) [-2199.353] (-2197.495) (-2197.261) -- 0:01:25
      45000 -- (-2196.749) [-2198.217] (-2204.801) (-2201.184) * [-2197.281] (-2197.045) (-2198.865) (-2197.693) -- 0:01:24

      Average standard deviation of split frequencies: 0.034648

      45500 -- (-2199.568) (-2198.048) [-2203.561] (-2202.404) * (-2197.990) (-2197.953) (-2197.875) [-2197.620] -- 0:01:23
      46000 -- (-2200.914) (-2197.986) [-2204.130] (-2198.622) * (-2197.407) [-2198.976] (-2197.152) (-2199.929) -- 0:01:22
      46500 -- (-2198.728) (-2202.285) (-2205.560) [-2196.870] * (-2198.034) [-2198.560] (-2198.069) (-2198.455) -- 0:01:22
      47000 -- (-2203.087) (-2205.094) (-2200.397) [-2201.287] * (-2201.131) [-2197.385] (-2201.597) (-2198.425) -- 0:01:21
      47500 -- [-2198.890] (-2196.664) (-2201.464) (-2205.900) * (-2196.994) (-2198.080) (-2198.386) [-2200.242] -- 0:01:20
      48000 -- (-2198.075) (-2199.967) (-2202.159) [-2199.780] * (-2195.028) (-2198.977) (-2197.781) [-2196.535] -- 0:01:19
      48500 -- (-2198.242) (-2197.627) [-2200.417] (-2205.873) * (-2196.548) (-2198.024) (-2196.779) [-2195.354] -- 0:01:18
      49000 -- (-2198.540) [-2196.355] (-2201.360) (-2209.609) * (-2197.087) (-2195.438) (-2199.339) [-2196.799] -- 0:01:17
      49500 -- (-2201.354) (-2197.830) [-2199.235] (-2204.311) * (-2199.171) [-2199.372] (-2195.543) (-2198.321) -- 0:01:16
      50000 -- (-2197.789) (-2194.379) [-2198.278] (-2201.462) * (-2199.372) (-2197.759) [-2197.232] (-2199.166) -- 0:01:16

      Average standard deviation of split frequencies: 0.028843

      50500 -- (-2198.118) (-2195.544) [-2203.035] (-2203.889) * (-2199.463) [-2194.988] (-2199.266) (-2203.291) -- 0:01:15
      51000 -- (-2198.365) (-2195.729) (-2207.088) [-2199.887] * (-2200.939) [-2194.729] (-2196.985) (-2198.452) -- 0:01:14
      51500 -- (-2198.368) [-2195.051] (-2201.324) (-2203.897) * (-2196.124) (-2196.207) (-2196.682) [-2199.666] -- 0:01:13
      52000 -- (-2198.006) [-2195.600] (-2197.423) (-2204.406) * (-2201.938) (-2198.802) (-2198.103) [-2196.814] -- 0:01:12
      52500 -- (-2197.385) (-2196.840) (-2199.124) [-2197.956] * (-2197.661) (-2198.380) [-2197.073] (-2196.755) -- 0:01:12
      53000 -- (-2197.847) (-2196.443) (-2203.714) [-2202.322] * (-2197.132) [-2197.236] (-2196.870) (-2196.872) -- 0:01:11
      53500 -- (-2196.721) (-2196.513) (-2205.399) [-2196.948] * (-2197.005) [-2196.083] (-2197.600) (-2198.455) -- 0:01:28
      54000 -- (-2196.846) [-2195.915] (-2204.547) (-2200.751) * [-2197.293] (-2197.129) (-2196.751) (-2200.074) -- 0:01:27
      54500 -- [-2198.352] (-2196.509) (-2199.082) (-2201.188) * (-2196.595) (-2194.931) [-2198.291] (-2200.073) -- 0:01:26
      55000 -- (-2199.325) (-2197.594) (-2212.269) [-2201.412] * (-2196.689) (-2195.818) [-2197.007] (-2197.200) -- 0:01:25

      Average standard deviation of split frequencies: 0.028798

      55500 -- (-2199.840) (-2195.619) (-2198.759) [-2199.299] * (-2197.648) (-2197.171) (-2197.208) [-2195.802] -- 0:01:25
      56000 -- [-2200.539] (-2197.713) (-2196.984) (-2206.262) * (-2197.186) [-2197.183] (-2196.316) (-2197.809) -- 0:01:24
      56500 -- (-2201.938) (-2195.757) (-2198.419) [-2199.126] * [-2198.191] (-2197.650) (-2197.328) (-2199.497) -- 0:01:23
      57000 -- (-2198.930) (-2196.784) (-2194.810) [-2204.428] * (-2197.001) (-2199.053) (-2197.254) [-2199.799] -- 0:01:22
      57500 -- [-2196.569] (-2194.913) (-2209.235) (-2201.582) * [-2196.031] (-2198.698) (-2197.928) (-2195.234) -- 0:01:21
      58000 -- (-2195.525) [-2196.675] (-2207.742) (-2203.372) * (-2197.021) [-2197.923] (-2197.923) (-2198.096) -- 0:01:21
      58500 -- [-2196.441] (-2200.355) (-2195.995) (-2209.144) * (-2197.417) (-2197.315) (-2197.171) [-2200.132] -- 0:01:20
      59000 -- (-2196.456) (-2200.078) (-2202.886) [-2202.511] * [-2196.730] (-2198.703) (-2197.391) (-2196.862) -- 0:01:19
      59500 -- [-2196.463] (-2196.791) (-2205.831) (-2200.877) * (-2196.574) (-2198.353) [-2197.801] (-2198.259) -- 0:01:19
      60000 -- (-2197.928) (-2197.755) (-2203.053) [-2197.551] * (-2195.842) [-2196.366] (-2199.282) (-2200.659) -- 0:01:18

      Average standard deviation of split frequencies: 0.030693

      60500 -- [-2198.047] (-2200.242) (-2200.867) (-2210.431) * (-2197.208) (-2197.312) [-2199.279] (-2199.103) -- 0:01:17
      61000 -- (-2199.299) (-2198.797) [-2203.634] (-2202.495) * [-2195.538] (-2200.383) (-2197.752) (-2197.353) -- 0:01:16
      61500 -- (-2199.198) (-2199.352) (-2200.070) [-2199.955] * (-2197.983) (-2199.097) (-2200.826) [-2198.126] -- 0:01:16
      62000 -- [-2200.792] (-2197.777) (-2200.042) (-2201.160) * (-2197.372) (-2200.205) (-2200.962) [-2195.708] -- 0:01:15
      62500 -- (-2195.108) [-2197.050] (-2199.780) (-2210.897) * (-2196.602) (-2197.599) (-2197.240) [-2198.123] -- 0:01:15
      63000 -- [-2197.596] (-2199.682) (-2203.319) (-2200.274) * (-2195.928) (-2196.049) (-2197.004) [-2195.658] -- 0:01:14
      63500 -- [-2196.586] (-2196.017) (-2204.732) (-2199.827) * (-2197.166) (-2197.156) [-2197.048] (-2194.799) -- 0:01:13
      64000 -- (-2198.743) (-2197.026) [-2202.862] (-2211.761) * (-2201.460) [-2199.595] (-2197.401) (-2198.641) -- 0:01:13
      64500 -- (-2199.083) (-2198.144) (-2205.761) [-2201.076] * (-2199.124) (-2198.263) [-2199.361] (-2197.310) -- 0:01:12
      65000 -- (-2199.137) (-2198.742) [-2196.885] (-2205.582) * (-2198.931) [-2200.503] (-2199.605) (-2199.595) -- 0:01:26

      Average standard deviation of split frequencies: 0.029284

      65500 -- (-2201.027) [-2197.064] (-2201.977) (-2208.959) * (-2198.222) (-2200.711) (-2198.499) [-2197.195] -- 0:01:25
      66000 -- (-2198.257) (-2197.039) [-2201.560] (-2200.347) * (-2199.654) (-2195.705) (-2196.896) [-2198.044] -- 0:01:24
      66500 -- (-2198.991) (-2198.839) (-2201.628) [-2207.484] * (-2201.992) (-2196.750) (-2199.832) [-2196.354] -- 0:01:24
      67000 -- (-2201.449) [-2198.290] (-2205.696) (-2208.259) * (-2196.582) (-2197.382) (-2199.174) [-2196.419] -- 0:01:23
      67500 -- (-2200.018) (-2199.221) [-2199.108] (-2206.542) * (-2201.111) (-2198.683) (-2203.100) [-2194.066] -- 0:01:22
      68000 -- (-2197.619) (-2195.999) [-2198.161] (-2197.543) * (-2200.959) [-2194.900] (-2200.470) (-2198.477) -- 0:01:22
      68500 -- (-2197.979) [-2196.293] (-2198.282) (-2197.288) * (-2196.482) (-2195.385) (-2199.893) [-2194.732] -- 0:01:21
      69000 -- (-2199.700) (-2196.188) (-2197.825) [-2197.097] * [-2197.958] (-2200.170) (-2199.565) (-2194.541) -- 0:01:20
      69500 -- (-2195.759) [-2198.144] (-2197.238) (-2200.595) * (-2197.524) (-2199.600) (-2196.510) [-2199.042] -- 0:01:20
      70000 -- (-2195.295) (-2199.008) (-2196.576) [-2196.611] * [-2199.689] (-2197.473) (-2201.280) (-2199.096) -- 0:01:19

      Average standard deviation of split frequencies: 0.030686

      70500 -- (-2199.504) [-2199.521] (-2196.631) (-2197.255) * (-2197.271) (-2196.973) [-2198.904] (-2195.745) -- 0:01:19
      71000 -- (-2198.093) (-2200.427) (-2197.943) [-2202.036] * (-2198.142) (-2194.998) [-2196.795] (-2194.717) -- 0:01:18
      71500 -- (-2194.396) [-2197.543] (-2198.182) (-2204.485) * (-2200.501) (-2197.820) [-2199.040] (-2193.723) -- 0:01:17
      72000 -- [-2197.317] (-2204.367) (-2197.933) (-2201.200) * (-2197.352) [-2196.698] (-2196.242) (-2196.908) -- 0:01:17
      72500 -- (-2201.287) [-2195.214] (-2196.659) (-2200.453) * (-2200.010) (-2197.038) [-2197.830] (-2198.994) -- 0:01:16
      73000 -- [-2200.506] (-2196.642) (-2197.245) (-2198.532) * [-2196.780] (-2195.474) (-2199.520) (-2200.172) -- 0:01:16
      73500 -- (-2197.884) (-2197.444) (-2196.777) [-2197.208] * (-2197.478) (-2196.496) (-2199.908) [-2198.328] -- 0:01:15
      74000 -- (-2198.868) [-2195.366] (-2197.904) (-2198.086) * (-2197.553) [-2195.294] (-2201.829) (-2197.764) -- 0:01:15
      74500 -- [-2195.745] (-2197.344) (-2199.228) (-2197.709) * (-2197.245) [-2194.986] (-2199.600) (-2196.633) -- 0:01:14
      75000 -- (-2199.367) (-2197.984) (-2199.931) [-2197.341] * (-2198.644) [-2196.702] (-2199.019) (-2195.797) -- 0:01:14

      Average standard deviation of split frequencies: 0.029832

      75500 -- (-2200.479) (-2196.067) [-2197.866] (-2200.324) * [-2198.572] (-2197.567) (-2199.016) (-2196.673) -- 0:01:13
      76000 -- (-2197.614) (-2196.396) [-2196.437] (-2196.637) * (-2198.095) [-2197.005] (-2198.101) (-2199.300) -- 0:01:25
      76500 -- (-2196.504) [-2196.322] (-2196.445) (-2195.325) * (-2198.096) (-2195.473) [-2198.815] (-2201.830) -- 0:01:24
      77000 -- [-2198.146] (-2198.144) (-2197.905) (-2200.662) * (-2198.410) (-2195.238) (-2197.327) [-2196.232] -- 0:01:23
      77500 -- (-2196.961) (-2198.764) [-2199.107] (-2198.212) * (-2197.524) [-2195.740] (-2198.148) (-2197.473) -- 0:01:23
      78000 -- (-2197.185) (-2197.835) (-2200.324) [-2197.106] * (-2200.922) (-2196.540) (-2198.233) [-2198.593] -- 0:01:22
      78500 -- [-2196.228] (-2198.551) (-2201.831) (-2197.109) * [-2198.485] (-2197.838) (-2200.045) (-2201.182) -- 0:01:22
      79000 -- (-2197.958) [-2197.716] (-2201.752) (-2197.224) * (-2196.901) (-2199.372) (-2201.239) [-2198.833] -- 0:01:21
      79500 -- (-2195.761) (-2203.198) (-2197.152) [-2198.789] * [-2196.288] (-2196.786) (-2200.190) (-2198.466) -- 0:01:21
      80000 -- (-2197.615) [-2202.954] (-2200.551) (-2198.135) * [-2201.009] (-2196.920) (-2199.456) (-2197.293) -- 0:01:20

      Average standard deviation of split frequencies: 0.027681

      80500 -- (-2199.764) (-2202.731) (-2197.368) [-2197.253] * (-2198.462) (-2203.729) [-2197.966] (-2196.064) -- 0:01:19
      81000 -- [-2198.677] (-2198.766) (-2194.790) (-2201.816) * (-2198.303) (-2196.693) [-2198.352] (-2198.129) -- 0:01:19
      81500 -- [-2194.810] (-2199.967) (-2196.737) (-2197.967) * (-2198.343) [-2196.575] (-2196.748) (-2199.408) -- 0:01:18
      82000 -- (-2196.526) (-2198.035) (-2196.626) [-2202.594] * (-2198.677) (-2198.169) [-2196.970] (-2199.398) -- 0:01:18
      82500 -- (-2197.023) [-2196.087] (-2197.292) (-2200.744) * (-2196.610) (-2198.731) [-2196.890] (-2198.636) -- 0:01:17
      83000 -- [-2195.084] (-2201.874) (-2196.812) (-2201.048) * (-2198.168) [-2199.418] (-2197.290) (-2197.024) -- 0:01:17
      83500 -- (-2199.006) [-2199.620] (-2196.470) (-2207.215) * [-2195.961] (-2198.567) (-2197.543) (-2198.759) -- 0:01:16
      84000 -- (-2200.952) (-2202.682) (-2200.983) [-2198.269] * (-2197.444) [-2196.533] (-2198.373) (-2198.888) -- 0:01:16
      84500 -- (-2201.729) [-2197.794] (-2202.376) (-2196.525) * (-2197.425) [-2197.102] (-2197.691) (-2195.601) -- 0:01:15
      85000 -- (-2197.730) (-2199.326) (-2197.006) [-2198.831] * (-2198.598) [-2199.052] (-2198.366) (-2196.946) -- 0:01:15

      Average standard deviation of split frequencies: 0.028229

      85500 -- (-2201.375) (-2199.895) (-2196.715) [-2198.625] * (-2196.389) [-2201.815] (-2196.980) (-2197.296) -- 0:01:14
      86000 -- (-2206.301) [-2196.563] (-2197.738) (-2197.552) * (-2197.168) (-2198.940) (-2195.832) [-2198.157] -- 0:01:14
      86500 -- (-2203.325) (-2199.972) [-2199.235] (-2198.379) * (-2199.842) (-2197.067) [-2195.632] (-2205.010) -- 0:01:13
      87000 -- [-2203.318] (-2197.933) (-2202.150) (-2200.637) * (-2200.900) (-2199.240) (-2195.819) [-2195.547] -- 0:01:13
      87500 -- (-2201.101) (-2197.246) (-2199.442) [-2198.661] * (-2204.724) (-2197.262) [-2200.381] (-2198.928) -- 0:01:23
      88000 -- (-2201.140) [-2196.351] (-2197.927) (-2195.078) * (-2202.320) [-2196.818] (-2200.081) (-2200.010) -- 0:01:22
      88500 -- (-2200.935) (-2197.502) (-2198.918) [-2196.018] * (-2201.886) (-2196.980) (-2198.883) [-2194.940] -- 0:01:22
      89000 -- [-2197.938] (-2196.300) (-2198.776) (-2197.489) * (-2200.696) (-2195.216) (-2198.237) [-2196.718] -- 0:01:21
      89500 -- (-2201.948) [-2197.084] (-2196.887) (-2196.597) * (-2200.257) [-2195.506] (-2198.535) (-2198.764) -- 0:01:21
      90000 -- (-2201.838) [-2197.145] (-2199.548) (-2197.554) * (-2197.011) [-2194.759] (-2198.645) (-2198.712) -- 0:01:20

      Average standard deviation of split frequencies: 0.024957

      90500 -- (-2202.231) (-2200.171) [-2197.307] (-2201.454) * [-2200.636] (-2197.413) (-2201.853) (-2197.050) -- 0:01:20
      91000 -- (-2199.250) (-2200.509) (-2196.076) [-2199.580] * (-2199.237) (-2196.888) (-2203.647) [-2197.569] -- 0:01:19
      91500 -- (-2198.767) (-2194.487) (-2196.459) [-2199.541] * [-2199.848] (-2198.975) (-2203.262) (-2197.191) -- 0:01:19
      92000 -- [-2197.962] (-2196.772) (-2196.418) (-2196.775) * (-2198.097) (-2199.010) [-2196.510] (-2198.344) -- 0:01:18
      92500 -- (-2198.850) (-2196.420) [-2195.932] (-2196.959) * (-2196.101) (-2196.956) [-2197.516] (-2196.706) -- 0:01:18
      93000 -- [-2197.755] (-2200.091) (-2197.856) (-2197.083) * (-2196.899) (-2198.213) [-2197.511] (-2198.880) -- 0:01:18
      93500 -- (-2200.009) (-2201.205) (-2200.314) [-2197.212] * (-2195.604) (-2198.430) (-2203.184) [-2195.382] -- 0:01:17
      94000 -- (-2197.585) [-2197.670] (-2204.220) (-2197.867) * [-2196.461] (-2198.344) (-2201.973) (-2195.939) -- 0:01:17
      94500 -- (-2199.557) (-2197.888) (-2203.096) [-2196.676] * (-2202.078) (-2198.797) [-2197.761] (-2195.975) -- 0:01:16
      95000 -- (-2199.212) (-2195.441) (-2198.357) [-2195.451] * (-2200.469) [-2198.482] (-2198.661) (-2196.673) -- 0:01:16

      Average standard deviation of split frequencies: 0.020110

      95500 -- (-2196.487) [-2197.760] (-2198.796) (-2197.054) * (-2201.015) [-2200.115] (-2198.510) (-2196.600) -- 0:01:15
      96000 -- (-2198.251) (-2197.023) [-2198.373] (-2196.490) * [-2198.480] (-2199.415) (-2198.904) (-2196.920) -- 0:01:15
      96500 -- (-2199.275) (-2196.903) (-2196.576) [-2198.724] * (-2195.901) (-2196.546) (-2197.599) [-2196.750] -- 0:01:14
      97000 -- (-2199.875) (-2200.127) [-2198.372] (-2196.768) * [-2198.093] (-2197.351) (-2205.088) (-2199.974) -- 0:01:14
      97500 -- (-2199.764) [-2196.631] (-2197.518) (-2199.261) * (-2199.899) [-2198.135] (-2198.828) (-2196.820) -- 0:01:14
      98000 -- [-2199.022] (-2194.173) (-2197.501) (-2197.138) * (-2197.825) (-2195.982) [-2198.671] (-2199.036) -- 0:01:13
      98500 -- [-2198.910] (-2195.413) (-2197.161) (-2199.909) * (-2196.792) (-2198.474) [-2196.583] (-2199.600) -- 0:01:22
      99000 -- (-2198.464) [-2196.238] (-2199.372) (-2198.949) * (-2196.804) (-2200.794) (-2198.376) [-2199.353] -- 0:01:21
      99500 -- (-2196.197) [-2196.502] (-2197.677) (-2197.010) * (-2198.588) (-2198.980) [-2196.715] (-2200.278) -- 0:01:21
      100000 -- [-2199.293] (-2198.235) (-2200.801) (-2198.011) * [-2199.873] (-2195.172) (-2199.174) (-2196.903) -- 0:01:21

      Average standard deviation of split frequencies: 0.020703

      100500 -- (-2200.993) [-2199.802] (-2204.252) (-2199.238) * [-2198.823] (-2196.407) (-2198.272) (-2196.168) -- 0:01:20
      101000 -- [-2204.494] (-2198.263) (-2205.264) (-2197.743) * (-2196.003) (-2196.072) (-2199.125) [-2197.917] -- 0:01:20
      101500 -- (-2200.928) (-2200.797) (-2198.423) [-2198.006] * (-2199.125) (-2196.329) [-2196.500] (-2194.122) -- 0:01:19
      102000 -- (-2204.381) (-2196.883) (-2196.307) [-2196.606] * (-2199.334) (-2194.104) [-2195.220] (-2197.302) -- 0:01:19
      102500 -- [-2200.443] (-2196.285) (-2195.960) (-2197.598) * (-2199.464) (-2197.231) [-2196.210] (-2197.826) -- 0:01:18
      103000 -- [-2199.967] (-2198.356) (-2199.826) (-2198.030) * [-2199.944] (-2195.191) (-2197.281) (-2197.852) -- 0:01:18
      103500 -- [-2195.904] (-2199.129) (-2197.065) (-2201.059) * (-2198.011) (-2197.361) (-2197.252) [-2195.588] -- 0:01:17
      104000 -- [-2196.902] (-2200.482) (-2197.121) (-2197.659) * (-2198.942) (-2198.377) (-2194.965) [-2195.502] -- 0:01:17
      104500 -- (-2196.516) [-2200.784] (-2196.512) (-2197.607) * (-2199.462) (-2196.273) [-2196.379] (-2195.738) -- 0:01:17
      105000 -- [-2196.443] (-2196.557) (-2197.262) (-2197.606) * (-2197.643) (-2196.074) (-2198.478) [-2194.527] -- 0:01:16

      Average standard deviation of split frequencies: 0.016853

      105500 -- (-2195.060) (-2193.720) [-2198.816] (-2197.196) * [-2199.778] (-2196.818) (-2198.733) (-2198.908) -- 0:01:16
      106000 -- [-2195.947] (-2194.921) (-2197.697) (-2197.100) * (-2197.213) [-2197.156] (-2197.813) (-2206.248) -- 0:01:15
      106500 -- (-2196.285) (-2196.493) [-2196.627] (-2199.640) * (-2198.635) [-2199.788] (-2198.364) (-2201.286) -- 0:01:15
      107000 -- (-2198.082) [-2196.603] (-2195.427) (-2198.064) * (-2199.816) [-2200.430] (-2197.447) (-2197.093) -- 0:01:15
      107500 -- [-2197.012] (-2198.977) (-2197.522) (-2197.723) * (-2202.387) (-2198.599) (-2198.568) [-2195.537] -- 0:01:14
      108000 -- (-2196.006) (-2197.335) [-2200.069] (-2198.879) * (-2201.512) (-2195.920) (-2199.581) [-2196.239] -- 0:01:14
      108500 -- (-2198.096) (-2196.544) (-2196.724) [-2197.649] * (-2198.165) [-2195.544] (-2204.208) (-2198.572) -- 0:01:13
      109000 -- (-2199.251) [-2194.860] (-2195.427) (-2197.572) * [-2196.949] (-2198.605) (-2200.680) (-2197.737) -- 0:01:13
      109500 -- (-2196.455) [-2195.491] (-2198.702) (-2197.907) * (-2200.761) [-2197.814] (-2196.205) (-2194.814) -- 0:01:13
      110000 -- (-2196.962) [-2196.907] (-2197.517) (-2199.043) * (-2197.218) (-2197.035) (-2195.758) [-2197.672] -- 0:01:20

      Average standard deviation of split frequencies: 0.015855

      110500 -- [-2196.742] (-2199.576) (-2197.285) (-2200.225) * (-2198.914) (-2198.075) (-2195.411) [-2197.827] -- 0:01:20
      111000 -- [-2195.235] (-2197.817) (-2200.292) (-2197.274) * (-2201.763) [-2197.211] (-2197.313) (-2194.748) -- 0:01:20
      111500 -- [-2199.689] (-2197.628) (-2198.044) (-2197.785) * (-2199.393) [-2197.379] (-2196.214) (-2200.795) -- 0:01:19
      112000 -- [-2197.654] (-2199.364) (-2197.004) (-2198.137) * (-2198.961) [-2196.477] (-2198.563) (-2199.907) -- 0:01:19
      112500 -- [-2198.873] (-2201.112) (-2198.461) (-2197.128) * (-2198.222) (-2197.902) (-2204.317) [-2198.208] -- 0:01:18
      113000 -- (-2202.232) (-2197.711) (-2198.518) [-2196.584] * [-2198.290] (-2198.626) (-2198.536) (-2198.106) -- 0:01:18
      113500 -- (-2197.786) [-2197.575] (-2199.700) (-2196.740) * [-2197.669] (-2198.242) (-2196.936) (-2198.317) -- 0:01:18
      114000 -- (-2197.138) [-2194.668] (-2200.283) (-2194.091) * (-2199.692) (-2197.332) [-2196.970] (-2197.817) -- 0:01:17
      114500 -- (-2197.119) (-2196.392) (-2198.911) [-2199.389] * (-2201.221) [-2198.627] (-2197.964) (-2199.320) -- 0:01:17
      115000 -- [-2196.818] (-2197.427) (-2197.546) (-2198.633) * [-2198.855] (-2199.147) (-2200.012) (-2197.955) -- 0:01:16

      Average standard deviation of split frequencies: 0.016707

      115500 -- (-2197.055) (-2203.475) (-2197.937) [-2198.393] * [-2197.248] (-2201.628) (-2200.541) (-2198.639) -- 0:01:16
      116000 -- [-2199.251] (-2202.717) (-2200.601) (-2201.179) * (-2202.636) [-2200.118] (-2200.926) (-2199.897) -- 0:01:16
      116500 -- (-2197.174) (-2196.966) [-2201.167] (-2204.514) * [-2198.148] (-2197.399) (-2197.272) (-2201.982) -- 0:01:15
      117000 -- [-2201.494] (-2198.616) (-2198.265) (-2200.128) * (-2197.410) [-2198.144] (-2199.128) (-2199.087) -- 0:01:15
      117500 -- [-2197.653] (-2197.075) (-2200.462) (-2197.590) * (-2197.017) (-2199.540) [-2196.866] (-2197.865) -- 0:01:15
      118000 -- (-2198.123) (-2196.829) [-2195.588] (-2198.077) * [-2197.484] (-2198.472) (-2196.786) (-2200.119) -- 0:01:14
      118500 -- (-2197.635) (-2197.378) (-2195.652) [-2198.401] * (-2199.678) (-2199.592) (-2198.754) [-2196.322] -- 0:01:14
      119000 -- (-2198.751) (-2197.214) [-2195.625] (-2195.136) * [-2196.929] (-2197.983) (-2197.277) (-2199.750) -- 0:01:14
      119500 -- (-2195.558) (-2196.259) [-2197.292] (-2198.364) * (-2197.612) [-2199.591] (-2199.540) (-2201.733) -- 0:01:13
      120000 -- (-2198.178) (-2198.583) [-2194.583] (-2197.270) * (-2195.520) (-2197.621) (-2198.305) [-2196.327] -- 0:01:13

      Average standard deviation of split frequencies: 0.018094

      120500 -- (-2197.146) (-2196.799) (-2197.452) [-2195.098] * (-2195.724) (-2198.887) (-2197.760) [-2196.518] -- 0:01:12
      121000 -- (-2195.490) (-2196.881) [-2197.851] (-2198.613) * [-2197.450] (-2197.824) (-2195.933) (-2195.420) -- 0:01:19
      121500 -- [-2198.301] (-2197.081) (-2197.127) (-2195.712) * (-2197.730) (-2201.183) (-2196.570) [-2197.161] -- 0:01:19
      122000 -- (-2196.435) [-2198.753] (-2196.272) (-2198.175) * [-2201.892] (-2195.478) (-2195.496) (-2197.417) -- 0:01:19
      122500 -- (-2198.611) (-2198.679) (-2196.779) [-2196.367]