>C1
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C2
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C3
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C4
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C5
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C6
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=270
C1 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C2 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C3 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C4 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C5 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C6 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
**************************************************
C1 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C2 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C3 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C4 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C5 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C6 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
**************************************************
C1 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C2 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C3 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C4 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C5 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C6 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
**************************************************
C1 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C2 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C3 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C4 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C5 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C6 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
**************************************************
C1 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C2 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C3 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C4 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C5 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C6 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
**************************************************
C1 PSQAPMAVEEKLADRYGHPR
C2 PSQAPMAVEEKLADRYGHPR
C3 PSQAPMAVEEKLADRYGHPR
C4 PSQAPMAVEEKLADRYGHPR
C5 PSQAPMAVEEKLADRYGHPR
C6 PSQAPMAVEEKLADRYGHPR
********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 270 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 270 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8100]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8100]--->[8100]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.826 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C2 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C3 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C4 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C5 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C6 MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
**************************************************
C1 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C2 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C3 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C4 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C5 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C6 SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
**************************************************
C1 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C2 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C3 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C4 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C5 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C6 QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
**************************************************
C1 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C2 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C3 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C4 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C5 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C6 DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
**************************************************
C1 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C2 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C3 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C4 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C5 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C6 LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
**************************************************
C1 PSQAPMAVEEKLADRYGHPR
C2 PSQAPMAVEEKLADRYGHPR
C3 PSQAPMAVEEKLADRYGHPR
C4 PSQAPMAVEEKLADRYGHPR
C5 PSQAPMAVEEKLADRYGHPR
C6 PSQAPMAVEEKLADRYGHPR
********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C2 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C3 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C4 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C5 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C6 ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
**************************************************
C1 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C2 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C3 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C4 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C5 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C6 AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
**************************************************
C1 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C2 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C3 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C4 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C5 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C6 AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
**************************************************
C1 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C2 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C3 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C4 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C5 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C6 TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
**************************************************
C1 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C2 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C3 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C4 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C5 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C6 TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
**************************************************
C1 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C2 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C3 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C4 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C5 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C6 ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
**************************************************
C1 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C2 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C3 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C4 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C5 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C6 CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
**************************************************
C1 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C2 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C3 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C4 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C5 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C6 CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
**************************************************
C1 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C2 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C3 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C4 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C5 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C6 CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
**************************************************
C1 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C2 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C3 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C4 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C5 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C6 GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
**************************************************
C1 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C2 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C3 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C4 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C5 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C6 CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
**************************************************
C1 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C2 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C3 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C4 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C5 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C6 TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
**************************************************
C1 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C2 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C3 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C4 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C5 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C6 CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
**************************************************
C1 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C2 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C3 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C4 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C5 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C6 TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
**************************************************
C1 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C2 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C3 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C4 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C5 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C6 ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
**************************************************
C1 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C2 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C3 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C4 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C5 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C6 CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
**************************************************
C1 CCACCCACGG
C2 CCACCCACGG
C3 CCACCCACGG
C4 CCACCCACGG
C5 CCACCCACGG
C6 CCACCCACGG
**********
>C1
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C2
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C3
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C4
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C5
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C6
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C1
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C2
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C3
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C4
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C5
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C6
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 810 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857047
Setting output file names to "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2108245535
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5500454974
Seed = 798874539
Swapseed = 1579857047
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1812.818558 -- -24.965149
Chain 2 -- -1812.818558 -- -24.965149
Chain 3 -- -1812.818558 -- -24.965149
Chain 4 -- -1812.818834 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1812.818730 -- -24.965149
Chain 2 -- -1812.818834 -- -24.965149
Chain 3 -- -1812.818730 -- -24.965149
Chain 4 -- -1812.818834 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1812.819] (-1812.819) (-1812.819) (-1812.819) * [-1812.819] (-1812.819) (-1812.819) (-1812.819)
500 -- (-1128.216) [-1125.070] (-1128.772) (-1133.297) * [-1126.556] (-1136.773) (-1125.615) (-1132.084) -- 0:00:00
1000 -- [-1118.450] (-1118.439) (-1126.127) (-1118.833) * (-1128.783) (-1132.463) [-1120.256] (-1127.880) -- 0:00:00
1500 -- (-1125.788) [-1123.533] (-1126.669) (-1123.805) * [-1124.611] (-1125.312) (-1128.833) (-1128.204) -- 0:00:00
2000 -- (-1127.307) [-1121.396] (-1123.105) (-1123.271) * [-1121.333] (-1125.445) (-1122.997) (-1125.873) -- 0:00:00
2500 -- [-1128.816] (-1127.109) (-1126.946) (-1124.829) * (-1121.591) [-1128.799] (-1125.655) (-1125.710) -- 0:00:00
3000 -- (-1126.092) [-1130.184] (-1123.750) (-1120.754) * (-1126.820) (-1124.397) (-1129.658) [-1123.484] -- 0:00:00
3500 -- (-1119.983) (-1125.621) [-1122.791] (-1128.218) * (-1125.005) [-1126.437] (-1127.594) (-1125.439) -- 0:04:44
4000 -- (-1124.289) (-1128.626) [-1124.075] (-1127.863) * (-1123.926) (-1123.828) (-1124.276) [-1121.706] -- 0:04:09
4500 -- (-1126.487) (-1121.009) [-1120.708] (-1132.038) * [-1119.241] (-1123.331) (-1122.899) (-1119.616) -- 0:03:41
5000 -- (-1128.039) (-1122.955) (-1127.860) [-1122.553] * (-1124.220) [-1122.661] (-1125.708) (-1126.655) -- 0:03:19
Average standard deviation of split frequencies: 0.099995
5500 -- (-1125.411) (-1121.360) [-1125.742] (-1122.347) * (-1122.324) [-1119.982] (-1123.992) (-1128.160) -- 0:03:00
6000 -- (-1126.181) [-1127.151] (-1123.973) (-1122.358) * (-1121.299) (-1121.112) [-1125.993] (-1128.193) -- 0:02:45
6500 -- (-1129.565) [-1120.211] (-1121.136) (-1123.720) * (-1120.427) (-1122.062) (-1127.492) [-1126.771] -- 0:02:32
7000 -- (-1127.184) (-1129.603) (-1120.546) [-1124.953] * (-1124.072) (-1126.769) [-1125.978] (-1124.105) -- 0:02:21
7500 -- (-1126.306) [-1123.911] (-1129.576) (-1125.805) * (-1129.349) [-1121.895] (-1125.214) (-1127.939) -- 0:02:12
8000 -- (-1123.087) (-1124.735) (-1125.143) [-1124.230] * (-1128.031) (-1126.391) (-1122.914) [-1125.657] -- 0:02:04
8500 -- (-1120.040) (-1120.206) (-1125.256) [-1125.053] * (-1122.866) (-1130.404) (-1119.168) [-1122.189] -- 0:01:56
9000 -- (-1123.324) (-1125.633) [-1121.254] (-1123.996) * (-1132.276) (-1124.005) [-1120.885] (-1125.256) -- 0:01:50
9500 -- [-1122.072] (-1127.482) (-1125.026) (-1118.421) * (-1133.668) [-1120.781] (-1126.119) (-1121.570) -- 0:01:44
10000 -- [-1122.238] (-1125.810) (-1122.430) (-1120.997) * (-1140.556) (-1128.650) [-1128.341] (-1122.864) -- 0:01:39
Average standard deviation of split frequencies: 0.079084
10500 -- (-1128.335) [-1123.098] (-1122.753) (-1128.581) * [-1133.440] (-1122.931) (-1123.109) (-1124.102) -- 0:01:34
11000 -- (-1125.463) [-1120.283] (-1123.280) (-1127.069) * (-1121.884) [-1122.366] (-1131.671) (-1123.369) -- 0:01:29
11500 -- (-1128.203) (-1128.438) [-1124.532] (-1128.693) * (-1126.174) (-1120.618) [-1121.252] (-1124.684) -- 0:01:25
12000 -- [-1116.919] (-1126.039) (-1123.421) (-1124.949) * (-1134.892) [-1118.634] (-1122.568) (-1128.323) -- 0:01:22
12500 -- (-1125.366) (-1124.154) (-1129.917) [-1120.319] * [-1121.224] (-1128.356) (-1121.536) (-1127.220) -- 0:01:19
13000 -- (-1129.192) [-1124.926] (-1121.880) (-1119.242) * (-1120.745) (-1125.182) [-1120.322] (-1127.898) -- 0:01:15
13500 -- (-1125.893) (-1122.380) [-1124.156] (-1120.339) * (-1123.182) (-1127.706) (-1125.502) [-1122.989] -- 0:01:13
14000 -- (-1131.545) [-1121.531] (-1123.403) (-1120.390) * (-1132.722) [-1132.046] (-1121.515) (-1124.999) -- 0:01:10
14500 -- (-1130.333) (-1121.862) (-1121.050) [-1126.915] * [-1127.915] (-1125.697) (-1122.249) (-1128.845) -- 0:01:07
15000 -- (-1133.724) [-1126.701] (-1129.306) (-1120.478) * (-1127.714) [-1119.759] (-1124.058) (-1129.961) -- 0:01:05
Average standard deviation of split frequencies: 0.078076
15500 -- (-1118.546) (-1123.769) (-1130.502) [-1120.934] * (-1120.566) (-1131.913) [-1120.137] (-1128.331) -- 0:01:03
16000 -- [-1122.750] (-1132.127) (-1122.455) (-1122.835) * (-1122.942) [-1121.943] (-1123.388) (-1120.959) -- 0:01:01
16500 -- (-1123.712) (-1128.340) [-1131.982] (-1120.968) * [-1123.313] (-1126.845) (-1124.789) (-1126.649) -- 0:00:59
17000 -- [-1122.714] (-1120.457) (-1125.935) (-1121.318) * (-1129.001) (-1127.440) (-1120.234) [-1126.129] -- 0:00:57
17500 -- (-1122.083) (-1126.444) [-1125.865] (-1123.665) * (-1132.420) [-1126.906] (-1127.002) (-1128.299) -- 0:00:56
18000 -- (-1126.688) (-1125.468) (-1126.559) [-1125.513] * (-1132.205) (-1125.813) [-1136.120] (-1131.608) -- 0:00:54
18500 -- (-1131.774) (-1124.987) (-1121.398) [-1126.268] * [-1120.665] (-1125.558) (-1126.534) (-1129.163) -- 0:00:53
19000 -- (-1130.258) (-1125.295) [-1129.129] (-1131.199) * (-1122.711) [-1123.759] (-1126.261) (-1131.867) -- 0:00:51
19500 -- (-1127.849) (-1128.913) (-1122.793) [-1122.529] * (-1130.158) (-1122.150) [-1121.778] (-1125.287) -- 0:01:40
20000 -- (-1125.123) (-1121.437) [-1125.606] (-1126.053) * [-1120.888] (-1124.778) (-1129.163) (-1124.287) -- 0:01:38
Average standard deviation of split frequencies: 0.068430
20500 -- (-1123.975) (-1122.727) (-1126.781) [-1128.551] * (-1129.566) (-1124.179) [-1121.068] (-1123.796) -- 0:01:35
21000 -- (-1124.116) (-1124.735) (-1124.874) [-1128.181] * (-1126.991) [-1122.886] (-1119.754) (-1124.439) -- 0:01:33
21500 -- (-1122.783) [-1126.842] (-1123.533) (-1129.516) * (-1132.922) (-1122.978) [-1129.670] (-1128.696) -- 0:01:31
22000 -- (-1119.879) (-1130.287) (-1126.085) [-1121.670] * [-1126.210] (-1121.883) (-1130.117) (-1127.620) -- 0:01:28
22500 -- (-1125.247) [-1122.909] (-1125.443) (-1135.203) * (-1119.499) (-1122.633) [-1126.786] (-1122.575) -- 0:01:26
23000 -- [-1126.780] (-1127.833) (-1130.679) (-1131.486) * (-1123.007) (-1124.110) (-1122.196) [-1123.795] -- 0:01:24
23500 -- [-1126.034] (-1126.883) (-1127.260) (-1122.831) * [-1122.819] (-1129.122) (-1119.818) (-1119.040) -- 0:01:23
24000 -- (-1132.589) (-1127.569) (-1129.041) [-1123.638] * (-1127.374) (-1124.724) (-1128.949) [-1128.919] -- 0:01:21
24500 -- [-1124.883] (-1124.087) (-1125.149) (-1125.208) * (-1125.639) [-1131.534] (-1119.742) (-1133.075) -- 0:01:19
25000 -- (-1124.307) (-1132.244) [-1129.736] (-1120.517) * (-1124.407) [-1122.661] (-1121.759) (-1122.067) -- 0:01:18
Average standard deviation of split frequencies: 0.051096
25500 -- (-1132.638) (-1129.709) (-1129.025) [-1122.061] * (-1122.314) [-1123.959] (-1131.776) (-1119.447) -- 0:01:16
26000 -- (-1131.354) [-1123.152] (-1122.159) (-1129.915) * (-1126.445) (-1125.670) [-1124.921] (-1123.448) -- 0:01:14
26500 -- (-1124.954) (-1127.303) (-1127.204) [-1137.778] * (-1124.830) (-1129.046) (-1126.004) [-1118.865] -- 0:01:13
27000 -- (-1122.427) [-1120.321] (-1125.072) (-1117.272) * [-1123.806] (-1146.551) (-1130.559) (-1122.279) -- 0:01:12
27500 -- [-1121.078] (-1124.207) (-1124.368) (-1115.695) * (-1131.368) (-1125.259) [-1120.970] (-1121.464) -- 0:01:10
28000 -- (-1135.583) (-1124.176) [-1136.782] (-1115.268) * (-1125.570) [-1117.532] (-1125.888) (-1132.971) -- 0:01:09
28500 -- [-1121.474] (-1125.499) (-1126.722) (-1114.627) * (-1124.118) (-1124.898) (-1123.437) [-1122.368] -- 0:01:08
29000 -- (-1120.871) (-1119.822) (-1120.790) [-1114.794] * (-1119.721) [-1128.769] (-1126.803) (-1125.702) -- 0:01:06
29500 -- (-1127.726) (-1127.393) [-1125.405] (-1118.399) * (-1126.169) (-1128.113) [-1125.186] (-1122.119) -- 0:01:05
30000 -- (-1126.677) (-1125.520) (-1122.263) [-1116.076] * (-1131.601) (-1126.625) (-1123.646) [-1122.690] -- 0:01:04
Average standard deviation of split frequencies: 0.051972
30500 -- (-1121.281) (-1131.600) [-1122.253] (-1115.721) * (-1118.424) (-1128.949) [-1121.273] (-1122.030) -- 0:01:03
31000 -- (-1126.002) (-1127.459) [-1120.372] (-1115.791) * (-1133.156) (-1127.748) [-1118.489] (-1124.486) -- 0:01:02
31500 -- (-1126.323) (-1119.375) (-1125.771) [-1115.265] * (-1129.137) (-1138.492) (-1131.793) [-1119.690] -- 0:01:01
32000 -- (-1126.504) (-1118.849) (-1129.030) [-1116.668] * [-1120.487] (-1116.282) (-1129.537) (-1123.214) -- 0:01:00
32500 -- (-1129.279) (-1115.381) [-1123.516] (-1115.463) * (-1127.809) [-1114.064] (-1129.282) (-1125.862) -- 0:00:59
33000 -- [-1119.540] (-1118.182) (-1132.026) (-1115.382) * (-1129.036) (-1115.157) [-1114.966] (-1118.477) -- 0:00:58
33500 -- (-1134.784) (-1116.740) [-1118.626] (-1120.073) * (-1120.151) [-1116.098] (-1124.225) (-1119.070) -- 0:00:57
34000 -- [-1124.081] (-1116.740) (-1124.232) (-1119.720) * [-1123.819] (-1116.703) (-1126.743) (-1125.626) -- 0:00:56
34500 -- (-1126.704) (-1114.442) [-1124.871] (-1118.894) * [-1131.418] (-1116.178) (-1124.687) (-1129.013) -- 0:00:55
35000 -- (-1124.905) (-1115.926) (-1127.598) [-1118.378] * [-1129.731] (-1118.076) (-1132.821) (-1129.791) -- 0:00:55
Average standard deviation of split frequencies: 0.048450
35500 -- [-1122.599] (-1115.930) (-1125.209) (-1116.786) * (-1126.412) (-1118.165) [-1126.455] (-1129.174) -- 0:01:21
36000 -- (-1120.936) (-1116.830) [-1119.843] (-1117.147) * (-1127.850) (-1116.077) (-1117.906) [-1124.874] -- 0:01:20
36500 -- (-1122.317) (-1119.024) (-1121.224) [-1114.149] * [-1127.225] (-1117.677) (-1133.979) (-1130.518) -- 0:01:19
37000 -- (-1132.203) (-1118.360) [-1119.721] (-1117.532) * [-1123.861] (-1118.039) (-1127.584) (-1134.130) -- 0:01:18
37500 -- [-1124.908] (-1115.605) (-1122.697) (-1115.457) * (-1121.692) [-1119.196] (-1121.807) (-1118.399) -- 0:01:17
38000 -- (-1129.960) (-1115.103) [-1124.286] (-1116.714) * (-1121.242) (-1118.257) [-1123.142] (-1121.559) -- 0:01:15
38500 -- (-1128.473) [-1115.790] (-1128.397) (-1115.189) * (-1125.946) (-1113.824) [-1121.425] (-1119.774) -- 0:01:14
39000 -- [-1122.458] (-1115.095) (-1126.367) (-1114.652) * (-1131.061) [-1115.113] (-1128.304) (-1119.342) -- 0:01:13
39500 -- (-1124.939) [-1117.301] (-1128.029) (-1122.649) * [-1122.760] (-1115.721) (-1116.034) (-1117.713) -- 0:01:12
40000 -- (-1127.240) (-1115.597) (-1123.935) [-1118.062] * (-1126.496) (-1115.263) (-1115.359) [-1113.792] -- 0:01:12
Average standard deviation of split frequencies: 0.041860
40500 -- [-1126.993] (-1116.215) (-1121.692) (-1120.788) * (-1128.444) (-1115.252) [-1116.244] (-1113.981) -- 0:01:11
41000 -- [-1128.627] (-1120.655) (-1125.424) (-1116.017) * (-1124.024) (-1115.041) [-1114.157] (-1115.623) -- 0:01:10
41500 -- [-1126.491] (-1116.086) (-1124.256) (-1115.433) * (-1125.967) [-1114.850] (-1116.414) (-1114.125) -- 0:01:09
42000 -- (-1129.165) (-1114.154) (-1123.540) [-1115.066] * (-1131.839) (-1115.700) (-1116.647) [-1113.773] -- 0:01:08
42500 -- (-1127.347) (-1115.402) (-1128.701) [-1114.537] * (-1122.148) (-1116.041) (-1117.948) [-1113.510] -- 0:01:07
43000 -- [-1115.770] (-1117.004) (-1125.833) (-1116.100) * (-1120.269) [-1114.286] (-1117.604) (-1115.960) -- 0:01:06
43500 -- [-1116.094] (-1117.116) (-1128.199) (-1118.312) * (-1121.713) [-1115.092] (-1114.919) (-1116.109) -- 0:01:05
44000 -- (-1113.899) (-1117.380) (-1129.119) [-1118.909] * (-1124.688) (-1114.795) (-1115.645) [-1114.056] -- 0:01:05
44500 -- (-1113.581) (-1117.600) [-1125.830] (-1114.748) * (-1126.462) (-1115.479) (-1113.998) [-1114.028] -- 0:01:04
45000 -- [-1115.170] (-1117.869) (-1125.971) (-1116.711) * (-1127.578) (-1118.018) (-1113.872) [-1114.580] -- 0:01:03
Average standard deviation of split frequencies: 0.042944
45500 -- (-1116.836) (-1119.833) [-1120.647] (-1114.737) * (-1121.717) [-1116.358] (-1116.812) (-1119.068) -- 0:01:02
46000 -- (-1115.253) (-1119.056) [-1129.759] (-1116.562) * (-1131.196) (-1115.209) [-1118.039] (-1113.777) -- 0:01:02
46500 -- (-1113.860) (-1116.824) (-1122.738) [-1115.990] * (-1126.282) (-1116.277) [-1114.589] (-1116.039) -- 0:01:01
47000 -- (-1114.069) [-1117.966] (-1124.815) (-1117.109) * (-1125.456) [-1116.067] (-1115.517) (-1116.757) -- 0:01:00
47500 -- (-1114.015) [-1116.964] (-1124.039) (-1116.035) * (-1129.642) (-1115.236) [-1119.275] (-1114.598) -- 0:01:00
48000 -- (-1113.400) (-1114.819) (-1124.420) [-1114.748] * (-1127.527) (-1118.056) (-1114.875) [-1115.978] -- 0:00:59
48500 -- (-1114.364) (-1113.432) (-1131.617) [-1114.568] * (-1140.244) [-1116.642] (-1116.579) (-1114.051) -- 0:00:58
49000 -- (-1115.798) (-1114.001) (-1120.986) [-1114.513] * (-1115.875) [-1114.729] (-1117.442) (-1115.530) -- 0:00:58
49500 -- (-1118.278) (-1114.153) [-1129.872] (-1114.804) * (-1116.495) (-1118.968) [-1114.903] (-1114.936) -- 0:00:57
50000 -- [-1116.842] (-1114.153) (-1129.748) (-1113.830) * (-1116.405) (-1118.751) [-1114.954] (-1117.566) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- [-1115.413] (-1116.391) (-1125.507) (-1115.476) * (-1114.920) (-1121.460) (-1116.085) [-1113.741] -- 0:00:56
51000 -- [-1118.248] (-1117.770) (-1127.865) (-1115.919) * [-1114.979] (-1122.006) (-1115.655) (-1114.315) -- 0:00:55
51500 -- (-1116.092) [-1118.128] (-1124.993) (-1113.905) * (-1116.345) (-1115.603) [-1118.292] (-1116.717) -- 0:01:13
52000 -- [-1117.545] (-1116.643) (-1126.140) (-1113.870) * (-1114.375) [-1115.893] (-1117.538) (-1114.248) -- 0:01:12
52500 -- (-1116.173) (-1116.861) [-1132.220] (-1116.786) * (-1117.248) (-1116.415) [-1116.522] (-1114.347) -- 0:01:12
53000 -- (-1117.128) (-1116.020) [-1120.452] (-1116.836) * [-1115.656] (-1115.822) (-1117.727) (-1114.347) -- 0:01:11
53500 -- (-1114.274) [-1116.816] (-1133.177) (-1117.748) * (-1114.300) (-1115.129) (-1118.100) [-1115.158] -- 0:01:10
54000 -- [-1115.119] (-1119.034) (-1119.428) (-1116.536) * (-1119.058) (-1118.457) (-1114.374) [-1113.944] -- 0:01:10
54500 -- (-1114.600) (-1120.382) [-1119.083] (-1119.368) * (-1116.104) (-1117.480) [-1114.132] (-1114.155) -- 0:01:09
55000 -- [-1114.134] (-1120.884) (-1121.810) (-1116.546) * (-1117.037) (-1117.099) [-1115.146] (-1113.710) -- 0:01:08
Average standard deviation of split frequencies: 0.032830
55500 -- [-1114.570] (-1118.909) (-1125.431) (-1114.604) * [-1117.064] (-1115.010) (-1114.638) (-1116.664) -- 0:01:08
56000 -- [-1114.734] (-1123.094) (-1124.494) (-1113.881) * (-1115.632) [-1116.582] (-1114.479) (-1114.597) -- 0:01:07
56500 -- (-1115.286) [-1115.842] (-1123.113) (-1113.597) * (-1114.381) (-1116.410) [-1113.427] (-1114.542) -- 0:01:06
57000 -- (-1114.672) [-1113.840] (-1122.796) (-1114.457) * (-1117.397) (-1114.255) (-1117.871) [-1115.460] -- 0:01:06
57500 -- (-1114.779) (-1114.507) [-1127.850] (-1115.786) * (-1118.981) [-1115.773] (-1115.998) (-1115.294) -- 0:01:05
58000 -- (-1113.395) [-1114.408] (-1121.724) (-1116.277) * (-1118.909) (-1115.924) (-1115.600) [-1115.221] -- 0:01:04
58500 -- [-1114.426] (-1116.645) (-1128.376) (-1116.159) * (-1119.133) (-1117.629) (-1116.388) [-1114.040] -- 0:01:04
59000 -- (-1115.329) (-1119.746) (-1126.179) [-1113.660] * (-1114.616) (-1116.895) [-1115.549] (-1116.836) -- 0:01:03
59500 -- (-1114.800) (-1117.615) (-1129.224) [-1113.665] * (-1114.404) [-1114.914] (-1114.437) (-1121.324) -- 0:01:03
60000 -- (-1115.674) (-1118.528) [-1121.329] (-1114.911) * (-1114.316) (-1116.267) [-1117.398] (-1119.041) -- 0:01:02
Average standard deviation of split frequencies: 0.028628
60500 -- (-1114.649) [-1118.247] (-1118.966) (-1116.925) * (-1116.025) [-1114.317] (-1114.473) (-1116.844) -- 0:01:02
61000 -- (-1114.108) (-1114.970) [-1118.822] (-1113.886) * (-1117.242) (-1115.738) (-1114.703) [-1116.855] -- 0:01:01
61500 -- [-1113.657] (-1115.804) (-1125.471) (-1114.545) * (-1116.399) [-1116.027] (-1113.707) (-1117.324) -- 0:01:01
62000 -- (-1117.358) (-1116.937) [-1121.857] (-1114.671) * [-1116.936] (-1115.857) (-1117.727) (-1116.021) -- 0:01:00
62500 -- (-1114.119) (-1116.236) (-1130.770) [-1115.478] * (-1115.386) (-1115.549) [-1114.715] (-1116.399) -- 0:01:00
63000 -- (-1116.608) (-1116.280) (-1126.129) [-1115.624] * [-1113.532] (-1116.972) (-1115.243) (-1114.239) -- 0:00:59
63500 -- (-1114.491) (-1116.411) [-1124.026] (-1115.200) * [-1114.184] (-1115.805) (-1117.470) (-1115.548) -- 0:00:58
64000 -- (-1115.193) (-1117.000) (-1122.634) [-1114.978] * (-1115.661) [-1115.911] (-1117.918) (-1116.548) -- 0:00:58
64500 -- [-1115.652] (-1116.783) (-1122.527) (-1113.739) * (-1116.864) (-1115.910) [-1115.155] (-1118.641) -- 0:00:58
65000 -- (-1117.758) [-1121.489] (-1123.943) (-1115.059) * (-1116.763) (-1115.455) (-1116.423) [-1116.861] -- 0:00:57
Average standard deviation of split frequencies: 0.026690
65500 -- (-1114.766) (-1118.678) (-1119.233) [-1114.973] * [-1114.684] (-1118.571) (-1119.362) (-1113.811) -- 0:00:57
66000 -- (-1113.596) (-1118.634) [-1125.820] (-1117.400) * (-1113.654) (-1117.953) [-1116.542] (-1113.469) -- 0:00:56
66500 -- (-1116.224) [-1116.312] (-1127.430) (-1115.122) * [-1113.654] (-1115.578) (-1118.944) (-1114.032) -- 0:00:56
67000 -- [-1114.774] (-1114.544) (-1126.143) (-1114.251) * [-1116.238] (-1117.919) (-1117.520) (-1113.933) -- 0:00:55
67500 -- (-1115.951) [-1113.610] (-1130.991) (-1114.338) * (-1114.802) [-1117.848] (-1118.401) (-1115.044) -- 0:01:09
68000 -- (-1116.402) [-1113.375] (-1128.721) (-1114.385) * (-1115.556) [-1114.791] (-1116.733) (-1115.042) -- 0:01:08
68500 -- (-1115.210) (-1113.821) [-1126.372] (-1114.953) * [-1113.447] (-1116.367) (-1116.423) (-1114.679) -- 0:01:07
69000 -- (-1114.040) (-1117.088) [-1119.724] (-1122.784) * (-1115.737) (-1116.813) (-1116.669) [-1114.077] -- 0:01:07
69500 -- (-1113.383) [-1117.088] (-1116.984) (-1122.465) * (-1115.544) [-1118.617] (-1115.694) (-1114.457) -- 0:01:06
70000 -- [-1114.498] (-1114.396) (-1115.679) (-1115.510) * (-1116.052) (-1115.656) (-1114.735) [-1117.775] -- 0:01:06
Average standard deviation of split frequencies: 0.023348
70500 -- [-1115.660] (-1114.396) (-1117.961) (-1115.610) * (-1115.444) (-1116.072) (-1114.267) [-1117.273] -- 0:01:05
71000 -- (-1113.957) [-1114.418] (-1115.563) (-1114.154) * (-1115.599) (-1114.177) (-1115.814) [-1119.044] -- 0:01:05
71500 -- (-1118.469) (-1115.017) [-1114.788] (-1114.201) * [-1115.821] (-1114.701) (-1115.140) (-1119.138) -- 0:01:04
72000 -- (-1118.714) (-1115.238) [-1118.528] (-1117.134) * (-1115.854) (-1115.141) [-1114.999] (-1117.193) -- 0:01:04
72500 -- [-1115.541] (-1114.636) (-1114.797) (-1115.611) * (-1115.525) [-1115.933] (-1114.268) (-1115.422) -- 0:01:03
73000 -- (-1115.590) (-1114.389) (-1116.114) [-1114.283] * (-1114.841) (-1118.461) [-1113.903] (-1117.749) -- 0:01:03
73500 -- (-1116.094) [-1113.573] (-1118.835) (-1116.862) * (-1114.609) [-1114.943] (-1116.007) (-1116.365) -- 0:01:03
74000 -- [-1114.274] (-1119.762) (-1115.770) (-1114.607) * (-1114.599) [-1115.432] (-1114.489) (-1116.444) -- 0:01:02
74500 -- (-1114.559) (-1114.755) [-1114.097] (-1114.071) * (-1113.798) (-1116.346) [-1114.848] (-1117.347) -- 0:01:02
75000 -- (-1114.270) [-1113.929] (-1114.097) (-1115.057) * (-1113.907) [-1115.016] (-1117.050) (-1122.667) -- 0:01:01
Average standard deviation of split frequencies: 0.022950
75500 -- (-1115.220) (-1115.244) [-1115.124] (-1114.792) * (-1114.417) [-1113.894] (-1116.848) (-1118.376) -- 0:01:01
76000 -- (-1113.703) (-1114.115) (-1116.265) [-1114.425] * (-1116.493) (-1115.520) (-1116.263) [-1115.130] -- 0:01:00
76500 -- (-1115.737) (-1117.117) (-1114.514) [-1113.675] * [-1113.901] (-1120.881) (-1117.227) (-1114.908) -- 0:01:00
77000 -- (-1114.566) [-1118.161] (-1113.640) (-1113.702) * (-1113.910) [-1125.247] (-1119.276) (-1116.748) -- 0:00:59
77500 -- (-1114.630) (-1118.148) [-1114.156] (-1114.638) * (-1114.029) (-1117.802) (-1115.220) [-1119.626] -- 0:00:59
78000 -- (-1115.947) (-1119.103) [-1114.732] (-1114.840) * [-1113.890] (-1116.480) (-1116.357) (-1115.447) -- 0:00:59
78500 -- [-1115.114] (-1117.845) (-1116.123) (-1114.921) * (-1113.686) (-1119.543) (-1115.259) [-1115.380] -- 0:00:58
79000 -- (-1117.026) (-1119.362) [-1115.325] (-1114.560) * (-1114.124) (-1116.705) (-1115.404) [-1114.639] -- 0:00:58
79500 -- (-1116.070) (-1114.377) (-1115.412) [-1117.290] * (-1113.623) (-1117.395) (-1115.951) [-1115.855] -- 0:00:57
80000 -- (-1116.877) (-1113.879) [-1115.509] (-1118.851) * (-1114.359) [-1114.649] (-1114.897) (-1120.369) -- 0:00:57
Average standard deviation of split frequencies: 0.029219
80500 -- [-1115.924] (-1116.549) (-1115.738) (-1115.665) * (-1117.164) (-1113.514) (-1117.867) [-1117.767] -- 0:00:57
81000 -- [-1114.664] (-1113.925) (-1114.825) (-1116.522) * (-1115.538) [-1114.760] (-1118.428) (-1115.159) -- 0:00:56
81500 -- [-1114.841] (-1117.777) (-1119.022) (-1122.480) * (-1118.615) (-1114.813) (-1116.698) [-1115.012] -- 0:00:56
82000 -- (-1114.218) (-1114.496) (-1114.793) [-1118.643] * (-1116.966) [-1116.011] (-1118.409) (-1117.394) -- 0:00:55
82500 -- [-1114.297] (-1113.893) (-1115.734) (-1116.078) * [-1115.513] (-1116.103) (-1114.272) (-1116.756) -- 0:00:55
83000 -- (-1114.825) (-1113.566) [-1116.804] (-1115.212) * (-1116.375) (-1115.386) (-1114.130) [-1118.516] -- 0:00:55
83500 -- [-1114.563] (-1114.553) (-1115.160) (-1116.811) * [-1115.211] (-1113.957) (-1114.904) (-1115.777) -- 0:01:05
84000 -- (-1114.672) (-1114.714) (-1114.651) [-1114.216] * (-1116.871) (-1114.481) [-1113.665] (-1115.155) -- 0:01:05
84500 -- (-1114.535) [-1115.181] (-1114.639) (-1115.908) * [-1115.267] (-1114.278) (-1113.534) (-1119.596) -- 0:01:05
85000 -- [-1116.276] (-1114.557) (-1114.566) (-1117.873) * (-1114.973) [-1114.743] (-1114.543) (-1116.861) -- 0:01:04
Average standard deviation of split frequencies: 0.027929
85500 -- [-1116.034] (-1116.152) (-1114.800) (-1119.450) * (-1114.471) (-1115.451) [-1113.958] (-1117.829) -- 0:01:04
86000 -- (-1119.151) [-1116.428] (-1113.886) (-1118.268) * (-1114.440) (-1116.026) [-1114.330] (-1118.247) -- 0:01:03
86500 -- (-1117.765) [-1116.127] (-1117.421) (-1114.761) * (-1117.082) (-1113.980) (-1114.385) [-1116.734] -- 0:01:03
87000 -- [-1115.548] (-1116.853) (-1120.260) (-1116.710) * (-1117.259) (-1114.183) (-1113.627) [-1116.176] -- 0:01:02
87500 -- (-1115.341) [-1113.888] (-1114.982) (-1115.609) * (-1114.424) [-1114.233] (-1115.645) (-1116.932) -- 0:01:02
88000 -- (-1115.118) (-1113.823) [-1117.780] (-1119.126) * (-1114.868) (-1114.867) [-1116.046] (-1116.483) -- 0:01:02
88500 -- [-1115.254] (-1114.017) (-1117.734) (-1116.536) * [-1114.627] (-1114.240) (-1116.231) (-1115.203) -- 0:01:01
89000 -- (-1118.687) (-1113.766) (-1118.190) [-1114.801] * [-1117.597] (-1115.972) (-1119.089) (-1118.170) -- 0:01:01
89500 -- (-1124.165) (-1119.594) [-1113.781] (-1115.578) * [-1116.187] (-1114.500) (-1115.291) (-1119.320) -- 0:01:01
90000 -- (-1119.180) [-1118.348] (-1113.751) (-1116.678) * [-1115.929] (-1117.739) (-1113.857) (-1116.059) -- 0:01:00
Average standard deviation of split frequencies: 0.026492
90500 -- (-1116.093) (-1117.906) (-1115.120) [-1114.893] * (-1115.885) [-1116.620] (-1115.417) (-1113.954) -- 0:01:00
91000 -- (-1120.508) [-1117.022] (-1115.313) (-1115.315) * (-1116.690) (-1114.101) (-1113.948) [-1115.722] -- 0:00:59
91500 -- (-1116.236) (-1122.215) [-1115.585] (-1116.987) * (-1117.361) [-1114.114] (-1114.410) (-1115.798) -- 0:00:59
92000 -- [-1114.565] (-1116.555) (-1115.028) (-1115.653) * [-1115.245] (-1115.347) (-1113.960) (-1115.688) -- 0:00:59
92500 -- [-1117.770] (-1118.119) (-1119.323) (-1116.904) * [-1115.030] (-1115.728) (-1116.080) (-1114.930) -- 0:00:58
93000 -- (-1114.113) (-1115.500) (-1115.442) [-1114.254] * (-1115.083) (-1115.381) [-1115.994] (-1117.956) -- 0:00:58
93500 -- (-1114.846) (-1120.172) (-1114.611) [-1115.327] * (-1114.249) (-1115.043) (-1116.474) [-1117.453] -- 0:00:58
94000 -- (-1117.023) (-1120.053) [-1115.970] (-1114.755) * (-1117.331) (-1115.218) (-1115.490) [-1115.234] -- 0:00:57
94500 -- [-1118.209] (-1115.597) (-1116.297) (-1113.801) * (-1118.982) (-1117.026) [-1117.500] (-1114.664) -- 0:00:57
95000 -- (-1114.733) (-1116.059) (-1122.481) [-1113.852] * [-1119.220] (-1116.286) (-1116.942) (-1117.454) -- 0:00:57
Average standard deviation of split frequencies: 0.026025
95500 -- (-1113.947) (-1115.651) [-1119.079] (-1114.520) * [-1116.284] (-1116.160) (-1116.703) (-1115.041) -- 0:00:56
96000 -- (-1113.947) (-1117.735) [-1117.564] (-1118.246) * [-1114.654] (-1119.484) (-1117.923) (-1113.987) -- 0:00:56
96500 -- (-1115.896) [-1114.880] (-1120.765) (-1116.796) * (-1117.524) (-1120.968) (-1118.620) [-1113.621] -- 0:00:56
97000 -- [-1113.985] (-1116.046) (-1119.023) (-1114.335) * (-1115.879) [-1115.294] (-1121.543) (-1117.180) -- 0:00:55
97500 -- (-1117.736) (-1116.385) (-1119.565) [-1114.470] * (-1118.124) [-1116.020] (-1115.456) (-1113.956) -- 0:00:55
98000 -- (-1120.552) (-1114.565) (-1115.158) [-1115.591] * (-1119.042) [-1113.460] (-1114.322) (-1114.021) -- 0:00:55
98500 -- (-1117.984) (-1117.394) [-1115.011] (-1115.701) * (-1115.391) (-1115.227) [-1114.144] (-1114.776) -- 0:00:54
99000 -- [-1115.509] (-1114.931) (-1114.690) (-1116.912) * (-1119.176) (-1116.064) (-1113.466) [-1114.873] -- 0:00:54
99500 -- (-1116.680) (-1116.395) [-1116.731] (-1119.259) * [-1114.419] (-1116.821) (-1113.830) (-1118.775) -- 0:01:03
100000 -- (-1118.643) (-1115.320) [-1116.431] (-1116.459) * [-1116.637] (-1114.295) (-1114.852) (-1113.714) -- 0:01:02
Average standard deviation of split frequencies: 0.028097
100500 -- [-1116.031] (-1118.209) (-1116.069) (-1117.442) * [-1115.779] (-1113.778) (-1119.194) (-1114.001) -- 0:01:02
101000 -- (-1114.654) (-1116.618) [-1115.361] (-1118.395) * (-1115.774) (-1118.345) [-1114.935] (-1113.501) -- 0:01:02
101500 -- (-1120.110) (-1116.600) [-1114.233] (-1116.646) * (-1116.925) (-1118.394) [-1116.010] (-1114.266) -- 0:01:01
102000 -- (-1115.481) (-1115.728) (-1114.827) [-1113.406] * (-1114.802) [-1113.606] (-1114.193) (-1114.638) -- 0:01:01
102500 -- [-1116.346] (-1117.335) (-1114.129) (-1113.610) * (-1114.009) [-1113.463] (-1117.363) (-1114.784) -- 0:01:01
103000 -- (-1115.170) (-1115.222) [-1113.949] (-1114.828) * (-1114.633) (-1113.640) (-1115.819) [-1113.940] -- 0:01:00
103500 -- [-1115.193] (-1121.420) (-1115.151) (-1116.330) * (-1118.641) [-1113.682] (-1115.834) (-1116.301) -- 0:01:00
104000 -- [-1114.841] (-1115.078) (-1117.423) (-1117.895) * (-1118.656) (-1115.572) (-1115.755) [-1115.817] -- 0:01:00
104500 -- [-1115.643] (-1115.135) (-1116.601) (-1117.536) * (-1118.243) (-1116.907) (-1116.591) [-1115.266] -- 0:00:59
105000 -- (-1114.541) (-1114.796) [-1115.464] (-1117.881) * [-1114.366] (-1117.673) (-1114.807) (-1118.145) -- 0:00:59
Average standard deviation of split frequencies: 0.029311
105500 -- (-1117.683) [-1114.883] (-1115.503) (-1117.040) * (-1114.917) [-1115.914] (-1117.522) (-1115.087) -- 0:00:59
106000 -- (-1114.265) (-1117.449) (-1115.977) [-1115.731] * [-1115.222] (-1114.555) (-1117.180) (-1115.800) -- 0:00:59
106500 -- (-1113.877) [-1116.361] (-1114.850) (-1116.563) * (-1118.210) (-1114.588) (-1119.384) [-1114.213] -- 0:00:58
107000 -- (-1113.829) [-1114.540] (-1116.025) (-1115.004) * [-1115.966] (-1114.099) (-1115.802) (-1118.783) -- 0:00:58
107500 -- (-1115.516) (-1114.997) (-1115.765) [-1119.156] * (-1118.372) (-1115.693) (-1117.729) [-1114.564] -- 0:00:58
108000 -- (-1118.216) (-1114.301) (-1115.500) [-1119.324] * (-1114.423) [-1115.821] (-1116.371) (-1117.176) -- 0:00:57
108500 -- (-1116.838) [-1114.195] (-1115.656) (-1115.414) * (-1121.557) [-1114.187] (-1114.645) (-1115.317) -- 0:00:57
109000 -- (-1116.452) [-1113.992] (-1116.094) (-1114.176) * (-1117.242) (-1116.946) [-1114.371] (-1119.007) -- 0:00:57
109500 -- [-1115.158] (-1114.495) (-1114.019) (-1117.969) * (-1115.766) [-1113.762] (-1114.668) (-1119.532) -- 0:00:56
110000 -- (-1118.511) [-1114.177] (-1113.696) (-1114.456) * (-1120.014) (-1114.459) (-1114.668) [-1116.571] -- 0:00:56
Average standard deviation of split frequencies: 0.028697
110500 -- [-1115.038] (-1117.207) (-1113.644) (-1114.530) * (-1116.417) (-1115.561) (-1115.409) [-1114.653] -- 0:00:56
111000 -- (-1114.915) [-1119.097] (-1115.791) (-1114.244) * (-1115.275) (-1114.138) (-1119.496) [-1118.120] -- 0:00:56
111500 -- (-1114.957) [-1117.619] (-1114.845) (-1115.127) * [-1114.628] (-1114.109) (-1121.467) (-1115.717) -- 0:00:55
112000 -- (-1116.879) (-1120.477) (-1116.403) [-1115.406] * (-1115.195) (-1118.780) (-1115.703) [-1116.605] -- 0:00:55
112500 -- (-1124.074) [-1121.738] (-1116.751) (-1114.795) * (-1121.624) (-1115.706) [-1116.204] (-1115.402) -- 0:00:55
113000 -- (-1123.754) (-1114.669) [-1118.135] (-1114.672) * (-1115.156) [-1116.431] (-1116.072) (-1116.565) -- 0:00:54
113500 -- (-1115.058) (-1114.315) (-1115.481) [-1115.724] * (-1114.376) (-1116.170) [-1117.954] (-1116.362) -- 0:00:54
114000 -- (-1114.985) (-1116.447) [-1116.332] (-1115.628) * (-1117.086) [-1116.525] (-1116.983) (-1114.892) -- 0:00:54
114500 -- [-1114.985] (-1116.311) (-1116.999) (-1118.719) * (-1116.984) (-1113.301) (-1115.793) [-1115.867] -- 0:00:54
115000 -- (-1114.903) [-1115.457] (-1115.712) (-1115.055) * (-1116.490) (-1115.042) (-1116.095) [-1114.037] -- 0:00:53
Average standard deviation of split frequencies: 0.026705
115500 -- (-1117.018) (-1114.786) (-1119.217) [-1113.570] * [-1114.339] (-1115.076) (-1116.096) (-1115.906) -- 0:01:01
116000 -- (-1115.530) [-1115.330] (-1117.433) (-1113.571) * (-1114.832) [-1116.276] (-1114.087) (-1113.743) -- 0:01:00
116500 -- (-1117.089) (-1115.782) [-1114.907] (-1114.175) * [-1114.012] (-1116.646) (-1113.608) (-1113.738) -- 0:01:00
117000 -- (-1116.834) (-1113.988) [-1115.444] (-1114.564) * (-1113.979) (-1115.000) [-1114.236] (-1113.545) -- 0:01:00
117500 -- (-1116.661) [-1115.777] (-1113.463) (-1115.195) * (-1115.956) (-1115.382) [-1114.108] (-1113.881) -- 0:01:00
118000 -- (-1115.563) (-1114.630) [-1115.403] (-1119.952) * (-1114.805) (-1114.929) [-1114.738] (-1116.342) -- 0:00:59
118500 -- (-1114.633) [-1114.039] (-1114.769) (-1115.219) * (-1116.700) [-1116.552] (-1116.212) (-1114.030) -- 0:00:59
119000 -- [-1116.064] (-1117.130) (-1114.671) (-1116.126) * (-1115.207) (-1115.071) [-1114.519] (-1114.275) -- 0:00:59
119500 -- (-1114.159) (-1116.850) (-1116.083) [-1120.539] * (-1118.561) (-1115.925) (-1115.123) [-1113.535] -- 0:00:58
120000 -- [-1114.509] (-1120.059) (-1114.502) (-1116.598) * (-1118.214) [-1114.572] (-1115.439) (-1114.682) -- 0:00:58
Average standard deviation of split frequencies: 0.024417
120500 -- [-1114.441] (-1121.605) (-1114.502) (-1119.262) * [-1118.169] (-1113.620) (-1114.327) (-1116.431) -- 0:00:58
121000 -- [-1115.370] (-1116.002) (-1115.887) (-1115.893) * (-1115.984) [-1113.586] (-1119.195) (-1114.309) -- 0:00:58
121500 -- (-1114.603) (-1116.952) [-1114.775] (-1115.711) * (-1117.124) [-1116.797] (-1115.808) (-1115.051) -- 0:00:57
122000 -- (-1117.208) [-1116.354] (-1115.551) (-1115.187) * (-1115.135) (-1114.621) [-1114.539] (-1116.506) -- 0:00:57
122500 -- [-1116.849] (-1116.025) (-1115.352) (-1115.209) * (-1116.065) (-1114.837) (-1116.864) [-1116.311] -- 0:00:57
123000 -- [-1122.402] (-1119.660) (-1114.664) (-1114.548) * (-1115.858) [-1114.232] (-1115.983) (-1116.725) -- 0:00:57
123500 -- (-1115.273) [-1113.401] (-1119.967) (-1113.396) * (-1118.670) [-1113.563] (-1117.124) (-1116.642) -- 0:00:56
124000 -- [-1115.618] (-1113.598) (-1116.454) (-1122.242) * (-1118.831) (-1117.244) [-1113.633] (-1115.501) -- 0:00:56
124500 -- (-1115.818) [-1114.180] (-1117.312) (-1115.757) * (-1119.918) (-1115.642) [-1114.919] (-1116.255) -- 0:00:56
125000 -- (-1116.535) [-1114.273] (-1114.683) (-1114.871) * (-1120.122) [-1115.956] (-1117.161) (-1115.800) -- 0:00:56
Average standard deviation of split frequencies: 0.024229
125500 -- (-1116.544) [-1116.510] (-1114.305) (-1114.284) * (-1115.503) (-1114.677) [-1114.742] (-1113.599) -- 0:00:55
126000 -- (-1114.331) (-1114.441) (-1115.225) [-1113.504] * [-1113.767] (-1114.723) (-1120.773) (-1115.752) -- 0:00:55
126500 -- (-1115.585) [-1116.272] (-1114.492) (-1115.115) * [-1114.064] (-1113.782) (-1118.979) (-1115.215) -- 0:00:55
127000 -- (-1114.325) (-1118.073) [-1116.364] (-1114.881) * [-1114.154] (-1117.737) (-1121.315) (-1116.228) -- 0:00:54
127500 -- (-1115.026) (-1117.593) (-1119.134) [-1114.910] * [-1114.042] (-1116.100) (-1121.595) (-1113.798) -- 0:00:54
128000 -- (-1114.676) [-1115.579] (-1114.250) (-1115.191) * (-1117.145) (-1118.454) [-1115.656] (-1113.961) -- 0:00:54
128500 -- (-1114.254) [-1116.122] (-1114.233) (-1117.644) * (-1115.605) [-1116.366] (-1116.657) (-1114.200) -- 0:00:54
129000 -- (-1115.811) (-1115.189) (-1115.920) [-1116.179] * (-1117.559) [-1116.215] (-1114.963) (-1114.131) -- 0:00:54
129500 -- (-1115.626) [-1117.828] (-1116.798) (-1114.070) * (-1115.499) [-1113.587] (-1114.951) (-1114.590) -- 0:00:53
130000 -- [-1116.149] (-1115.942) (-1114.119) (-1115.879) * (-1114.752) (-1114.266) [-1114.051] (-1114.487) -- 0:00:53
Average standard deviation of split frequencies: 0.022909
130500 -- (-1114.818) (-1115.332) (-1114.533) [-1122.379] * [-1115.848] (-1113.428) (-1117.807) (-1114.911) -- 0:00:53
131000 -- [-1113.945] (-1114.358) (-1115.103) (-1117.607) * (-1118.025) [-1116.592] (-1115.732) (-1119.230) -- 0:00:53
131500 -- (-1115.644) [-1114.358] (-1117.204) (-1116.709) * (-1115.095) (-1119.956) (-1114.746) [-1115.993] -- 0:00:52
132000 -- (-1114.794) [-1115.270] (-1114.437) (-1116.443) * (-1114.616) (-1117.013) (-1113.843) [-1115.404] -- 0:00:59
132500 -- (-1115.321) (-1115.001) [-1114.264] (-1114.095) * (-1116.325) (-1118.179) [-1116.106] (-1114.826) -- 0:00:58
133000 -- (-1117.041) (-1115.310) (-1117.751) [-1114.177] * (-1118.800) [-1116.154] (-1114.324) (-1115.599) -- 0:00:58
133500 -- [-1115.569] (-1114.708) (-1120.914) (-1115.171) * (-1117.275) (-1119.554) (-1114.733) [-1117.922] -- 0:00:58
134000 -- (-1114.851) (-1118.251) [-1116.276] (-1114.228) * [-1115.661] (-1114.074) (-1114.246) (-1115.452) -- 0:00:58
134500 -- [-1114.170] (-1117.692) (-1118.859) (-1118.726) * (-1116.337) (-1115.221) (-1114.544) [-1114.309] -- 0:00:57
135000 -- (-1114.164) [-1117.148] (-1115.229) (-1114.811) * (-1117.013) (-1116.995) [-1117.607] (-1119.725) -- 0:00:57
Average standard deviation of split frequencies: 0.022184
135500 -- (-1115.405) [-1115.516] (-1116.083) (-1114.078) * (-1116.618) (-1114.296) [-1116.775] (-1116.326) -- 0:00:57
136000 -- (-1115.660) (-1115.549) (-1116.470) [-1114.159] * (-1116.996) [-1114.414] (-1116.355) (-1116.396) -- 0:00:57
136500 -- (-1116.068) [-1117.789] (-1114.347) (-1121.127) * (-1118.352) (-1114.024) [-1113.705] (-1115.868) -- 0:00:56
137000 -- [-1116.975] (-1113.998) (-1118.985) (-1117.251) * (-1116.384) (-1118.267) [-1113.587] (-1117.916) -- 0:00:56
137500 -- (-1116.904) [-1117.472] (-1114.937) (-1114.480) * (-1115.116) (-1114.272) (-1117.632) [-1117.035] -- 0:00:56
138000 -- (-1115.339) (-1118.154) [-1114.648] (-1116.834) * (-1116.076) (-1115.498) [-1114.345] (-1117.540) -- 0:00:56
138500 -- (-1115.991) [-1115.054] (-1117.205) (-1116.275) * (-1114.398) (-1118.169) (-1115.927) [-1116.265] -- 0:00:55
139000 -- (-1114.687) (-1115.700) (-1115.599) [-1114.366] * (-1114.200) (-1115.172) [-1116.404] (-1117.760) -- 0:00:55
139500 -- (-1115.127) [-1115.704] (-1119.279) (-1114.174) * (-1115.305) (-1116.104) (-1118.814) [-1118.888] -- 0:00:55
140000 -- (-1118.929) [-1115.833] (-1114.871) (-1113.594) * [-1117.224] (-1114.399) (-1115.832) (-1117.563) -- 0:00:55
Average standard deviation of split frequencies: 0.022753
140500 -- (-1116.203) [-1115.416] (-1116.574) (-1113.584) * (-1117.612) (-1115.199) [-1117.465] (-1115.406) -- 0:00:55
141000 -- (-1117.708) (-1113.988) (-1114.084) [-1115.480] * (-1115.443) (-1115.171) (-1123.565) [-1114.357] -- 0:00:54
141500 -- (-1116.772) (-1116.932) (-1114.194) [-1116.497] * (-1115.890) [-1114.166] (-1114.113) (-1113.905) -- 0:00:54
142000 -- (-1118.380) (-1117.932) (-1115.331) [-1114.478] * (-1116.178) [-1114.436] (-1113.275) (-1114.746) -- 0:00:54
142500 -- [-1118.448] (-1115.859) (-1115.281) (-1115.352) * (-1114.456) [-1114.450] (-1113.602) (-1116.686) -- 0:00:54
143000 -- [-1115.363] (-1113.713) (-1115.081) (-1115.081) * (-1113.483) [-1113.963] (-1116.387) (-1113.568) -- 0:00:53
143500 -- (-1117.467) [-1113.869] (-1116.180) (-1114.477) * [-1119.841] (-1113.850) (-1119.993) (-1115.446) -- 0:00:53
144000 -- (-1115.253) [-1114.471] (-1114.530) (-1114.622) * (-1116.046) (-1113.428) [-1115.921] (-1118.320) -- 0:00:53
144500 -- [-1114.798] (-1114.867) (-1116.296) (-1113.763) * (-1115.807) (-1113.429) (-1118.482) [-1118.707] -- 0:00:53
145000 -- (-1116.159) [-1118.307] (-1115.339) (-1113.948) * [-1115.047] (-1116.880) (-1116.162) (-1115.650) -- 0:00:53
Average standard deviation of split frequencies: 0.024139
145500 -- [-1115.660] (-1118.433) (-1116.476) (-1113.324) * (-1114.831) [-1117.509] (-1116.385) (-1117.013) -- 0:00:52
146000 -- (-1115.298) [-1113.992] (-1117.317) (-1115.165) * (-1116.812) (-1115.592) (-1114.371) [-1115.308] -- 0:00:52
146500 -- (-1115.348) (-1114.101) [-1114.051] (-1118.991) * (-1114.650) [-1114.842] (-1118.941) (-1113.591) -- 0:00:52
147000 -- (-1113.850) (-1114.737) [-1114.457] (-1113.327) * [-1114.377] (-1114.574) (-1115.537) (-1113.591) -- 0:00:52
147500 -- (-1115.889) [-1114.838] (-1114.897) (-1114.116) * (-1114.435) (-1114.208) [-1114.016] (-1115.954) -- 0:00:52
148000 -- (-1114.741) [-1114.162] (-1116.761) (-1113.444) * (-1113.817) (-1113.355) (-1114.832) [-1114.977] -- 0:00:51
148500 -- (-1114.465) (-1116.680) (-1113.889) [-1113.426] * (-1114.438) [-1114.035] (-1114.051) (-1114.683) -- 0:00:57
149000 -- (-1113.759) [-1115.100] (-1116.672) (-1114.850) * [-1115.648] (-1114.467) (-1115.799) (-1121.426) -- 0:00:57
149500 -- (-1113.759) [-1113.823] (-1115.090) (-1114.499) * (-1114.308) (-1115.430) [-1115.076] (-1116.919) -- 0:00:56
150000 -- (-1113.965) (-1116.824) (-1116.023) [-1118.886] * [-1115.538] (-1116.084) (-1116.600) (-1115.384) -- 0:00:56
Average standard deviation of split frequencies: 0.023242
150500 -- (-1119.744) (-1114.147) [-1114.177] (-1114.361) * (-1114.176) (-1115.209) [-1117.492] (-1116.409) -- 0:00:56
151000 -- (-1116.917) [-1113.677] (-1113.874) (-1113.994) * (-1116.354) (-1113.752) (-1115.362) [-1114.142] -- 0:00:56
151500 -- (-1119.784) (-1114.925) [-1113.685] (-1114.968) * (-1120.284) (-1113.796) (-1116.371) [-1115.893] -- 0:00:56
152000 -- (-1115.273) [-1115.027] (-1115.171) (-1114.528) * [-1114.378] (-1115.180) (-1114.657) (-1117.950) -- 0:00:55
152500 -- (-1114.100) [-1115.254] (-1114.113) (-1114.251) * [-1114.373] (-1114.539) (-1119.074) (-1117.112) -- 0:00:55
153000 -- [-1114.100] (-1119.237) (-1114.808) (-1114.205) * (-1115.108) [-1114.218] (-1114.818) (-1116.286) -- 0:00:55
153500 -- (-1114.372) (-1118.289) (-1113.885) [-1114.687] * (-1118.802) [-1114.287] (-1114.861) (-1116.725) -- 0:00:55
154000 -- [-1114.761] (-1116.098) (-1114.656) (-1115.967) * [-1119.213] (-1114.523) (-1114.902) (-1116.650) -- 0:00:54
154500 -- [-1117.038] (-1116.897) (-1114.510) (-1115.941) * (-1116.921) (-1114.932) [-1114.037] (-1113.939) -- 0:00:54
155000 -- (-1116.326) [-1118.759] (-1115.132) (-1115.593) * (-1115.184) (-1114.413) (-1116.462) [-1116.916] -- 0:00:54
Average standard deviation of split frequencies: 0.021153
155500 -- (-1115.951) (-1116.157) (-1116.528) [-1114.188] * (-1114.194) (-1116.417) (-1114.319) [-1117.835] -- 0:00:54
156000 -- (-1116.458) (-1114.460) [-1115.974] (-1114.142) * (-1114.282) (-1115.892) [-1114.911] (-1116.728) -- 0:00:54
156500 -- (-1116.782) (-1115.039) [-1114.154] (-1115.537) * (-1115.256) [-1115.193] (-1114.642) (-1117.631) -- 0:00:53
157000 -- [-1116.391] (-1117.411) (-1114.692) (-1115.676) * (-1117.808) [-1114.300] (-1119.528) (-1118.040) -- 0:00:53
157500 -- [-1117.457] (-1116.345) (-1115.565) (-1114.756) * (-1116.850) (-1115.757) [-1117.553] (-1114.072) -- 0:00:53
158000 -- [-1116.611] (-1115.306) (-1115.435) (-1117.979) * (-1114.628) (-1114.638) [-1116.438] (-1114.908) -- 0:00:53
158500 -- (-1114.399) [-1119.258] (-1114.500) (-1114.256) * (-1114.097) (-1116.429) [-1117.247] (-1113.302) -- 0:00:53
159000 -- (-1114.171) (-1114.573) [-1114.501] (-1116.582) * (-1117.593) (-1118.361) (-1114.571) [-1113.988] -- 0:00:52
159500 -- (-1116.179) [-1119.408] (-1117.778) (-1116.069) * [-1113.782] (-1116.981) (-1115.038) (-1113.883) -- 0:00:52
160000 -- (-1114.839) (-1119.137) [-1114.206] (-1123.742) * (-1116.778) (-1117.374) (-1117.521) [-1115.884] -- 0:00:52
Average standard deviation of split frequencies: 0.020538
160500 -- (-1116.155) [-1114.567] (-1115.664) (-1120.626) * (-1115.332) [-1115.617] (-1117.004) (-1119.576) -- 0:00:52
161000 -- (-1118.470) (-1116.450) (-1116.473) [-1114.227] * (-1116.091) [-1114.438] (-1117.282) (-1119.046) -- 0:00:52
161500 -- (-1116.250) (-1116.313) (-1114.027) [-1114.318] * (-1116.221) [-1114.425] (-1116.287) (-1115.798) -- 0:00:51
162000 -- [-1121.550] (-1115.652) (-1114.552) (-1115.041) * (-1114.585) (-1115.080) (-1114.749) [-1116.723] -- 0:00:51
162500 -- (-1115.138) [-1114.532] (-1114.723) (-1113.966) * [-1114.253] (-1114.940) (-1115.422) (-1114.543) -- 0:00:51
163000 -- (-1114.401) (-1114.156) (-1114.386) [-1114.232] * [-1114.950] (-1115.150) (-1114.448) (-1117.632) -- 0:00:51
163500 -- [-1115.871] (-1113.795) (-1114.383) (-1114.390) * (-1117.125) (-1116.355) (-1115.693) [-1115.283] -- 0:00:51
164000 -- (-1114.612) (-1115.849) [-1114.596] (-1115.181) * (-1114.427) (-1115.786) [-1113.698] (-1115.071) -- 0:00:50
164500 -- (-1115.709) (-1114.124) (-1118.855) [-1114.974] * (-1123.038) (-1113.873) (-1115.990) [-1114.811] -- 0:00:50
165000 -- (-1114.462) (-1114.814) (-1115.556) [-1114.775] * (-1118.838) [-1113.966] (-1118.080) (-1115.710) -- 0:00:55
Average standard deviation of split frequencies: 0.020020
165500 -- [-1113.739] (-1118.424) (-1115.556) (-1113.967) * (-1114.176) (-1114.968) [-1117.885] (-1116.365) -- 0:00:55
166000 -- (-1115.730) (-1121.923) [-1114.097] (-1115.401) * (-1115.137) (-1116.390) (-1115.456) [-1118.175] -- 0:00:55
166500 -- (-1114.414) (-1118.929) (-1115.975) [-1116.180] * [-1114.004] (-1114.880) (-1116.656) (-1115.417) -- 0:00:55
167000 -- (-1123.282) (-1120.547) [-1117.529] (-1117.315) * [-1114.568] (-1115.079) (-1121.112) (-1114.184) -- 0:00:54
167500 -- [-1114.432] (-1117.953) (-1118.321) (-1116.136) * [-1114.201] (-1116.114) (-1118.358) (-1119.538) -- 0:00:54
168000 -- (-1113.525) (-1116.495) [-1118.533] (-1115.914) * (-1113.783) [-1113.716] (-1115.675) (-1114.529) -- 0:00:54
168500 -- (-1118.653) [-1115.660] (-1117.865) (-1113.725) * [-1113.626] (-1114.426) (-1115.477) (-1115.623) -- 0:00:54
169000 -- (-1116.176) (-1114.546) (-1120.633) [-1114.158] * (-1115.100) (-1119.197) [-1114.633] (-1118.851) -- 0:00:54
169500 -- (-1116.959) (-1116.831) [-1117.498] (-1113.766) * (-1117.491) (-1118.645) [-1114.793] (-1119.394) -- 0:00:53
170000 -- (-1116.180) (-1120.204) (-1116.615) [-1115.401] * [-1113.800] (-1121.104) (-1114.355) (-1114.904) -- 0:00:53
Average standard deviation of split frequencies: 0.018463
170500 -- (-1117.666) [-1117.000] (-1117.688) (-1113.954) * (-1115.430) (-1116.435) [-1114.409] (-1115.129) -- 0:00:53
171000 -- (-1116.135) [-1116.847] (-1116.822) (-1114.932) * (-1115.553) (-1116.646) [-1114.033] (-1115.815) -- 0:00:53
171500 -- [-1116.444] (-1115.455) (-1118.898) (-1113.868) * (-1118.643) [-1116.480] (-1116.666) (-1114.753) -- 0:00:53
172000 -- (-1116.876) (-1116.746) (-1118.686) [-1117.115] * [-1116.383] (-1114.663) (-1116.921) (-1115.250) -- 0:00:52
172500 -- (-1115.983) (-1115.004) (-1119.185) [-1113.873] * [-1116.711] (-1113.881) (-1116.639) (-1117.695) -- 0:00:52
173000 -- [-1114.783] (-1122.895) (-1117.797) (-1114.716) * (-1117.119) [-1115.949] (-1117.585) (-1117.026) -- 0:00:52
173500 -- (-1114.976) (-1116.233) [-1116.282] (-1119.928) * [-1116.390] (-1118.026) (-1120.169) (-1117.336) -- 0:00:52
174000 -- (-1114.370) (-1114.392) [-1113.894] (-1115.104) * [-1114.745] (-1115.046) (-1118.869) (-1118.512) -- 0:00:52
174500 -- [-1115.593] (-1117.173) (-1118.210) (-1117.130) * [-1115.771] (-1114.972) (-1115.740) (-1116.179) -- 0:00:52
175000 -- (-1114.621) (-1114.680) (-1114.522) [-1114.192] * (-1115.150) (-1114.963) (-1114.185) [-1116.805] -- 0:00:51
Average standard deviation of split frequencies: 0.017057
175500 -- (-1114.052) [-1114.873] (-1113.822) (-1114.940) * [-1116.357] (-1117.109) (-1113.487) (-1115.254) -- 0:00:51
176000 -- [-1113.382] (-1114.417) (-1116.313) (-1115.519) * (-1117.729) [-1115.598] (-1114.127) (-1115.670) -- 0:00:51
176500 -- (-1115.688) (-1114.296) [-1113.949] (-1114.168) * [-1114.777] (-1115.129) (-1115.145) (-1122.011) -- 0:00:51
177000 -- (-1115.596) [-1115.239] (-1115.295) (-1114.841) * [-1115.683] (-1114.727) (-1116.428) (-1117.031) -- 0:00:51
177500 -- [-1115.009] (-1115.555) (-1116.414) (-1116.223) * [-1115.401] (-1119.098) (-1115.626) (-1114.933) -- 0:00:50
178000 -- (-1116.806) [-1115.146] (-1116.665) (-1115.469) * (-1114.990) [-1117.502] (-1114.673) (-1114.729) -- 0:00:50
178500 -- [-1116.387] (-1116.578) (-1114.930) (-1115.509) * (-1116.697) (-1118.159) (-1114.856) [-1115.296] -- 0:00:50
179000 -- (-1115.396) [-1115.566] (-1114.506) (-1115.747) * (-1118.491) (-1116.713) [-1115.764] (-1115.846) -- 0:00:50
179500 -- (-1117.721) [-1115.603] (-1114.506) (-1115.713) * (-1118.456) [-1117.063] (-1114.853) (-1118.456) -- 0:00:50
180000 -- (-1116.766) [-1113.863] (-1114.082) (-1116.344) * (-1118.518) [-1115.766] (-1115.204) (-1115.525) -- 0:00:50
Average standard deviation of split frequencies: 0.018127
180500 -- [-1115.772] (-1113.967) (-1115.236) (-1117.466) * (-1117.695) [-1116.017] (-1114.590) (-1119.016) -- 0:00:49
181000 -- [-1114.478] (-1114.729) (-1117.548) (-1116.363) * (-1114.007) [-1114.348] (-1115.121) (-1114.743) -- 0:00:54
181500 -- (-1113.681) (-1114.801) [-1116.726] (-1119.603) * (-1114.114) (-1114.570) [-1113.715] (-1114.261) -- 0:00:54
182000 -- [-1113.980] (-1116.732) (-1114.763) (-1118.396) * (-1113.332) (-1113.512) (-1114.562) [-1113.974] -- 0:00:53
182500 -- (-1120.493) (-1114.554) (-1115.573) [-1113.735] * (-1113.719) [-1113.578] (-1113.694) (-1115.791) -- 0:00:53
183000 -- [-1116.369] (-1117.488) (-1116.812) (-1114.118) * [-1114.968] (-1114.736) (-1115.869) (-1115.014) -- 0:00:53
183500 -- (-1115.815) [-1115.005] (-1119.664) (-1115.424) * (-1113.910) (-1114.448) [-1116.202] (-1116.242) -- 0:00:53
184000 -- (-1116.627) [-1114.778] (-1115.113) (-1119.264) * (-1116.837) (-1115.427) (-1116.121) [-1113.883] -- 0:00:53
184500 -- (-1117.006) (-1114.464) [-1113.943] (-1119.684) * (-1114.269) (-1115.144) [-1115.592] (-1114.704) -- 0:00:53
185000 -- (-1120.344) (-1114.614) [-1114.777] (-1120.751) * (-1115.020) [-1115.361] (-1116.045) (-1114.577) -- 0:00:52
Average standard deviation of split frequencies: 0.015587
185500 -- (-1119.954) (-1115.478) (-1113.497) [-1117.573] * (-1114.481) (-1114.120) [-1114.769] (-1114.558) -- 0:00:52
186000 -- [-1114.892] (-1117.011) (-1117.007) (-1116.222) * (-1116.321) (-1116.131) [-1114.400] (-1119.024) -- 0:00:52
186500 -- [-1117.984] (-1117.280) (-1116.691) (-1117.258) * (-1115.263) (-1120.309) [-1115.514] (-1114.134) -- 0:00:52
187000 -- (-1115.125) [-1117.407] (-1114.893) (-1116.186) * (-1114.763) [-1116.642] (-1115.655) (-1114.931) -- 0:00:52
187500 -- [-1114.549] (-1115.660) (-1119.889) (-1117.046) * [-1114.756] (-1116.705) (-1116.047) (-1114.460) -- 0:00:52
188000 -- (-1114.323) [-1114.966] (-1117.088) (-1113.616) * (-1117.648) [-1114.285] (-1115.128) (-1114.051) -- 0:00:51
188500 -- (-1114.942) (-1115.256) (-1115.608) [-1115.444] * (-1113.558) (-1115.363) [-1115.247] (-1113.534) -- 0:00:51
189000 -- (-1114.943) (-1117.769) (-1117.999) [-1114.223] * (-1124.408) [-1113.713] (-1115.192) (-1114.330) -- 0:00:51
189500 -- [-1115.507] (-1114.023) (-1115.793) (-1114.679) * (-1114.456) [-1113.917] (-1116.486) (-1115.242) -- 0:00:51
190000 -- (-1114.564) [-1115.064] (-1114.183) (-1116.562) * [-1115.310] (-1114.226) (-1114.972) (-1115.912) -- 0:00:51
Average standard deviation of split frequencies: 0.015823
190500 -- [-1117.931] (-1115.622) (-1115.200) (-1116.420) * [-1115.467] (-1118.482) (-1114.685) (-1118.958) -- 0:00:50
191000 -- (-1113.872) [-1117.162] (-1114.699) (-1114.034) * (-1116.110) (-1115.483) (-1115.708) [-1117.328] -- 0:00:50
191500 -- (-1114.347) (-1119.706) [-1114.519] (-1115.029) * (-1117.418) (-1116.056) (-1115.863) [-1115.036] -- 0:00:50
192000 -- (-1115.628) (-1119.436) (-1114.663) [-1114.210] * (-1116.359) (-1124.358) [-1114.588] (-1119.227) -- 0:00:50
192500 -- (-1116.789) (-1116.848) [-1116.821] (-1114.512) * (-1116.956) (-1116.326) [-1114.691] (-1113.950) -- 0:00:50
193000 -- (-1115.291) (-1115.609) [-1116.189] (-1114.963) * (-1116.152) [-1116.463] (-1114.412) (-1115.847) -- 0:00:50
193500 -- (-1114.135) (-1117.773) [-1114.878] (-1114.357) * (-1117.255) (-1114.973) (-1119.046) [-1116.831] -- 0:00:50
194000 -- (-1116.773) (-1117.718) (-1116.087) [-1115.104] * (-1115.301) (-1115.574) (-1115.302) [-1113.579] -- 0:00:49
194500 -- [-1115.242] (-1115.762) (-1118.203) (-1114.167) * (-1119.968) [-1116.134] (-1119.890) (-1113.340) -- 0:00:49
195000 -- (-1119.357) (-1114.378) [-1113.640] (-1113.972) * (-1116.258) (-1115.482) [-1115.213] (-1115.252) -- 0:00:49
Average standard deviation of split frequencies: 0.017409
195500 -- (-1116.750) (-1115.571) [-1115.579] (-1114.391) * (-1116.934) [-1116.080] (-1116.105) (-1113.665) -- 0:00:49
196000 -- (-1117.227) (-1118.852) (-1116.047) [-1114.956] * (-1116.142) (-1114.448) (-1113.738) [-1113.552] -- 0:00:49
196500 -- [-1116.742] (-1115.414) (-1116.398) (-1116.227) * (-1117.638) (-1114.589) [-1114.726] (-1115.906) -- 0:00:49
197000 -- [-1115.472] (-1115.682) (-1117.901) (-1114.062) * (-1120.476) [-1113.966] (-1114.051) (-1114.043) -- 0:00:48
197500 -- (-1116.775) [-1115.638] (-1113.923) (-1113.562) * (-1118.696) [-1117.671] (-1118.524) (-1113.741) -- 0:00:48
198000 -- (-1115.507) [-1116.150] (-1115.250) (-1114.395) * [-1116.058] (-1114.977) (-1116.588) (-1114.684) -- 0:00:52
198500 -- (-1113.549) (-1116.263) (-1116.976) [-1114.617] * (-1116.667) (-1115.807) (-1114.916) [-1114.613] -- 0:00:52
199000 -- (-1113.538) (-1116.616) [-1114.339] (-1114.291) * (-1113.872) [-1113.947] (-1113.841) (-1113.410) -- 0:00:52
199500 -- [-1114.802] (-1116.120) (-1114.293) (-1114.464) * (-1116.381) (-1113.960) [-1119.495] (-1113.410) -- 0:00:52
200000 -- [-1116.754] (-1116.222) (-1116.178) (-1120.326) * (-1115.895) [-1114.560] (-1120.648) (-1117.651) -- 0:00:51
Average standard deviation of split frequencies: 0.018346
200500 -- (-1119.720) (-1116.859) [-1114.565] (-1119.817) * [-1113.716] (-1113.619) (-1114.485) (-1121.534) -- 0:00:51
201000 -- (-1119.088) (-1116.647) [-1114.009] (-1116.340) * (-1113.580) [-1115.697] (-1113.283) (-1117.619) -- 0:00:51
201500 -- (-1115.603) (-1116.041) (-1115.261) [-1115.980] * (-1118.260) (-1113.899) (-1113.849) [-1114.027] -- 0:00:51
202000 -- (-1119.381) (-1118.831) [-1116.530] (-1116.517) * [-1113.511] (-1118.440) (-1113.800) (-1115.903) -- 0:00:51
202500 -- (-1117.995) (-1114.658) (-1118.515) [-1114.359] * (-1115.373) (-1115.203) [-1113.800] (-1114.581) -- 0:00:51
203000 -- (-1116.466) (-1115.187) [-1114.853] (-1116.031) * (-1115.746) (-1113.885) [-1114.251] (-1114.452) -- 0:00:51
203500 -- (-1114.886) (-1114.365) (-1116.432) [-1121.341] * (-1118.465) [-1115.266] (-1114.621) (-1114.840) -- 0:00:50
204000 -- [-1116.024] (-1114.742) (-1115.013) (-1115.493) * (-1114.288) [-1115.031] (-1114.372) (-1116.143) -- 0:00:50
204500 -- (-1115.085) (-1114.766) [-1115.665] (-1116.346) * (-1114.350) (-1114.323) [-1114.458] (-1117.425) -- 0:00:50
205000 -- [-1114.985] (-1116.808) (-1118.636) (-1120.127) * (-1120.663) (-1119.026) (-1113.847) [-1117.075] -- 0:00:50
Average standard deviation of split frequencies: 0.019833
205500 -- (-1120.539) (-1114.735) [-1116.547] (-1117.485) * (-1113.989) (-1121.700) (-1115.439) [-1115.014] -- 0:00:50
206000 -- (-1120.326) (-1115.546) (-1116.649) [-1116.729] * (-1116.613) (-1118.785) (-1113.771) [-1116.753] -- 0:00:50
206500 -- (-1118.876) [-1116.097] (-1119.075) (-1115.246) * (-1116.748) [-1119.216] (-1113.843) (-1114.366) -- 0:00:49
207000 -- (-1117.354) (-1113.903) (-1115.032) [-1114.616] * (-1118.319) (-1119.643) (-1114.816) [-1116.146] -- 0:00:49
207500 -- (-1123.251) (-1117.380) [-1113.863] (-1121.025) * [-1115.208] (-1120.256) (-1113.260) (-1116.416) -- 0:00:49
208000 -- (-1116.809) [-1114.780] (-1115.090) (-1116.973) * (-1118.348) (-1120.606) [-1113.632] (-1115.023) -- 0:00:49
208500 -- (-1119.792) [-1115.702] (-1114.654) (-1115.273) * [-1115.321] (-1118.242) (-1116.663) (-1115.362) -- 0:00:49
209000 -- (-1116.628) (-1113.298) (-1116.091) [-1115.803] * (-1114.262) [-1117.276] (-1120.998) (-1115.355) -- 0:00:49
209500 -- (-1116.384) (-1115.041) [-1115.680] (-1116.075) * [-1118.517] (-1117.627) (-1117.986) (-1114.168) -- 0:00:49
210000 -- (-1117.007) (-1115.441) (-1115.657) [-1119.737] * [-1115.787] (-1117.265) (-1114.726) (-1113.763) -- 0:00:48
Average standard deviation of split frequencies: 0.017901
210500 -- (-1114.798) (-1115.122) [-1113.575] (-1116.087) * (-1115.050) (-1114.423) (-1114.525) [-1115.365] -- 0:00:48
211000 -- (-1115.757) (-1114.419) [-1113.934] (-1117.039) * [-1116.279] (-1115.017) (-1115.171) (-1114.460) -- 0:00:48
211500 -- [-1115.687] (-1115.605) (-1113.960) (-1116.253) * [-1115.543] (-1116.681) (-1114.425) (-1116.446) -- 0:00:48
212000 -- (-1113.989) (-1118.406) [-1115.878] (-1114.786) * [-1120.188] (-1114.072) (-1113.488) (-1116.139) -- 0:00:48
212500 -- (-1115.044) (-1114.418) (-1118.386) [-1114.852] * (-1116.287) [-1115.367] (-1115.609) (-1122.268) -- 0:00:48
213000 -- (-1116.160) (-1114.086) (-1116.077) [-1116.303] * (-1118.643) (-1114.114) (-1114.660) [-1119.903] -- 0:00:48
213500 -- (-1115.449) (-1114.309) [-1115.206] (-1114.780) * (-1118.196) (-1114.226) [-1114.442] (-1114.770) -- 0:00:47
214000 -- (-1115.413) (-1117.512) (-1115.506) [-1115.444] * (-1118.710) (-1114.514) [-1114.928] (-1118.319) -- 0:00:47
214500 -- (-1114.446) [-1115.904] (-1118.190) (-1117.501) * (-1119.261) [-1115.945] (-1116.605) (-1119.016) -- 0:00:47
215000 -- [-1116.792] (-1116.231) (-1117.008) (-1114.502) * (-1115.696) (-1117.986) (-1116.903) [-1113.576] -- 0:00:51
Average standard deviation of split frequencies: 0.016732
215500 -- (-1114.977) [-1115.032] (-1115.796) (-1113.857) * [-1116.165] (-1116.792) (-1116.947) (-1116.891) -- 0:00:50
216000 -- [-1115.090] (-1116.266) (-1115.977) (-1114.467) * [-1118.654] (-1116.353) (-1119.243) (-1115.392) -- 0:00:50
216500 -- [-1115.589] (-1115.331) (-1117.890) (-1114.575) * (-1117.690) (-1118.028) (-1120.470) [-1116.369] -- 0:00:50
217000 -- (-1113.372) [-1114.071] (-1117.687) (-1113.915) * (-1119.128) (-1118.680) (-1118.996) [-1116.887] -- 0:00:50
217500 -- (-1116.995) [-1115.895] (-1115.956) (-1119.718) * (-1116.975) (-1118.305) (-1118.937) [-1116.652] -- 0:00:50
218000 -- (-1117.224) (-1121.892) (-1115.936) [-1114.704] * [-1114.722] (-1114.746) (-1117.684) (-1121.015) -- 0:00:50
218500 -- (-1118.623) (-1113.859) [-1117.851] (-1118.643) * (-1115.261) [-1117.480] (-1119.124) (-1116.995) -- 0:00:50
219000 -- (-1114.764) [-1113.834] (-1114.647) (-1114.760) * (-1119.613) [-1114.632] (-1117.024) (-1116.048) -- 0:00:49
219500 -- [-1117.295] (-1113.882) (-1117.001) (-1114.143) * (-1115.778) [-1114.573] (-1115.345) (-1113.851) -- 0:00:49
220000 -- (-1115.537) [-1116.172] (-1115.691) (-1114.222) * (-1114.699) [-1115.575] (-1117.688) (-1113.952) -- 0:00:49
Average standard deviation of split frequencies: 0.014633
220500 -- (-1114.098) [-1117.141] (-1117.235) (-1114.137) * [-1117.000] (-1114.248) (-1114.846) (-1116.452) -- 0:00:49
221000 -- (-1115.366) [-1116.070] (-1115.363) (-1116.798) * (-1115.011) (-1114.947) [-1113.823] (-1113.740) -- 0:00:49
221500 -- (-1114.404) (-1115.182) (-1114.807) [-1114.776] * [-1113.593] (-1120.369) (-1115.412) (-1114.539) -- 0:00:49
222000 -- (-1116.422) (-1115.288) [-1113.490] (-1116.524) * (-1114.359) (-1114.696) (-1115.406) [-1114.977] -- 0:00:49
222500 -- (-1115.120) (-1118.403) (-1117.167) [-1115.110] * (-1113.464) [-1114.202] (-1114.419) (-1113.761) -- 0:00:48
223000 -- [-1116.176] (-1113.753) (-1116.315) (-1113.651) * (-1116.083) (-1115.795) (-1114.692) [-1115.234] -- 0:00:48
223500 -- (-1115.811) (-1117.643) [-1113.378] (-1114.802) * [-1114.248] (-1115.171) (-1113.907) (-1117.150) -- 0:00:48
224000 -- (-1114.987) (-1115.050) (-1114.596) [-1118.747] * (-1113.690) (-1115.565) [-1113.801] (-1115.571) -- 0:00:48
224500 -- (-1114.597) (-1113.879) [-1115.473] (-1118.232) * [-1116.246] (-1117.552) (-1113.934) (-1116.662) -- 0:00:48
225000 -- (-1116.272) (-1115.921) (-1117.059) [-1118.551] * [-1114.722] (-1116.929) (-1115.441) (-1119.320) -- 0:00:48
Average standard deviation of split frequencies: 0.014601
225500 -- [-1116.748] (-1119.077) (-1114.837) (-1114.816) * (-1114.384) (-1115.394) [-1116.333] (-1117.269) -- 0:00:48
226000 -- (-1116.101) (-1117.767) [-1115.075] (-1114.671) * (-1114.818) (-1118.608) [-1115.434] (-1117.693) -- 0:00:47
226500 -- (-1116.345) (-1120.727) [-1115.953] (-1114.175) * (-1123.236) (-1114.587) [-1115.827] (-1113.972) -- 0:00:47
227000 -- (-1114.100) (-1115.444) (-1115.638) [-1115.421] * (-1115.688) (-1115.527) [-1116.568] (-1115.448) -- 0:00:47
227500 -- (-1117.000) (-1115.200) (-1115.229) [-1115.191] * [-1115.111] (-1113.857) (-1116.635) (-1115.590) -- 0:00:47
228000 -- (-1115.741) (-1121.631) (-1114.266) [-1115.882] * (-1114.791) [-1113.628] (-1115.426) (-1115.438) -- 0:00:47
228500 -- (-1116.497) (-1117.651) (-1114.969) [-1116.541] * (-1114.555) (-1118.110) (-1114.269) [-1113.541] -- 0:00:47
229000 -- [-1114.205] (-1114.529) (-1114.645) (-1118.345) * (-1116.236) (-1114.776) [-1114.556] (-1114.690) -- 0:00:47
229500 -- (-1116.477) (-1115.016) [-1114.760] (-1116.789) * (-1114.643) (-1116.297) (-1113.772) [-1113.314] -- 0:00:47
230000 -- [-1117.173] (-1113.524) (-1114.097) (-1115.037) * (-1115.037) (-1113.551) [-1115.576] (-1113.217) -- 0:00:46
Average standard deviation of split frequencies: 0.016349
230500 -- [-1117.284] (-1117.388) (-1114.185) (-1117.162) * (-1113.627) (-1114.354) [-1113.714] (-1113.217) -- 0:00:46
231000 -- (-1115.113) (-1117.756) [-1113.648] (-1114.874) * (-1115.762) [-1114.561] (-1115.058) (-1115.560) -- 0:00:49
231500 -- [-1114.996] (-1114.998) (-1114.860) (-1115.548) * (-1120.115) [-1116.134] (-1117.059) (-1115.449) -- 0:00:49
232000 -- [-1114.572] (-1115.324) (-1114.762) (-1119.906) * (-1119.687) [-1115.713] (-1116.842) (-1113.819) -- 0:00:49
232500 -- (-1114.834) (-1116.286) (-1115.036) [-1115.922] * (-1115.934) [-1115.309] (-1114.994) (-1114.525) -- 0:00:49
233000 -- (-1113.366) (-1117.527) [-1116.465] (-1121.597) * [-1114.869] (-1116.829) (-1113.979) (-1116.665) -- 0:00:49
233500 -- (-1117.963) [-1116.853] (-1115.019) (-1121.301) * (-1117.002) [-1113.762] (-1114.774) (-1118.836) -- 0:00:49
234000 -- (-1116.603) [-1115.801] (-1114.161) (-1117.077) * (-1117.650) (-1115.349) [-1114.494] (-1119.330) -- 0:00:49
234500 -- (-1115.534) [-1119.028] (-1116.515) (-1114.567) * (-1119.658) (-1117.385) (-1116.657) [-1115.476] -- 0:00:48
235000 -- (-1117.198) [-1115.173] (-1116.854) (-1113.960) * (-1118.654) (-1116.666) [-1115.351] (-1116.376) -- 0:00:48
Average standard deviation of split frequencies: 0.016080
235500 -- [-1115.830] (-1114.657) (-1116.525) (-1114.088) * (-1117.299) (-1120.454) [-1118.357] (-1115.767) -- 0:00:48
236000 -- [-1113.656] (-1114.875) (-1116.410) (-1113.521) * (-1115.730) [-1114.136] (-1114.665) (-1115.238) -- 0:00:48
236500 -- (-1115.511) (-1115.310) (-1116.028) [-1114.835] * [-1113.827] (-1114.984) (-1113.693) (-1116.483) -- 0:00:48
237000 -- (-1119.765) [-1117.462] (-1117.135) (-1117.181) * (-1114.793) [-1114.389] (-1115.395) (-1115.769) -- 0:00:48
237500 -- (-1119.260) (-1117.398) [-1114.034] (-1117.011) * (-1115.725) [-1115.481] (-1123.980) (-1117.726) -- 0:00:48
238000 -- (-1118.831) (-1117.758) [-1113.249] (-1114.817) * (-1114.928) [-1116.834] (-1115.547) (-1116.601) -- 0:00:48
238500 -- (-1120.318) (-1117.236) [-1113.334] (-1115.552) * (-1114.394) [-1116.061] (-1120.197) (-1116.581) -- 0:00:47
239000 -- (-1122.158) (-1115.545) (-1115.511) [-1115.327] * [-1116.013] (-1116.360) (-1120.721) (-1113.985) -- 0:00:47
239500 -- (-1115.091) [-1115.246] (-1113.805) (-1114.458) * (-1120.269) [-1123.684] (-1117.655) (-1115.976) -- 0:00:47
240000 -- [-1115.496] (-1115.186) (-1114.445) (-1115.101) * (-1117.398) (-1115.459) [-1116.189] (-1121.494) -- 0:00:47
Average standard deviation of split frequencies: 0.015979
240500 -- (-1116.769) [-1117.184] (-1115.171) (-1115.850) * (-1117.613) (-1116.903) (-1116.955) [-1119.219] -- 0:00:47
241000 -- (-1113.567) [-1114.598] (-1114.364) (-1115.686) * (-1113.941) (-1114.058) [-1114.747] (-1115.448) -- 0:00:47
241500 -- (-1113.567) (-1116.070) [-1116.160] (-1115.823) * (-1116.454) (-1114.983) (-1116.357) [-1115.293] -- 0:00:47
242000 -- (-1113.467) (-1116.880) [-1115.976] (-1115.758) * [-1114.642] (-1114.445) (-1116.280) (-1115.850) -- 0:00:46
242500 -- [-1116.537] (-1114.206) (-1119.247) (-1115.358) * (-1113.528) (-1114.041) [-1116.362] (-1113.976) -- 0:00:46
243000 -- [-1114.527] (-1115.883) (-1114.675) (-1113.212) * (-1117.671) (-1113.371) [-1116.358] (-1114.346) -- 0:00:46
243500 -- [-1114.019] (-1116.198) (-1116.509) (-1115.454) * [-1119.247] (-1115.186) (-1115.870) (-1120.813) -- 0:00:46
244000 -- (-1115.645) (-1114.122) (-1115.609) [-1114.445] * (-1118.534) [-1114.997] (-1116.254) (-1115.074) -- 0:00:46
244500 -- (-1122.749) (-1114.153) (-1122.035) [-1114.424] * (-1124.227) [-1117.049] (-1120.161) (-1113.831) -- 0:00:46
245000 -- (-1115.546) [-1119.704] (-1120.023) (-1117.933) * (-1116.282) (-1116.534) (-1117.096) [-1114.270] -- 0:00:46
Average standard deviation of split frequencies: 0.017151
245500 -- (-1115.020) (-1121.126) (-1114.539) [-1116.488] * (-1116.855) (-1117.554) [-1114.276] (-1113.591) -- 0:00:46
246000 -- (-1115.118) [-1116.861] (-1114.664) (-1120.090) * [-1115.168] (-1117.827) (-1116.110) (-1113.598) -- 0:00:45
246500 -- (-1115.486) [-1115.545] (-1117.931) (-1115.578) * [-1115.154] (-1116.679) (-1115.571) (-1114.187) -- 0:00:45
247000 -- (-1115.757) (-1120.903) (-1119.066) [-1119.098] * [-1117.992] (-1115.383) (-1116.057) (-1115.055) -- 0:00:48
247500 -- (-1115.444) (-1115.716) [-1117.018] (-1119.696) * (-1117.958) (-1116.640) [-1114.773] (-1114.279) -- 0:00:48
248000 -- (-1114.874) [-1117.378] (-1116.048) (-1117.521) * (-1114.502) [-1117.081] (-1115.184) (-1115.293) -- 0:00:48
248500 -- [-1115.879] (-1118.586) (-1113.953) (-1117.321) * [-1113.789] (-1118.999) (-1113.922) (-1113.516) -- 0:00:48
249000 -- [-1114.872] (-1116.966) (-1114.714) (-1115.513) * [-1113.554] (-1119.248) (-1115.652) (-1113.528) -- 0:00:48
249500 -- [-1116.348] (-1115.346) (-1114.302) (-1114.971) * (-1116.217) (-1116.255) (-1114.660) [-1115.752] -- 0:00:48
250000 -- (-1115.644) [-1117.056] (-1117.341) (-1118.322) * (-1119.317) [-1114.556] (-1116.581) (-1120.613) -- 0:00:48
Average standard deviation of split frequencies: 0.016478
250500 -- [-1115.740] (-1115.203) (-1115.905) (-1115.358) * (-1117.000) (-1114.599) [-1114.896] (-1117.043) -- 0:00:47
251000 -- (-1118.268) [-1115.171] (-1115.702) (-1115.707) * (-1116.965) (-1118.074) (-1118.142) [-1116.207] -- 0:00:47
251500 -- [-1115.069] (-1114.712) (-1116.198) (-1115.084) * (-1114.094) (-1117.732) (-1118.502) [-1114.106] -- 0:00:47
252000 -- (-1115.322) (-1114.628) (-1115.687) [-1114.154] * (-1116.272) (-1115.526) [-1115.355] (-1114.471) -- 0:00:47
252500 -- (-1117.642) (-1117.031) [-1115.706] (-1116.018) * (-1115.742) (-1122.657) [-1115.964] (-1117.025) -- 0:00:47
253000 -- [-1115.392] (-1116.541) (-1117.503) (-1115.979) * (-1115.420) (-1116.296) [-1114.557] (-1117.697) -- 0:00:47
253500 -- [-1115.667] (-1117.614) (-1116.937) (-1115.558) * (-1116.856) (-1117.610) [-1115.530] (-1116.762) -- 0:00:47
254000 -- (-1114.986) (-1115.313) (-1114.853) [-1114.250] * (-1115.219) (-1115.039) (-1116.160) [-1115.398] -- 0:00:46
254500 -- [-1115.984] (-1116.818) (-1117.261) (-1115.501) * (-1115.504) [-1113.678] (-1114.658) (-1114.156) -- 0:00:46
255000 -- (-1114.627) (-1116.852) (-1114.005) [-1117.345] * (-1114.625) [-1113.709] (-1114.277) (-1117.715) -- 0:00:46
Average standard deviation of split frequencies: 0.015192
255500 -- [-1113.551] (-1117.444) (-1114.622) (-1119.789) * (-1115.761) (-1114.503) [-1114.507] (-1114.817) -- 0:00:46
256000 -- [-1117.113] (-1116.801) (-1115.485) (-1115.542) * (-1116.857) [-1114.459] (-1116.380) (-1116.594) -- 0:00:46
256500 -- [-1113.623] (-1115.687) (-1114.805) (-1115.956) * (-1115.985) (-1114.063) (-1114.840) [-1115.314] -- 0:00:46
257000 -- (-1113.716) (-1116.652) (-1113.866) [-1117.009] * (-1116.591) (-1114.755) (-1117.050) [-1114.239] -- 0:00:46
257500 -- (-1114.952) (-1116.276) [-1114.095] (-1114.949) * (-1118.005) (-1115.655) (-1118.344) [-1115.339] -- 0:00:46
258000 -- (-1119.985) (-1122.715) [-1114.262] (-1113.823) * (-1115.523) (-1116.556) [-1115.337] (-1115.628) -- 0:00:46
258500 -- (-1114.311) (-1119.844) (-1116.704) [-1114.346] * [-1117.065] (-1114.120) (-1115.231) (-1115.303) -- 0:00:45
259000 -- (-1115.488) (-1120.185) (-1113.822) [-1114.277] * (-1116.269) (-1115.526) [-1114.044] (-1114.556) -- 0:00:45
259500 -- (-1115.848) (-1119.602) (-1113.816) [-1114.118] * [-1114.291] (-1114.283) (-1115.536) (-1114.415) -- 0:00:45
260000 -- (-1115.120) (-1118.667) (-1116.321) [-1115.082] * (-1116.705) (-1115.362) [-1115.199] (-1114.843) -- 0:00:45
Average standard deviation of split frequencies: 0.014558
260500 -- (-1119.104) (-1117.447) [-1115.514] (-1116.608) * (-1116.394) [-1114.746] (-1118.472) (-1115.082) -- 0:00:45
261000 -- [-1115.698] (-1116.997) (-1116.729) (-1114.878) * (-1122.520) (-1114.063) [-1114.891] (-1120.004) -- 0:00:45
261500 -- (-1118.375) (-1117.569) (-1116.612) [-1115.273] * (-1116.944) (-1114.540) [-1118.761] (-1118.770) -- 0:00:45
262000 -- (-1117.110) (-1115.830) (-1119.023) [-1116.118] * (-1113.895) (-1114.623) [-1115.955] (-1117.650) -- 0:00:45
262500 -- (-1117.707) (-1114.860) [-1115.693] (-1119.568) * (-1113.820) [-1114.326] (-1114.711) (-1114.008) -- 0:00:44
263000 -- (-1118.534) (-1114.058) (-1116.011) [-1115.510] * [-1115.775] (-1114.705) (-1115.689) (-1115.268) -- 0:00:44
263500 -- (-1115.448) [-1114.158] (-1113.975) (-1117.636) * [-1113.993] (-1114.250) (-1115.497) (-1115.297) -- 0:00:47
264000 -- (-1113.862) (-1115.242) (-1114.415) [-1116.558] * [-1113.993] (-1116.102) (-1114.486) (-1115.619) -- 0:00:47
264500 -- (-1113.751) (-1115.453) [-1116.975] (-1115.843) * (-1114.310) (-1114.033) (-1117.183) [-1114.170] -- 0:00:47
265000 -- [-1113.869] (-1118.483) (-1114.377) (-1118.922) * (-1116.797) [-1117.462] (-1116.133) (-1114.334) -- 0:00:47
Average standard deviation of split frequencies: 0.014355
265500 -- [-1113.962] (-1119.283) (-1117.661) (-1119.429) * (-1116.931) (-1117.628) [-1117.754] (-1115.840) -- 0:00:47
266000 -- (-1116.921) (-1116.956) [-1117.289] (-1116.545) * (-1114.065) [-1117.934] (-1116.361) (-1113.863) -- 0:00:46
266500 -- (-1116.160) (-1119.323) (-1115.291) [-1116.071] * (-1114.095) [-1114.721] (-1115.255) (-1114.998) -- 0:00:46
267000 -- (-1114.959) [-1116.918] (-1116.294) (-1116.435) * [-1117.714] (-1116.312) (-1116.802) (-1114.053) -- 0:00:46
267500 -- [-1115.045] (-1119.068) (-1116.813) (-1114.246) * (-1120.550) (-1115.417) (-1118.719) [-1113.674] -- 0:00:46
268000 -- (-1117.408) (-1118.036) [-1118.568] (-1114.638) * (-1118.055) [-1115.459] (-1118.059) (-1114.991) -- 0:00:46
268500 -- (-1114.599) (-1116.248) [-1115.908] (-1117.323) * (-1115.504) [-1118.319] (-1113.800) (-1116.301) -- 0:00:46
269000 -- [-1114.136] (-1115.358) (-1120.173) (-1116.586) * [-1115.835] (-1115.682) (-1115.567) (-1115.458) -- 0:00:46
269500 -- (-1113.721) (-1116.131) [-1118.241] (-1115.587) * (-1114.362) (-1115.482) (-1116.104) [-1114.525] -- 0:00:46
270000 -- [-1114.032] (-1113.405) (-1114.330) (-1117.759) * (-1114.602) (-1117.308) [-1114.331] (-1114.564) -- 0:00:45
Average standard deviation of split frequencies: 0.013850
270500 -- (-1115.116) [-1114.267] (-1113.846) (-1113.826) * (-1115.347) (-1114.085) [-1115.806] (-1117.832) -- 0:00:45
271000 -- (-1114.972) (-1114.284) [-1113.919] (-1114.329) * [-1114.113] (-1115.400) (-1118.640) (-1114.114) -- 0:00:45
271500 -- (-1115.413) (-1114.799) (-1114.284) [-1114.219] * (-1115.501) [-1117.951] (-1116.608) (-1113.682) -- 0:00:45
272000 -- (-1118.410) (-1116.280) [-1113.606] (-1114.159) * (-1118.995) [-1114.294] (-1115.899) (-1114.065) -- 0:00:45
272500 -- (-1117.643) (-1113.871) (-1115.743) [-1117.819] * [-1115.428] (-1115.072) (-1115.294) (-1114.359) -- 0:00:45
273000 -- (-1114.971) (-1116.603) [-1115.743] (-1117.079) * [-1114.757] (-1115.782) (-1115.078) (-1114.371) -- 0:00:45
273500 -- (-1116.240) [-1114.913] (-1117.287) (-1117.897) * [-1115.715] (-1116.990) (-1120.635) (-1117.309) -- 0:00:45
274000 -- (-1115.559) [-1113.824] (-1116.846) (-1118.190) * (-1115.559) (-1115.522) (-1115.386) [-1113.839] -- 0:00:45
274500 -- (-1115.017) (-1114.215) (-1115.329) [-1117.308] * (-1116.548) [-1115.098] (-1114.637) (-1116.621) -- 0:00:44
275000 -- (-1113.961) [-1114.645] (-1113.497) (-1116.983) * [-1116.094] (-1117.387) (-1114.704) (-1120.885) -- 0:00:44
Average standard deviation of split frequencies: 0.014396
275500 -- (-1113.595) (-1117.535) [-1113.468] (-1116.492) * (-1115.311) [-1115.392] (-1114.076) (-1118.966) -- 0:00:44
276000 -- (-1113.963) (-1115.596) [-1114.399] (-1118.629) * [-1116.323] (-1114.249) (-1114.134) (-1121.742) -- 0:00:44
276500 -- (-1117.167) (-1114.254) (-1114.044) [-1117.054] * (-1116.801) (-1115.138) (-1114.216) [-1117.124] -- 0:00:44
277000 -- (-1116.375) (-1115.431) [-1119.229] (-1117.907) * (-1116.550) (-1117.693) (-1114.145) [-1115.320] -- 0:00:44
277500 -- (-1117.160) (-1116.735) [-1116.131] (-1114.617) * (-1116.200) (-1114.030) (-1113.948) [-1116.410] -- 0:00:44
278000 -- (-1118.658) (-1114.058) (-1114.891) [-1117.735] * [-1115.433] (-1114.384) (-1114.927) (-1116.567) -- 0:00:44
278500 -- [-1115.011] (-1114.596) (-1118.735) (-1115.523) * (-1115.505) (-1116.041) (-1115.754) [-1114.984] -- 0:00:44
279000 -- (-1116.199) (-1114.303) (-1120.507) [-1116.158] * (-1114.863) (-1116.392) (-1116.989) [-1117.530] -- 0:00:43
279500 -- (-1114.959) (-1114.186) (-1116.285) [-1115.798] * (-1114.176) (-1114.251) (-1116.547) [-1117.828] -- 0:00:46
280000 -- (-1115.674) (-1116.445) (-1114.822) [-1115.185] * (-1120.451) [-1114.181] (-1115.467) (-1114.599) -- 0:00:46
Average standard deviation of split frequencies: 0.014811
280500 -- (-1114.991) (-1119.212) (-1114.788) [-1115.652] * (-1117.644) [-1113.376] (-1116.473) (-1113.669) -- 0:00:46
281000 -- (-1114.445) (-1118.030) (-1116.025) [-1115.867] * (-1116.822) (-1114.794) (-1114.245) [-1115.081] -- 0:00:46
281500 -- (-1116.834) [-1115.389] (-1114.618) (-1117.524) * (-1119.993) (-1113.733) (-1114.186) [-1115.979] -- 0:00:45
282000 -- (-1114.345) (-1118.723) [-1114.358] (-1115.679) * (-1114.149) [-1114.031] (-1114.531) (-1117.068) -- 0:00:45
282500 -- (-1114.232) [-1115.436] (-1114.367) (-1117.427) * [-1115.372] (-1118.223) (-1115.151) (-1118.870) -- 0:00:45
283000 -- [-1115.043] (-1115.354) (-1114.833) (-1116.209) * (-1116.942) (-1116.288) [-1114.447] (-1118.910) -- 0:00:45
283500 -- [-1115.732] (-1115.675) (-1116.408) (-1115.907) * (-1116.328) (-1116.159) [-1113.844] (-1115.854) -- 0:00:45
284000 -- (-1114.068) (-1119.065) [-1114.830] (-1116.792) * (-1116.596) (-1119.963) [-1117.088] (-1114.312) -- 0:00:45
284500 -- [-1113.906] (-1113.783) (-1116.332) (-1115.257) * (-1115.177) [-1116.778] (-1119.317) (-1114.215) -- 0:00:45
285000 -- (-1115.167) (-1113.592) (-1118.241) [-1114.611] * (-1116.085) [-1115.831] (-1119.560) (-1114.812) -- 0:00:45
Average standard deviation of split frequencies: 0.014759
285500 -- (-1116.082) (-1113.942) (-1115.436) [-1116.235] * (-1117.225) (-1118.592) (-1113.827) [-1114.929] -- 0:00:45
286000 -- (-1122.963) (-1114.573) [-1113.937] (-1115.552) * [-1113.937] (-1120.330) (-1118.320) (-1115.581) -- 0:00:44
286500 -- (-1118.126) (-1114.104) [-1116.023] (-1121.389) * (-1114.532) (-1114.005) [-1116.719] (-1116.793) -- 0:00:44
287000 -- (-1117.258) (-1118.413) [-1116.791] (-1117.687) * [-1114.487] (-1114.029) (-1115.927) (-1115.948) -- 0:00:44
287500 -- (-1117.409) (-1113.887) [-1114.515] (-1117.305) * [-1114.056] (-1116.112) (-1117.797) (-1115.801) -- 0:00:44
288000 -- (-1114.357) (-1118.060) [-1115.159] (-1115.265) * (-1113.797) (-1114.928) [-1121.138] (-1120.501) -- 0:00:44
288500 -- [-1115.103] (-1121.140) (-1117.323) (-1116.490) * [-1114.479] (-1114.866) (-1118.234) (-1119.504) -- 0:00:44
289000 -- (-1115.472) (-1116.852) [-1116.551] (-1115.010) * (-1114.479) [-1114.698] (-1119.544) (-1119.187) -- 0:00:44
289500 -- [-1113.467] (-1114.815) (-1113.713) (-1116.314) * (-1115.271) (-1116.447) (-1116.599) [-1115.386] -- 0:00:44
290000 -- (-1114.330) (-1117.453) [-1113.270] (-1114.447) * [-1114.285] (-1115.939) (-1117.042) (-1121.141) -- 0:00:44
Average standard deviation of split frequencies: 0.014817
290500 -- (-1115.401) (-1116.271) [-1114.581] (-1116.347) * [-1115.274] (-1115.943) (-1116.822) (-1118.943) -- 0:00:43
291000 -- (-1118.338) (-1115.769) [-1113.821] (-1116.557) * (-1114.794) [-1114.363] (-1119.546) (-1118.764) -- 0:00:43
291500 -- (-1119.057) (-1113.310) [-1114.143] (-1114.414) * (-1113.907) [-1114.296] (-1118.598) (-1118.020) -- 0:00:43
292000 -- (-1115.203) [-1114.038] (-1114.960) (-1115.866) * (-1114.588) (-1117.246) [-1116.799] (-1113.794) -- 0:00:43
292500 -- (-1116.296) [-1114.113] (-1116.760) (-1114.679) * [-1114.208] (-1119.825) (-1113.822) (-1113.537) -- 0:00:43
293000 -- (-1114.786) (-1115.068) [-1115.993] (-1114.414) * (-1115.666) (-1116.834) (-1114.812) [-1116.851] -- 0:00:43
293500 -- (-1114.862) [-1114.603] (-1117.771) (-1114.391) * (-1115.483) (-1117.368) [-1115.152] (-1114.137) -- 0:00:43
294000 -- [-1115.067] (-1115.288) (-1114.852) (-1114.653) * (-1115.976) (-1118.506) [-1116.782] (-1114.102) -- 0:00:43
294500 -- (-1114.904) (-1118.478) [-1118.505] (-1116.451) * (-1118.686) [-1114.254] (-1119.406) (-1113.986) -- 0:00:43
295000 -- (-1117.833) (-1113.336) [-1114.635] (-1118.426) * (-1115.314) (-1114.277) [-1117.778] (-1113.843) -- 0:00:43
Average standard deviation of split frequencies: 0.014094
295500 -- (-1116.685) (-1114.191) [-1114.406] (-1117.891) * (-1115.080) (-1114.565) [-1114.537] (-1118.070) -- 0:00:42
296000 -- (-1115.813) (-1115.682) (-1116.044) [-1116.453] * (-1115.153) (-1114.724) (-1118.282) [-1114.705] -- 0:00:45
296500 -- [-1116.049] (-1114.653) (-1119.149) (-1113.629) * (-1116.583) (-1115.111) (-1116.068) [-1115.924] -- 0:00:45
297000 -- (-1118.738) (-1115.580) (-1115.652) [-1114.230] * (-1115.868) [-1114.695] (-1115.895) (-1116.227) -- 0:00:44
297500 -- [-1114.581] (-1115.550) (-1116.107) (-1115.530) * (-1115.976) [-1117.756] (-1116.904) (-1115.483) -- 0:00:44
298000 -- (-1117.141) (-1116.054) (-1115.499) [-1114.949] * (-1115.820) [-1114.081] (-1114.674) (-1117.997) -- 0:00:44
298500 -- [-1117.567] (-1114.904) (-1117.476) (-1116.206) * (-1119.019) [-1116.721] (-1119.420) (-1115.477) -- 0:00:44
299000 -- (-1118.512) (-1114.987) [-1115.935] (-1119.226) * (-1115.675) [-1116.983] (-1119.211) (-1121.014) -- 0:00:44
299500 -- (-1118.482) (-1114.809) [-1116.327] (-1116.061) * (-1114.997) (-1119.494) [-1116.689] (-1118.298) -- 0:00:44
300000 -- (-1115.636) [-1115.063] (-1119.928) (-1115.122) * (-1117.175) (-1115.595) [-1121.973] (-1118.533) -- 0:00:44
Average standard deviation of split frequencies: 0.014346
300500 -- (-1114.214) (-1117.348) [-1114.391] (-1118.247) * (-1116.601) [-1115.912] (-1115.740) (-1118.315) -- 0:00:44
301000 -- (-1114.712) (-1118.243) [-1115.506] (-1117.810) * [-1115.841] (-1116.924) (-1114.369) (-1121.210) -- 0:00:44
301500 -- (-1117.380) (-1115.566) (-1113.825) [-1117.301] * (-1117.677) (-1114.979) (-1114.923) [-1115.208] -- 0:00:44
302000 -- (-1117.644) (-1117.460) (-1118.728) [-1114.867] * (-1117.727) [-1118.211] (-1114.690) (-1115.691) -- 0:00:43
302500 -- [-1116.299] (-1114.206) (-1116.559) (-1114.670) * (-1116.261) (-1117.707) [-1116.890] (-1114.733) -- 0:00:43
303000 -- (-1119.527) (-1119.408) [-1114.433] (-1114.696) * [-1114.963] (-1114.655) (-1114.981) (-1116.717) -- 0:00:43
303500 -- (-1117.120) (-1116.815) [-1113.821] (-1121.733) * (-1115.565) (-1114.053) (-1114.514) [-1116.220] -- 0:00:43
304000 -- [-1114.269] (-1116.705) (-1113.777) (-1117.001) * (-1113.715) (-1114.467) [-1114.514] (-1115.511) -- 0:00:43
304500 -- (-1115.732) [-1114.896] (-1113.777) (-1119.654) * [-1114.587] (-1117.671) (-1115.250) (-1113.753) -- 0:00:43
305000 -- (-1114.798) [-1115.418] (-1114.801) (-1118.335) * (-1113.690) (-1119.053) [-1115.253] (-1114.306) -- 0:00:43
Average standard deviation of split frequencies: 0.014915
305500 -- [-1114.631] (-1116.929) (-1114.425) (-1120.049) * (-1114.833) (-1117.196) [-1116.246] (-1115.804) -- 0:00:43
306000 -- (-1117.161) (-1118.024) (-1115.882) [-1117.800] * [-1114.577] (-1116.006) (-1115.756) (-1115.041) -- 0:00:43
306500 -- (-1116.703) [-1117.275] (-1118.076) (-1115.054) * (-1115.659) (-1115.435) [-1116.580] (-1116.671) -- 0:00:42
307000 -- (-1116.132) (-1119.037) [-1118.205] (-1119.630) * (-1115.061) (-1117.270) (-1114.980) [-1116.302] -- 0:00:42
307500 -- (-1116.456) (-1118.447) [-1117.280] (-1117.655) * (-1113.632) [-1116.759] (-1115.385) (-1115.022) -- 0:00:42
308000 -- (-1117.775) (-1116.848) [-1114.240] (-1116.136) * (-1115.208) (-1115.423) (-1113.985) [-1124.580] -- 0:00:42
308500 -- (-1113.556) [-1113.997] (-1115.426) (-1113.378) * (-1116.123) (-1114.411) [-1113.507] (-1121.853) -- 0:00:42
309000 -- (-1113.303) [-1114.561] (-1117.637) (-1114.314) * [-1113.394] (-1114.614) (-1119.049) (-1114.204) -- 0:00:42
309500 -- (-1113.599) [-1115.218] (-1116.312) (-1116.367) * (-1116.337) (-1114.886) (-1122.422) [-1114.652] -- 0:00:42
310000 -- (-1114.069) (-1114.066) [-1116.181] (-1115.587) * (-1119.090) (-1115.312) (-1114.809) [-1116.320] -- 0:00:42
Average standard deviation of split frequencies: 0.014484
310500 -- (-1114.072) (-1115.125) [-1115.026] (-1115.865) * (-1116.095) [-1117.558] (-1119.225) (-1118.715) -- 0:00:42
311000 -- (-1114.253) (-1117.918) (-1120.077) [-1117.072] * (-1115.562) [-1119.869] (-1116.384) (-1120.103) -- 0:00:42
311500 -- [-1113.915] (-1115.787) (-1116.141) (-1116.622) * (-1115.322) [-1118.408] (-1117.140) (-1116.198) -- 0:00:41
312000 -- [-1113.840] (-1113.555) (-1115.610) (-1114.135) * [-1115.515] (-1117.262) (-1113.890) (-1115.375) -- 0:00:44
312500 -- (-1115.116) [-1113.993] (-1119.144) (-1113.625) * (-1116.885) (-1116.860) [-1114.477] (-1113.365) -- 0:00:44
313000 -- [-1115.220] (-1115.318) (-1116.097) (-1116.435) * (-1114.590) (-1118.748) [-1114.146] (-1113.550) -- 0:00:43
313500 -- (-1115.195) (-1116.036) (-1117.380) [-1116.778] * (-1115.944) (-1118.047) (-1116.012) [-1115.560] -- 0:00:43
314000 -- (-1114.056) (-1115.017) [-1116.135] (-1113.413) * (-1117.432) (-1116.766) (-1117.284) [-1115.172] -- 0:00:43
314500 -- (-1113.939) (-1114.789) (-1118.434) [-1114.229] * (-1117.687) (-1115.092) [-1116.153] (-1114.851) -- 0:00:43
315000 -- [-1116.565] (-1113.713) (-1117.138) (-1118.141) * (-1116.420) [-1114.774] (-1120.155) (-1115.939) -- 0:00:43
Average standard deviation of split frequencies: 0.014714
315500 -- (-1119.007) (-1118.583) [-1115.255] (-1115.940) * [-1116.916] (-1114.754) (-1116.397) (-1115.941) -- 0:00:43
316000 -- (-1116.952) (-1116.759) (-1113.956) [-1115.188] * (-1115.666) (-1114.786) [-1113.824] (-1116.987) -- 0:00:43
316500 -- (-1113.794) (-1117.883) (-1114.068) [-1114.896] * (-1117.778) [-1116.088] (-1116.033) (-1114.727) -- 0:00:43
317000 -- [-1113.752] (-1119.158) (-1115.065) (-1115.176) * (-1115.104) (-1116.678) [-1115.878] (-1115.051) -- 0:00:43
317500 -- (-1117.654) [-1116.412] (-1114.671) (-1121.149) * [-1114.597] (-1118.547) (-1115.065) (-1114.461) -- 0:00:42
318000 -- [-1118.361] (-1113.705) (-1114.740) (-1116.917) * (-1115.992) (-1117.965) [-1115.991] (-1115.227) -- 0:00:42
318500 -- (-1116.873) (-1118.219) (-1116.914) [-1118.159] * (-1115.588) [-1115.281] (-1117.384) (-1115.224) -- 0:00:42
319000 -- (-1116.060) [-1115.353] (-1117.270) (-1115.854) * (-1116.857) (-1115.832) [-1114.238] (-1116.272) -- 0:00:42
319500 -- [-1116.237] (-1114.669) (-1113.826) (-1116.542) * (-1115.472) (-1115.440) (-1116.079) [-1114.904] -- 0:00:42
320000 -- [-1118.042] (-1115.497) (-1114.957) (-1116.000) * [-1115.774] (-1118.362) (-1115.915) (-1116.608) -- 0:00:42
Average standard deviation of split frequencies: 0.014701
320500 -- [-1116.905] (-1114.250) (-1118.274) (-1121.409) * (-1115.990) (-1116.085) (-1115.726) [-1116.608] -- 0:00:42
321000 -- [-1115.923] (-1115.381) (-1115.698) (-1114.998) * [-1115.232] (-1114.682) (-1113.773) (-1114.804) -- 0:00:42
321500 -- (-1117.173) (-1114.441) (-1117.041) [-1116.238] * (-1115.078) (-1114.903) [-1114.534] (-1113.570) -- 0:00:42
322000 -- (-1120.183) (-1114.427) (-1117.669) [-1114.740] * (-1114.440) (-1114.792) [-1116.234] (-1117.300) -- 0:00:42
322500 -- (-1113.611) [-1114.263] (-1117.158) (-1115.796) * (-1119.396) (-1117.179) (-1116.276) [-1115.915] -- 0:00:42
323000 -- (-1113.910) [-1116.032] (-1115.370) (-1115.622) * [-1114.227] (-1116.689) (-1116.081) (-1115.171) -- 0:00:41
323500 -- [-1115.373] (-1117.825) (-1117.611) (-1118.966) * (-1115.092) [-1117.666] (-1113.196) (-1114.605) -- 0:00:41
324000 -- (-1117.289) (-1117.783) [-1114.340] (-1115.887) * [-1113.404] (-1114.479) (-1114.134) (-1114.915) -- 0:00:41
324500 -- [-1114.656] (-1114.855) (-1115.507) (-1117.381) * (-1119.307) (-1115.358) [-1116.026] (-1117.454) -- 0:00:41
325000 -- (-1117.524) (-1114.855) (-1116.134) [-1115.533] * (-1121.762) (-1119.688) (-1115.802) [-1115.148] -- 0:00:41
Average standard deviation of split frequencies: 0.014712
325500 -- [-1115.905] (-1113.792) (-1114.293) (-1117.671) * (-1115.562) (-1116.450) (-1118.059) [-1114.472] -- 0:00:41
326000 -- (-1114.796) [-1115.932] (-1114.585) (-1120.311) * (-1114.807) (-1115.070) (-1113.565) [-1115.754] -- 0:00:41
326500 -- (-1115.322) [-1116.929] (-1116.819) (-1121.071) * [-1114.774] (-1114.693) (-1114.042) (-1114.495) -- 0:00:41
327000 -- [-1116.332] (-1117.862) (-1114.279) (-1115.029) * (-1116.414) (-1114.971) [-1114.151] (-1114.411) -- 0:00:41
327500 -- (-1118.886) [-1117.751] (-1113.587) (-1114.925) * (-1118.343) (-1115.094) (-1114.782) [-1120.180] -- 0:00:41
328000 -- (-1117.578) (-1119.135) [-1114.041] (-1114.391) * [-1120.869] (-1113.928) (-1113.225) (-1118.170) -- 0:00:40
328500 -- (-1117.678) [-1116.297] (-1114.082) (-1115.055) * (-1118.942) (-1115.989) [-1113.552] (-1115.331) -- 0:00:42
329000 -- (-1117.648) [-1113.908] (-1114.909) (-1115.114) * [-1115.351] (-1120.734) (-1116.260) (-1114.524) -- 0:00:42
329500 -- (-1114.639) (-1114.013) (-1115.797) [-1119.622] * [-1116.431] (-1120.612) (-1114.492) (-1114.531) -- 0:00:42
330000 -- (-1118.070) [-1115.251] (-1115.394) (-1114.566) * (-1113.720) (-1115.489) (-1114.680) [-1115.131] -- 0:00:42
Average standard deviation of split frequencies: 0.013985
330500 -- (-1115.629) (-1114.810) [-1114.221] (-1114.377) * (-1113.662) (-1116.301) (-1116.797) [-1118.234] -- 0:00:42
331000 -- [-1115.970] (-1119.036) (-1115.287) (-1114.282) * [-1114.345] (-1114.479) (-1118.506) (-1120.800) -- 0:00:42
331500 -- (-1115.497) (-1116.141) [-1116.166] (-1118.164) * (-1116.831) [-1114.991] (-1119.498) (-1115.857) -- 0:00:42
332000 -- (-1118.419) (-1119.035) [-1116.529] (-1116.039) * (-1114.846) (-1113.790) [-1114.705] (-1116.179) -- 0:00:42
332500 -- [-1115.274] (-1117.295) (-1117.035) (-1121.350) * (-1114.107) [-1114.469] (-1116.896) (-1115.900) -- 0:00:42
333000 -- (-1116.357) (-1118.164) (-1117.863) [-1116.052] * (-1113.996) [-1115.574] (-1117.995) (-1121.296) -- 0:00:42
333500 -- (-1114.927) (-1115.073) (-1123.414) [-1115.846] * (-1114.668) [-1115.422] (-1113.582) (-1115.500) -- 0:00:41
334000 -- (-1115.164) [-1116.737] (-1117.453) (-1117.122) * (-1119.550) [-1113.379] (-1115.597) (-1114.988) -- 0:00:41
334500 -- (-1113.730) [-1115.476] (-1120.310) (-1114.662) * [-1116.846] (-1113.327) (-1115.859) (-1115.973) -- 0:00:41
335000 -- (-1113.840) (-1114.631) [-1115.023] (-1116.311) * [-1114.617] (-1119.654) (-1114.451) (-1114.877) -- 0:00:41
Average standard deviation of split frequencies: 0.013399
335500 -- (-1113.849) (-1115.511) (-1115.412) [-1117.062] * (-1114.881) (-1120.134) (-1114.330) [-1115.430] -- 0:00:41
336000 -- (-1119.898) (-1116.462) (-1114.927) [-1113.733] * [-1113.724] (-1117.234) (-1115.330) (-1114.717) -- 0:00:41
336500 -- (-1115.161) (-1116.821) [-1113.240] (-1117.831) * (-1115.182) (-1116.425) (-1113.682) [-1114.873] -- 0:00:41
337000 -- [-1114.153] (-1117.968) (-1113.653) (-1115.576) * (-1117.751) (-1117.791) (-1117.396) [-1118.086] -- 0:00:41
337500 -- (-1115.705) [-1116.621] (-1114.180) (-1114.288) * (-1113.977) (-1118.100) [-1115.215] (-1114.987) -- 0:00:41
338000 -- [-1115.303] (-1120.138) (-1113.435) (-1114.743) * [-1114.677] (-1117.589) (-1116.714) (-1117.837) -- 0:00:41
338500 -- (-1118.830) [-1116.871] (-1113.412) (-1120.309) * (-1115.303) (-1116.241) [-1114.281] (-1114.811) -- 0:00:41
339000 -- (-1115.315) (-1116.211) [-1114.400] (-1115.105) * (-1114.026) (-1114.059) [-1115.157] (-1114.924) -- 0:00:40
339500 -- (-1117.997) [-1120.823] (-1114.085) (-1116.797) * (-1114.713) (-1114.434) (-1115.263) [-1118.466] -- 0:00:40
340000 -- [-1115.766] (-1118.915) (-1114.326) (-1117.015) * [-1116.996] (-1114.423) (-1115.227) (-1119.523) -- 0:00:40
Average standard deviation of split frequencies: 0.013255
340500 -- (-1115.136) (-1119.170) [-1114.744] (-1116.472) * (-1114.747) [-1115.508] (-1116.858) (-1116.828) -- 0:00:40
341000 -- (-1116.672) [-1117.963] (-1113.860) (-1118.588) * (-1115.682) [-1119.194] (-1118.551) (-1118.318) -- 0:00:40
341500 -- (-1117.078) (-1115.846) (-1114.355) [-1115.030] * (-1114.424) [-1116.499] (-1115.819) (-1116.948) -- 0:00:40
342000 -- (-1118.120) (-1116.683) [-1113.939] (-1117.140) * (-1115.188) (-1115.783) [-1116.317] (-1114.926) -- 0:00:40
342500 -- (-1117.352) (-1116.609) (-1116.326) [-1117.145] * [-1117.020] (-1114.817) (-1115.735) (-1115.618) -- 0:00:40
343000 -- [-1116.921] (-1116.179) (-1115.869) (-1118.111) * (-1117.991) [-1115.424] (-1115.987) (-1116.531) -- 0:00:40
343500 -- [-1113.461] (-1117.418) (-1116.264) (-1116.263) * (-1116.447) (-1114.717) (-1116.968) [-1116.082] -- 0:00:40
344000 -- (-1115.094) (-1117.614) (-1116.024) [-1117.474] * [-1119.276] (-1113.661) (-1116.042) (-1117.656) -- 0:00:40
344500 -- (-1115.857) [-1114.997] (-1114.272) (-1116.322) * (-1113.901) (-1118.245) [-1114.772] (-1115.366) -- 0:00:39
345000 -- (-1115.069) (-1117.173) (-1115.703) [-1116.261] * (-1114.566) [-1115.001] (-1114.246) (-1116.635) -- 0:00:41
Average standard deviation of split frequencies: 0.013352
345500 -- (-1116.045) (-1115.283) [-1114.664] (-1115.107) * (-1116.060) [-1115.126] (-1114.246) (-1118.075) -- 0:00:41
346000 -- [-1114.926] (-1115.694) (-1120.018) (-1114.186) * [-1117.937] (-1115.090) (-1114.712) (-1119.718) -- 0:00:41
346500 -- [-1114.957] (-1119.419) (-1114.767) (-1117.011) * (-1117.937) (-1116.006) (-1115.558) [-1114.784] -- 0:00:41
347000 -- [-1115.318] (-1119.113) (-1116.135) (-1115.508) * (-1116.606) [-1114.502] (-1119.872) (-1114.440) -- 0:00:41
347500 -- (-1117.434) (-1116.794) [-1114.170] (-1113.996) * (-1115.330) (-1115.190) (-1115.781) [-1114.269] -- 0:00:41
348000 -- (-1115.122) (-1117.782) (-1114.865) [-1115.026] * (-1114.061) [-1114.976] (-1115.700) (-1114.830) -- 0:00:41
348500 -- (-1118.450) [-1114.277] (-1115.832) (-1117.817) * (-1114.017) (-1118.004) (-1113.872) [-1117.297] -- 0:00:41
349000 -- (-1114.486) (-1116.592) (-1116.762) [-1116.895] * (-1115.627) (-1116.571) (-1113.478) [-1119.423] -- 0:00:41
349500 -- [-1114.347] (-1114.676) (-1117.385) (-1115.911) * (-1117.149) (-1115.874) (-1115.883) [-1113.989] -- 0:00:40
350000 -- (-1117.105) (-1114.655) (-1115.431) [-1116.295] * (-1117.988) (-1113.674) [-1116.383] (-1114.630) -- 0:00:40
Average standard deviation of split frequencies: 0.013107
350500 -- (-1116.883) (-1114.141) [-1114.406] (-1119.945) * [-1113.662] (-1113.463) (-1116.216) (-1114.432) -- 0:00:40
351000 -- (-1116.379) (-1114.662) [-1117.884] (-1121.289) * (-1115.056) (-1113.703) (-1116.602) [-1118.189] -- 0:00:40
351500 -- (-1115.670) (-1119.751) (-1120.518) [-1117.090] * (-1116.642) (-1113.523) [-1118.900] (-1117.717) -- 0:00:40
352000 -- (-1116.540) (-1115.601) [-1116.260] (-1114.838) * (-1115.249) [-1114.710] (-1118.517) (-1117.600) -- 0:00:40
352500 -- (-1117.845) (-1117.149) [-1117.031] (-1115.792) * (-1117.125) (-1115.559) [-1116.934] (-1118.635) -- 0:00:40
353000 -- (-1116.396) [-1113.227] (-1114.155) (-1117.779) * (-1114.857) [-1115.820] (-1115.202) (-1115.472) -- 0:00:40
353500 -- (-1115.599) [-1114.783] (-1114.129) (-1118.462) * [-1116.342] (-1117.079) (-1114.365) (-1115.664) -- 0:00:40
354000 -- (-1115.291) (-1115.347) [-1113.997] (-1115.924) * (-1114.584) (-1115.832) (-1114.433) [-1113.938] -- 0:00:40
354500 -- (-1115.742) (-1118.387) (-1115.442) [-1116.863] * (-1114.131) [-1117.467] (-1115.896) (-1114.068) -- 0:00:40
355000 -- (-1118.286) [-1117.695] (-1115.379) (-1117.389) * (-1114.405) (-1115.791) (-1121.242) [-1114.550] -- 0:00:39
Average standard deviation of split frequencies: 0.012712
355500 -- [-1115.424] (-1116.667) (-1115.320) (-1118.614) * (-1113.727) [-1113.788] (-1120.096) (-1115.101) -- 0:00:39
356000 -- (-1117.644) [-1115.781] (-1116.132) (-1116.273) * [-1114.054] (-1114.291) (-1114.935) (-1117.185) -- 0:00:39
356500 -- (-1116.082) (-1119.085) [-1117.608] (-1116.504) * [-1114.124] (-1114.387) (-1115.209) (-1118.528) -- 0:00:39
357000 -- (-1115.161) (-1114.269) (-1117.851) [-1116.753] * (-1114.751) (-1113.702) (-1116.718) [-1114.394] -- 0:00:39
357500 -- (-1116.369) (-1114.111) (-1117.349) [-1116.453] * (-1114.637) (-1113.413) (-1113.638) [-1115.025] -- 0:00:39
358000 -- [-1117.522] (-1114.889) (-1114.152) (-1116.179) * [-1115.337] (-1114.282) (-1114.490) (-1114.583) -- 0:00:39
358500 -- (-1116.221) (-1116.060) [-1114.654] (-1118.492) * [-1115.016] (-1115.685) (-1115.039) (-1115.540) -- 0:00:39
359000 -- [-1115.288] (-1116.917) (-1113.584) (-1116.832) * (-1117.482) (-1116.356) (-1115.760) [-1113.377] -- 0:00:39
359500 -- (-1115.840) (-1116.353) (-1115.456) [-1116.918] * [-1116.208] (-1114.277) (-1116.408) (-1113.824) -- 0:00:39
360000 -- (-1117.510) [-1114.111] (-1114.052) (-1116.407) * (-1114.950) (-1113.864) [-1114.131] (-1116.828) -- 0:00:39
Average standard deviation of split frequencies: 0.012245
360500 -- (-1115.599) [-1118.956] (-1118.334) (-1113.992) * [-1116.841] (-1118.139) (-1116.821) (-1117.465) -- 0:00:39
361000 -- (-1121.598) (-1119.188) [-1118.790] (-1114.230) * [-1116.580] (-1116.049) (-1114.984) (-1117.456) -- 0:00:38
361500 -- [-1115.598] (-1118.596) (-1117.037) (-1114.978) * [-1118.500] (-1116.288) (-1116.806) (-1116.554) -- 0:00:40
362000 -- (-1115.934) (-1114.446) [-1115.683] (-1115.550) * (-1120.094) [-1113.329] (-1118.836) (-1122.446) -- 0:00:40
362500 -- (-1118.468) (-1114.988) [-1118.081] (-1115.339) * (-1117.968) (-1115.644) [-1115.374] (-1118.620) -- 0:00:40
363000 -- [-1119.966] (-1115.067) (-1119.602) (-1114.367) * (-1115.158) (-1114.477) (-1116.919) [-1118.553] -- 0:00:40
363500 -- (-1114.987) (-1116.510) [-1118.244] (-1115.870) * (-1113.551) (-1114.244) (-1114.955) [-1114.103] -- 0:00:40
364000 -- (-1117.417) (-1119.298) [-1116.102] (-1115.700) * (-1116.638) [-1113.803] (-1116.861) (-1113.875) -- 0:00:40
364500 -- [-1114.652] (-1113.895) (-1116.411) (-1116.403) * (-1113.685) [-1117.192] (-1114.985) (-1113.974) -- 0:00:40
365000 -- (-1114.336) (-1114.923) [-1116.480] (-1116.603) * (-1120.794) [-1117.134] (-1116.332) (-1114.002) -- 0:00:40
Average standard deviation of split frequencies: 0.013371
365500 -- (-1113.336) (-1115.109) (-1116.633) [-1114.805] * [-1115.865] (-1114.246) (-1116.531) (-1116.912) -- 0:00:39
366000 -- (-1115.779) [-1113.797] (-1116.992) (-1115.051) * (-1117.551) [-1114.315] (-1114.642) (-1114.943) -- 0:00:39
366500 -- (-1117.125) (-1114.123) (-1115.841) [-1115.366] * (-1114.837) [-1117.282] (-1118.177) (-1115.550) -- 0:00:39
367000 -- (-1118.432) [-1119.538] (-1115.453) (-1116.563) * (-1114.662) (-1115.277) [-1116.345] (-1115.146) -- 0:00:39
367500 -- (-1116.351) (-1115.652) (-1116.896) [-1113.907] * [-1114.238] (-1116.686) (-1114.386) (-1115.304) -- 0:00:39
368000 -- [-1114.564] (-1115.848) (-1116.621) (-1115.522) * (-1115.639) (-1114.885) (-1114.571) [-1116.371] -- 0:00:39
368500 -- [-1115.431] (-1115.573) (-1117.497) (-1114.606) * (-1118.105) [-1115.650] (-1120.064) (-1116.371) -- 0:00:39
369000 -- (-1119.196) (-1115.883) (-1116.809) [-1113.443] * [-1115.774] (-1117.976) (-1118.679) (-1114.940) -- 0:00:39
369500 -- (-1117.833) (-1118.824) (-1116.040) [-1115.767] * (-1117.614) (-1115.213) (-1120.390) [-1113.677] -- 0:00:39
370000 -- (-1116.486) (-1115.298) (-1117.417) [-1117.206] * (-1114.242) (-1115.035) (-1119.299) [-1114.245] -- 0:00:39
Average standard deviation of split frequencies: 0.011587
370500 -- (-1116.153) [-1114.089] (-1115.315) (-1119.178) * (-1114.386) (-1117.024) [-1116.977] (-1115.777) -- 0:00:39
371000 -- (-1114.182) (-1117.138) (-1120.666) [-1119.140] * (-1114.674) (-1114.855) (-1114.687) [-1113.669] -- 0:00:38
371500 -- (-1114.781) (-1118.726) [-1117.247] (-1113.880) * (-1119.166) (-1116.197) [-1114.730] (-1118.932) -- 0:00:38
372000 -- [-1115.632] (-1116.906) (-1118.768) (-1114.042) * (-1117.309) (-1116.383) (-1114.216) [-1115.242] -- 0:00:38
372500 -- (-1114.647) (-1114.222) (-1116.424) [-1116.137] * (-1114.769) (-1117.605) (-1115.117) [-1115.543] -- 0:00:38
373000 -- (-1115.707) [-1113.698] (-1115.141) (-1115.411) * (-1114.995) (-1117.679) [-1115.370] (-1114.310) -- 0:00:38
373500 -- (-1116.599) (-1118.709) (-1113.521) [-1116.056] * (-1117.563) (-1117.306) [-1116.271] (-1116.319) -- 0:00:38
374000 -- (-1115.824) [-1120.234] (-1115.101) (-1115.350) * (-1116.462) (-1114.471) (-1114.353) [-1113.512] -- 0:00:38
374500 -- [-1115.789] (-1118.405) (-1114.603) (-1115.146) * (-1113.894) (-1114.489) (-1115.277) [-1116.257] -- 0:00:38
375000 -- (-1114.626) [-1114.037] (-1115.291) (-1115.043) * (-1113.677) (-1115.386) [-1114.951] (-1119.149) -- 0:00:38
Average standard deviation of split frequencies: 0.012259
375500 -- (-1115.999) (-1114.816) (-1115.084) [-1122.009] * (-1115.660) (-1115.629) [-1114.179] (-1115.563) -- 0:00:38
376000 -- (-1116.782) [-1115.518] (-1117.967) (-1115.111) * [-1113.239] (-1115.441) (-1114.434) (-1114.710) -- 0:00:38
376500 -- (-1115.470) (-1118.009) (-1121.357) [-1115.450] * (-1114.034) [-1117.991] (-1115.630) (-1117.022) -- 0:00:39
377000 -- (-1114.277) (-1117.161) [-1114.780] (-1118.278) * (-1115.178) (-1115.868) (-1115.663) [-1114.380] -- 0:00:39
377500 -- (-1114.181) (-1117.079) (-1117.938) [-1115.617] * (-1114.090) (-1114.469) (-1119.071) [-1118.333] -- 0:00:39
378000 -- [-1120.686] (-1114.914) (-1113.705) (-1117.754) * [-1113.809] (-1114.825) (-1114.348) (-1117.011) -- 0:00:39
378500 -- (-1114.762) [-1115.287] (-1113.388) (-1118.656) * (-1115.705) [-1114.428] (-1118.019) (-1115.307) -- 0:00:39
379000 -- (-1114.537) (-1115.613) (-1115.861) [-1114.919] * [-1115.178] (-1114.932) (-1116.614) (-1114.869) -- 0:00:39
379500 -- (-1114.675) (-1115.029) (-1114.615) [-1114.970] * [-1114.213] (-1120.011) (-1115.520) (-1116.439) -- 0:00:39
380000 -- (-1115.686) (-1114.762) [-1115.423] (-1115.667) * [-1115.197] (-1118.160) (-1116.160) (-1115.486) -- 0:00:39
Average standard deviation of split frequencies: 0.011489
380500 -- (-1117.830) (-1115.384) [-1113.434] (-1113.871) * (-1114.164) (-1116.957) [-1115.595] (-1115.896) -- 0:00:39
381000 -- (-1115.948) [-1116.223] (-1116.465) (-1115.821) * (-1115.484) (-1116.958) [-1116.406] (-1117.352) -- 0:00:38
381500 -- [-1116.351] (-1114.717) (-1116.070) (-1115.200) * (-1114.130) (-1116.066) [-1116.119] (-1113.617) -- 0:00:38
382000 -- (-1116.353) (-1114.139) (-1115.838) [-1114.700] * [-1116.018] (-1116.268) (-1114.695) (-1117.165) -- 0:00:38
382500 -- (-1121.004) (-1118.878) (-1116.628) [-1114.431] * (-1113.863) (-1117.397) [-1117.156] (-1114.878) -- 0:00:38
383000 -- (-1117.368) [-1122.928] (-1113.712) (-1114.471) * (-1116.899) (-1113.703) [-1113.695] (-1114.119) -- 0:00:38
383500 -- (-1117.989) (-1115.790) (-1115.554) [-1116.533] * (-1117.110) [-1115.131] (-1114.659) (-1113.271) -- 0:00:38
384000 -- (-1115.470) (-1116.309) (-1113.589) [-1116.482] * (-1113.936) (-1115.354) (-1115.654) [-1115.299] -- 0:00:38
384500 -- (-1119.864) [-1116.513] (-1114.316) (-1114.894) * (-1114.425) [-1113.939] (-1118.638) (-1117.052) -- 0:00:38
385000 -- (-1115.851) (-1119.316) [-1114.853] (-1115.837) * [-1113.630] (-1114.368) (-1118.242) (-1114.438) -- 0:00:38
Average standard deviation of split frequencies: 0.010381
385500 -- (-1116.457) (-1116.885) [-1114.599] (-1114.111) * (-1113.601) [-1115.912] (-1118.380) (-1114.931) -- 0:00:38
386000 -- (-1115.607) [-1116.021] (-1115.296) (-1114.021) * (-1114.778) [-1113.932] (-1115.282) (-1117.386) -- 0:00:38
386500 -- (-1117.758) [-1117.568] (-1113.470) (-1114.503) * (-1115.192) (-1114.489) (-1118.337) [-1115.583] -- 0:00:38
387000 -- [-1115.086] (-1116.431) (-1113.697) (-1115.702) * (-1117.941) (-1114.489) (-1115.651) [-1116.398] -- 0:00:38
387500 -- (-1114.881) [-1114.445] (-1117.177) (-1115.740) * [-1114.201] (-1114.192) (-1114.762) (-1113.411) -- 0:00:37
388000 -- (-1114.903) (-1114.847) (-1114.092) [-1117.103] * (-1116.000) [-1116.932] (-1117.126) (-1114.427) -- 0:00:37
388500 -- [-1115.741] (-1119.641) (-1116.213) (-1115.784) * (-1113.566) [-1114.645] (-1114.741) (-1113.773) -- 0:00:37
389000 -- [-1113.471] (-1115.439) (-1118.250) (-1114.047) * (-1114.039) (-1113.932) [-1116.316] (-1115.005) -- 0:00:37
389500 -- (-1115.394) (-1116.334) (-1119.193) [-1113.967] * (-1113.834) (-1115.994) [-1114.374] (-1115.532) -- 0:00:37
390000 -- [-1115.144] (-1114.005) (-1119.386) (-1116.138) * (-1116.170) (-1115.926) [-1113.741] (-1115.256) -- 0:00:37
Average standard deviation of split frequencies: 0.009854
390500 -- [-1118.938] (-1121.386) (-1118.249) (-1115.599) * [-1114.712] (-1116.058) (-1114.250) (-1117.264) -- 0:00:37
391000 -- [-1114.223] (-1116.862) (-1118.049) (-1115.124) * (-1116.679) [-1114.402] (-1116.104) (-1115.072) -- 0:00:37
391500 -- (-1115.786) [-1116.995] (-1116.301) (-1117.108) * [-1115.178] (-1114.390) (-1114.303) (-1115.844) -- 0:00:37
392000 -- (-1117.162) (-1115.823) (-1120.265) [-1118.795] * (-1113.892) [-1113.785] (-1116.247) (-1118.540) -- 0:00:37
392500 -- (-1114.687) (-1116.375) (-1115.378) [-1114.775] * (-1115.119) [-1113.698] (-1115.610) (-1114.121) -- 0:00:37
393000 -- [-1114.190] (-1116.769) (-1115.023) (-1116.918) * (-1114.128) (-1114.085) (-1115.452) [-1115.059] -- 0:00:38
393500 -- [-1113.596] (-1116.590) (-1115.219) (-1116.200) * (-1117.800) [-1115.503] (-1114.977) (-1115.570) -- 0:00:38
394000 -- [-1113.755] (-1114.575) (-1115.776) (-1113.411) * [-1113.537] (-1119.050) (-1120.000) (-1114.095) -- 0:00:38
394500 -- (-1116.444) [-1117.229] (-1115.030) (-1113.858) * [-1114.605] (-1116.862) (-1116.226) (-1116.110) -- 0:00:38
395000 -- (-1116.472) (-1115.554) [-1117.514] (-1113.848) * (-1117.105) [-1114.810] (-1114.501) (-1115.019) -- 0:00:38
Average standard deviation of split frequencies: 0.009259
395500 -- (-1116.876) [-1113.698] (-1116.885) (-1114.126) * (-1114.400) (-1116.374) (-1114.450) [-1115.061] -- 0:00:38
396000 -- (-1116.648) (-1116.149) [-1118.129] (-1114.117) * (-1113.647) [-1117.484] (-1117.007) (-1116.738) -- 0:00:38
396500 -- (-1115.581) (-1118.232) (-1118.938) [-1115.202] * (-1113.606) [-1114.731] (-1123.750) (-1115.433) -- 0:00:38
397000 -- [-1116.482] (-1118.565) (-1118.641) (-1114.704) * [-1113.785] (-1115.247) (-1117.039) (-1116.889) -- 0:00:37
397500 -- (-1116.637) (-1114.505) (-1116.710) [-1117.809] * (-1114.396) [-1115.206] (-1118.500) (-1114.864) -- 0:00:37
398000 -- (-1117.452) (-1115.087) (-1115.313) [-1115.295] * [-1114.037] (-1117.024) (-1115.305) (-1119.257) -- 0:00:37
398500 -- (-1114.546) (-1115.060) [-1115.683] (-1117.752) * (-1116.089) [-1115.901] (-1114.926) (-1117.352) -- 0:00:37
399000 -- (-1118.644) [-1114.253] (-1118.533) (-1114.921) * (-1113.326) [-1117.477] (-1118.917) (-1119.189) -- 0:00:37
399500 -- (-1114.305) [-1115.422] (-1115.669) (-1114.463) * [-1116.317] (-1118.479) (-1116.433) (-1113.323) -- 0:00:37
400000 -- (-1115.426) [-1113.735] (-1115.981) (-1114.704) * [-1115.527] (-1119.017) (-1116.191) (-1115.738) -- 0:00:37
Average standard deviation of split frequencies: 0.009739
400500 -- (-1119.212) [-1113.520] (-1115.414) (-1114.552) * (-1115.861) (-1114.005) (-1114.407) [-1117.456] -- 0:00:37
401000 -- (-1117.226) (-1115.802) [-1116.600] (-1115.249) * (-1115.607) (-1117.572) [-1115.033] (-1118.769) -- 0:00:37
401500 -- [-1114.587] (-1115.412) (-1115.251) (-1120.892) * (-1115.600) (-1115.596) (-1118.216) [-1117.939] -- 0:00:37
402000 -- (-1113.840) (-1115.395) (-1115.783) [-1121.568] * [-1115.399] (-1113.543) (-1120.233) (-1116.029) -- 0:00:37
402500 -- (-1117.709) [-1115.164] (-1115.904) (-1116.356) * (-1116.958) [-1114.394] (-1113.859) (-1117.919) -- 0:00:37
403000 -- (-1118.072) (-1119.485) [-1117.067] (-1117.172) * (-1114.442) [-1120.135] (-1116.182) (-1114.596) -- 0:00:37
403500 -- (-1123.110) (-1116.092) [-1116.687] (-1114.998) * (-1117.375) [-1114.616] (-1114.233) (-1117.334) -- 0:00:36
404000 -- (-1114.205) (-1116.801) (-1114.651) [-1117.958] * [-1117.052] (-1116.452) (-1113.868) (-1117.641) -- 0:00:36
404500 -- (-1117.702) (-1117.170) (-1115.616) [-1118.774] * [-1117.169] (-1117.112) (-1115.439) (-1114.977) -- 0:00:36
405000 -- (-1120.561) [-1116.083] (-1117.153) (-1114.457) * (-1117.672) (-1116.376) [-1115.331] (-1114.764) -- 0:00:36
Average standard deviation of split frequencies: 0.010192
405500 -- (-1116.954) (-1115.218) (-1116.645) [-1117.663] * (-1113.617) (-1115.756) (-1118.693) [-1113.958] -- 0:00:36
406000 -- (-1115.134) (-1115.895) (-1120.597) [-1117.007] * (-1116.048) (-1116.089) (-1114.592) [-1115.346] -- 0:00:36
406500 -- (-1114.323) (-1116.128) (-1118.561) [-1114.415] * [-1114.150] (-1117.728) (-1114.144) (-1115.026) -- 0:00:36
407000 -- (-1117.041) (-1114.412) [-1116.670] (-1114.757) * (-1115.005) [-1117.110] (-1114.453) (-1114.204) -- 0:00:36
407500 -- (-1116.562) (-1115.590) [-1117.525] (-1114.366) * (-1116.714) (-1119.421) [-1113.516] (-1117.481) -- 0:00:36
408000 -- (-1116.375) [-1119.366] (-1119.633) (-1114.980) * (-1116.260) (-1114.522) (-1116.965) [-1115.731] -- 0:00:36
408500 -- (-1119.415) (-1116.158) (-1116.123) [-1115.539] * (-1117.837) (-1116.094) (-1116.629) [-1115.884] -- 0:00:36
409000 -- [-1115.358] (-1118.054) (-1114.962) (-1115.393) * (-1115.417) (-1116.854) (-1118.697) [-1114.394] -- 0:00:37
409500 -- (-1114.847) (-1117.762) (-1115.131) [-1114.196] * (-1114.962) (-1115.763) [-1116.434] (-1116.625) -- 0:00:37
410000 -- (-1118.181) (-1116.736) (-1114.919) [-1114.227] * [-1114.721] (-1116.435) (-1114.907) (-1115.620) -- 0:00:37
Average standard deviation of split frequencies: 0.009630
410500 -- [-1115.655] (-1117.599) (-1117.234) (-1116.266) * [-1113.873] (-1117.067) (-1121.204) (-1115.793) -- 0:00:37
411000 -- (-1114.716) (-1115.033) [-1115.187] (-1113.941) * (-1117.582) (-1115.473) [-1119.016] (-1116.195) -- 0:00:37
411500 -- (-1115.336) (-1118.816) (-1115.019) [-1115.268] * (-1115.584) (-1119.670) [-1114.356] (-1115.287) -- 0:00:37
412000 -- [-1115.314] (-1118.742) (-1114.045) (-1116.344) * (-1118.658) [-1118.829] (-1116.481) (-1115.049) -- 0:00:37
412500 -- (-1113.691) (-1114.918) [-1115.604] (-1120.470) * (-1113.826) [-1117.864] (-1119.655) (-1118.033) -- 0:00:37
413000 -- (-1115.653) [-1113.761] (-1115.764) (-1115.486) * (-1113.266) (-1117.649) (-1116.890) [-1116.385] -- 0:00:36
413500 -- (-1115.746) [-1115.637] (-1114.969) (-1117.331) * [-1118.632] (-1122.126) (-1117.679) (-1117.128) -- 0:00:36
414000 -- [-1115.829] (-1117.440) (-1113.887) (-1116.310) * [-1114.693] (-1115.257) (-1118.195) (-1115.024) -- 0:00:36
414500 -- [-1118.886] (-1116.744) (-1113.888) (-1115.486) * (-1115.284) [-1115.492] (-1115.320) (-1114.705) -- 0:00:36
415000 -- (-1115.202) [-1115.629] (-1114.760) (-1115.551) * (-1114.630) (-1121.924) (-1117.032) [-1113.515] -- 0:00:36
Average standard deviation of split frequencies: 0.009569
415500 -- (-1114.434) (-1116.483) [-1113.726] (-1116.123) * (-1115.461) [-1117.037] (-1116.709) (-1113.926) -- 0:00:36
416000 -- [-1114.870] (-1117.796) (-1114.828) (-1116.842) * (-1113.492) (-1120.834) (-1117.449) [-1113.813] -- 0:00:36
416500 -- (-1115.925) (-1117.764) (-1114.842) [-1121.216] * (-1113.974) [-1119.477] (-1115.462) (-1116.132) -- 0:00:36
417000 -- [-1114.829] (-1116.043) (-1114.354) (-1115.081) * [-1113.815] (-1114.717) (-1116.849) (-1114.893) -- 0:00:36
417500 -- (-1115.709) (-1114.178) (-1114.275) [-1116.992] * (-1117.060) [-1115.247] (-1122.301) (-1115.873) -- 0:00:36
418000 -- [-1118.378] (-1118.521) (-1114.128) (-1115.602) * (-1117.607) (-1115.353) (-1114.290) [-1118.962] -- 0:00:36
418500 -- [-1114.324] (-1114.374) (-1116.489) (-1116.225) * (-1116.070) (-1115.033) (-1114.393) [-1114.974] -- 0:00:36
419000 -- (-1114.363) (-1113.749) (-1114.550) [-1114.216] * (-1114.953) (-1116.526) (-1113.847) [-1115.375] -- 0:00:36
419500 -- (-1116.615) [-1113.518] (-1116.874) (-1113.311) * [-1116.009] (-1115.617) (-1118.104) (-1115.426) -- 0:00:35
420000 -- [-1115.499] (-1113.504) (-1115.473) (-1115.276) * [-1113.501] (-1117.224) (-1120.745) (-1114.960) -- 0:00:35
Average standard deviation of split frequencies: 0.010027
420500 -- (-1115.512) (-1116.666) [-1117.223] (-1114.262) * (-1115.943) [-1115.473] (-1114.956) (-1116.160) -- 0:00:35
421000 -- (-1114.578) (-1118.552) [-1116.539] (-1117.602) * (-1114.361) [-1115.641] (-1115.035) (-1115.906) -- 0:00:35
421500 -- [-1116.070] (-1121.491) (-1114.151) (-1119.269) * (-1115.073) (-1113.723) (-1118.456) [-1114.748] -- 0:00:35
422000 -- (-1115.391) (-1118.181) [-1117.451] (-1118.912) * (-1114.111) [-1115.362] (-1114.192) (-1114.445) -- 0:00:35
422500 -- (-1114.755) (-1117.420) [-1116.232] (-1117.554) * (-1115.722) (-1115.742) [-1113.996] (-1114.437) -- 0:00:35
423000 -- (-1114.723) (-1115.290) [-1116.341] (-1115.058) * (-1113.994) [-1116.985] (-1114.254) (-1114.442) -- 0:00:35
423500 -- (-1114.655) (-1118.658) [-1114.169] (-1114.167) * [-1115.215] (-1116.651) (-1118.742) (-1115.807) -- 0:00:35
424000 -- (-1115.344) [-1114.372] (-1114.941) (-1114.766) * (-1114.421) (-1114.289) [-1116.670] (-1115.259) -- 0:00:35
424500 -- (-1116.757) (-1117.789) (-1115.591) [-1114.206] * (-1116.103) [-1114.643] (-1114.810) (-1116.514) -- 0:00:35
425000 -- (-1114.595) (-1117.809) (-1115.546) [-1117.028] * (-1116.510) (-1115.183) (-1114.799) [-1114.736] -- 0:00:35
Average standard deviation of split frequencies: 0.009610
425500 -- (-1115.343) [-1115.461] (-1117.902) (-1115.626) * (-1115.553) (-1114.430) [-1114.007] (-1119.162) -- 0:00:36
426000 -- (-1116.340) (-1118.093) [-1115.009] (-1115.345) * (-1115.628) [-1116.654] (-1114.243) (-1116.750) -- 0:00:36
426500 -- [-1116.079] (-1116.497) (-1114.164) (-1115.266) * (-1115.309) [-1114.485] (-1113.644) (-1115.147) -- 0:00:36
427000 -- (-1118.953) (-1116.181) [-1113.757] (-1118.367) * [-1115.062] (-1114.749) (-1118.575) (-1113.575) -- 0:00:36
427500 -- (-1113.669) (-1114.537) (-1114.629) [-1117.430] * (-1114.349) (-1114.597) (-1114.941) [-1113.583] -- 0:00:36
428000 -- (-1119.335) [-1115.291] (-1116.442) (-1122.887) * (-1119.897) (-1114.448) [-1115.730] (-1119.002) -- 0:00:36
428500 -- (-1115.133) [-1114.605] (-1113.620) (-1117.948) * [-1116.456] (-1115.688) (-1114.936) (-1114.310) -- 0:00:36
429000 -- [-1116.554] (-1115.717) (-1114.827) (-1117.795) * (-1114.514) [-1114.911] (-1117.068) (-1120.457) -- 0:00:35
429500 -- (-1114.854) [-1116.004] (-1114.416) (-1115.542) * [-1114.624] (-1118.340) (-1117.639) (-1115.998) -- 0:00:35
430000 -- (-1115.821) (-1115.300) [-1113.634] (-1113.855) * (-1114.624) (-1118.994) [-1117.617] (-1115.488) -- 0:00:35
Average standard deviation of split frequencies: 0.009608
430500 -- (-1119.100) (-1116.922) [-1113.642] (-1116.364) * (-1117.126) [-1115.018] (-1117.534) (-1119.332) -- 0:00:35
431000 -- (-1116.191) [-1115.523] (-1114.720) (-1115.255) * (-1114.888) (-1116.381) (-1115.023) [-1115.058] -- 0:00:35
431500 -- (-1115.251) (-1113.717) [-1115.420] (-1113.888) * [-1115.611] (-1118.605) (-1114.189) (-1113.817) -- 0:00:35
432000 -- (-1116.822) [-1114.899] (-1118.304) (-1113.979) * (-1115.019) [-1114.910] (-1119.363) (-1115.448) -- 0:00:35
432500 -- (-1116.410) (-1121.434) (-1114.659) [-1114.390] * (-1118.048) (-1117.177) (-1114.114) [-1115.278] -- 0:00:35
433000 -- (-1113.833) [-1114.678] (-1118.739) (-1114.493) * (-1115.456) (-1118.970) (-1113.274) [-1115.632] -- 0:00:35
433500 -- (-1115.745) (-1114.773) (-1115.452) [-1114.582] * (-1119.213) (-1117.178) [-1113.274] (-1116.492) -- 0:00:35
434000 -- (-1114.915) (-1115.600) (-1114.979) [-1115.019] * (-1117.740) (-1117.386) (-1113.915) [-1115.985] -- 0:00:35
434500 -- [-1114.737] (-1119.168) (-1114.143) (-1118.707) * (-1116.485) (-1117.608) (-1116.832) [-1115.516] -- 0:00:35
435000 -- [-1119.036] (-1115.901) (-1116.372) (-1114.928) * (-1117.296) (-1117.380) [-1115.362] (-1114.846) -- 0:00:35
Average standard deviation of split frequencies: 0.009310
435500 -- (-1119.927) (-1115.407) [-1114.107] (-1119.622) * (-1116.635) (-1120.024) [-1116.466] (-1116.062) -- 0:00:34
436000 -- (-1114.293) (-1115.773) [-1116.042] (-1117.458) * (-1115.655) [-1116.349] (-1116.182) (-1114.210) -- 0:00:34
436500 -- (-1113.922) [-1117.251] (-1118.013) (-1118.924) * (-1117.360) [-1114.780] (-1116.177) (-1114.471) -- 0:00:34
437000 -- (-1116.884) [-1115.361] (-1122.071) (-1114.220) * (-1119.519) (-1113.939) [-1115.244] (-1114.877) -- 0:00:34
437500 -- [-1114.512] (-1116.974) (-1119.715) (-1114.222) * [-1119.083] (-1118.591) (-1114.430) (-1114.169) -- 0:00:34
438000 -- (-1117.847) (-1116.489) [-1118.174] (-1114.691) * [-1116.299] (-1119.907) (-1116.273) (-1114.124) -- 0:00:34
438500 -- (-1117.195) [-1114.806] (-1113.341) (-1115.360) * (-1113.709) [-1115.605] (-1115.417) (-1114.072) -- 0:00:34
439000 -- (-1114.869) [-1115.090] (-1114.042) (-1113.831) * (-1114.457) [-1114.779] (-1119.070) (-1114.478) -- 0:00:34
439500 -- (-1115.683) (-1116.742) [-1113.479] (-1115.021) * (-1115.398) (-1115.031) (-1113.710) [-1114.271] -- 0:00:34
440000 -- (-1114.146) (-1119.459) (-1113.997) [-1116.387] * (-1116.235) (-1115.300) (-1113.838) [-1114.241] -- 0:00:34
Average standard deviation of split frequencies: 0.009390
440500 -- (-1118.045) [-1118.450] (-1119.756) (-1113.823) * (-1114.125) [-1116.120] (-1115.790) (-1117.784) -- 0:00:34
441000 -- (-1120.268) (-1119.052) (-1117.225) [-1116.190] * (-1114.764) (-1117.576) (-1119.058) [-1114.651] -- 0:00:34
441500 -- (-1119.696) (-1113.779) (-1114.728) [-1116.170] * (-1113.794) [-1115.930] (-1118.258) (-1114.967) -- 0:00:35
442000 -- (-1117.129) [-1114.358] (-1116.233) (-1114.059) * [-1113.690] (-1119.692) (-1115.195) (-1114.617) -- 0:00:35
442500 -- (-1113.823) [-1114.328] (-1115.119) (-1115.853) * (-1114.554) [-1118.446] (-1117.191) (-1114.849) -- 0:00:35
443000 -- (-1115.145) (-1114.554) (-1116.443) [-1114.189] * [-1114.738] (-1117.163) (-1113.898) (-1114.021) -- 0:00:35
443500 -- (-1113.852) (-1113.549) (-1121.036) [-1114.082] * (-1114.924) (-1121.281) [-1113.951] (-1114.049) -- 0:00:35
444000 -- (-1116.282) [-1114.545] (-1115.715) (-1117.706) * [-1115.048] (-1114.578) (-1114.604) (-1114.314) -- 0:00:35
444500 -- (-1114.147) (-1115.678) [-1115.715] (-1114.996) * (-1116.980) [-1113.856] (-1114.841) (-1120.396) -- 0:00:34
445000 -- (-1117.871) (-1113.371) [-1115.754] (-1115.267) * [-1115.992] (-1117.991) (-1115.604) (-1114.578) -- 0:00:34
Average standard deviation of split frequencies: 0.010159
445500 -- (-1115.366) (-1114.277) (-1114.016) [-1115.849] * (-1115.686) (-1116.661) (-1114.505) [-1114.647] -- 0:00:34
446000 -- (-1116.747) [-1114.561] (-1114.887) (-1114.451) * [-1116.464] (-1116.686) (-1114.557) (-1115.577) -- 0:00:34
446500 -- (-1114.665) (-1114.650) [-1113.489] (-1115.591) * (-1115.551) (-1115.601) [-1114.518] (-1114.282) -- 0:00:34
447000 -- (-1115.138) [-1114.748] (-1117.365) (-1115.111) * [-1114.356] (-1117.803) (-1114.907) (-1116.269) -- 0:00:34
447500 -- (-1116.366) (-1114.602) [-1113.935] (-1114.487) * (-1114.186) (-1117.623) [-1116.478] (-1118.754) -- 0:00:34
448000 -- (-1117.456) (-1117.270) [-1113.693] (-1116.718) * (-1113.192) [-1115.803] (-1113.993) (-1114.527) -- 0:00:34
448500 -- (-1114.375) (-1118.340) (-1114.512) [-1118.613] * (-1114.254) (-1115.000) [-1117.508] (-1115.715) -- 0:00:34
449000 -- [-1114.897] (-1120.045) (-1113.870) (-1115.474) * [-1116.697] (-1116.169) (-1115.629) (-1115.780) -- 0:00:34
449500 -- (-1118.367) [-1116.398] (-1116.853) (-1115.390) * (-1116.929) [-1115.829] (-1124.073) (-1113.638) -- 0:00:34
450000 -- (-1118.108) (-1114.415) (-1116.732) [-1115.697] * [-1115.188] (-1116.389) (-1118.585) (-1114.964) -- 0:00:34
Average standard deviation of split frequencies: 0.009476
450500 -- (-1116.014) (-1114.918) [-1117.382] (-1115.867) * (-1116.598) (-1120.287) [-1116.886] (-1114.256) -- 0:00:34
451000 -- (-1119.691) (-1114.763) [-1119.216] (-1117.369) * (-1116.855) [-1114.762] (-1114.824) (-1113.993) -- 0:00:34
451500 -- (-1129.520) (-1115.830) (-1116.720) [-1116.288] * (-1117.085) (-1114.430) [-1115.034] (-1113.934) -- 0:00:34
452000 -- (-1119.065) [-1116.756] (-1116.040) (-1115.583) * (-1117.051) (-1114.687) [-1115.922] (-1113.977) -- 0:00:33
452500 -- [-1116.107] (-1115.138) (-1118.690) (-1122.029) * [-1117.146] (-1114.187) (-1113.773) (-1115.889) -- 0:00:33
453000 -- (-1117.126) [-1117.568] (-1113.879) (-1119.214) * (-1116.453) (-1115.001) [-1114.350] (-1115.532) -- 0:00:33
453500 -- (-1116.730) [-1118.479] (-1115.387) (-1119.004) * (-1115.783) [-1114.693] (-1116.077) (-1117.427) -- 0:00:33
454000 -- (-1113.377) (-1116.003) [-1113.769] (-1118.223) * (-1113.703) [-1114.804] (-1115.023) (-1116.265) -- 0:00:33
454500 -- (-1115.016) (-1113.697) (-1114.618) [-1114.287] * (-1115.817) (-1114.912) [-1115.110] (-1114.331) -- 0:00:33
455000 -- (-1114.282) (-1113.696) [-1114.256] (-1117.681) * (-1113.890) (-1115.014) [-1116.145] (-1114.332) -- 0:00:33
Average standard deviation of split frequencies: 0.009243
455500 -- [-1115.658] (-1113.552) (-1116.928) (-1115.364) * (-1113.844) (-1114.616) [-1114.536] (-1115.088) -- 0:00:33
456000 -- (-1116.712) (-1118.647) (-1118.574) [-1119.656] * (-1115.056) (-1114.623) (-1114.450) [-1114.721] -- 0:00:33
456500 -- (-1115.328) [-1117.272] (-1114.811) (-1115.392) * (-1115.136) [-1115.598] (-1114.683) (-1121.761) -- 0:00:33
457000 -- (-1116.123) (-1114.282) [-1113.698] (-1115.121) * (-1118.391) (-1114.608) [-1113.648] (-1114.744) -- 0:00:33
457500 -- (-1116.584) (-1118.431) (-1115.681) [-1114.476] * (-1118.170) (-1118.301) [-1115.391] (-1119.192) -- 0:00:33
458000 -- [-1115.759] (-1116.643) (-1118.286) (-1116.991) * (-1115.754) (-1116.638) (-1116.004) [-1115.182] -- 0:00:34
458500 -- [-1114.901] (-1121.414) (-1118.670) (-1114.749) * [-1115.489] (-1115.026) (-1119.178) (-1118.246) -- 0:00:34
459000 -- [-1115.277] (-1114.306) (-1114.727) (-1114.891) * (-1114.375) [-1114.480] (-1117.554) (-1114.531) -- 0:00:34
459500 -- (-1115.178) (-1118.808) [-1114.171] (-1114.775) * (-1116.782) (-1114.903) (-1123.032) [-1116.621] -- 0:00:34
460000 -- (-1116.266) (-1114.714) [-1114.419] (-1115.667) * (-1114.346) (-1115.776) (-1121.092) [-1117.700] -- 0:00:34
Average standard deviation of split frequencies: 0.009330
460500 -- (-1116.707) (-1115.673) [-1114.644] (-1114.285) * [-1116.098] (-1117.828) (-1116.569) (-1115.823) -- 0:00:33
461000 -- (-1114.298) (-1114.932) (-1115.489) [-1114.815] * (-1116.444) (-1119.668) (-1116.566) [-1114.952] -- 0:00:33
461500 -- (-1115.197) (-1116.988) [-1117.627] (-1116.707) * (-1116.453) (-1117.442) (-1120.708) [-1117.041] -- 0:00:33
462000 -- (-1116.791) (-1116.061) (-1116.341) [-1116.138] * (-1113.635) (-1114.297) (-1117.838) [-1114.745] -- 0:00:33
462500 -- [-1118.954] (-1115.267) (-1116.325) (-1115.838) * (-1116.030) (-1115.485) (-1117.738) [-1114.299] -- 0:00:33
463000 -- (-1116.861) (-1122.544) [-1115.920] (-1114.318) * (-1120.344) (-1114.809) (-1117.432) [-1119.411] -- 0:00:33
463500 -- (-1119.020) [-1114.912] (-1118.130) (-1116.236) * (-1116.256) (-1115.307) (-1114.954) [-1114.681] -- 0:00:33
464000 -- (-1116.512) (-1114.098) [-1114.567] (-1117.953) * (-1116.597) (-1114.422) [-1114.933] (-1118.394) -- 0:00:33
464500 -- (-1114.551) (-1115.574) [-1114.737] (-1114.643) * (-1116.527) (-1117.824) (-1121.580) [-1117.494] -- 0:00:33
465000 -- (-1116.763) (-1117.305) (-1114.337) [-1115.507] * (-1114.381) (-1115.716) (-1115.179) [-1117.737] -- 0:00:33
Average standard deviation of split frequencies: 0.009759
465500 -- (-1117.965) (-1117.596) (-1113.983) [-1114.740] * (-1116.740) (-1113.752) [-1115.303] (-1116.554) -- 0:00:33
466000 -- [-1115.903] (-1114.917) (-1117.584) (-1122.139) * (-1114.183) [-1116.148] (-1115.195) (-1116.621) -- 0:00:33
466500 -- [-1119.336] (-1115.396) (-1114.423) (-1118.871) * (-1115.796) (-1116.854) (-1115.670) [-1116.088] -- 0:00:33
467000 -- [-1116.223] (-1114.777) (-1114.236) (-1121.598) * (-1115.203) (-1118.604) (-1115.598) [-1116.089] -- 0:00:33
467500 -- (-1114.678) [-1116.693] (-1114.889) (-1116.222) * (-1117.783) (-1118.032) [-1114.589] (-1115.617) -- 0:00:33
468000 -- [-1115.579] (-1113.922) (-1117.137) (-1116.153) * (-1116.416) (-1115.542) [-1113.820] (-1116.195) -- 0:00:32
468500 -- (-1118.905) (-1113.575) (-1114.546) [-1115.489] * (-1114.583) [-1114.613] (-1113.393) (-1114.992) -- 0:00:32
469000 -- [-1114.066] (-1115.029) (-1114.692) (-1120.977) * (-1118.508) (-1116.142) [-1115.519] (-1119.844) -- 0:00:32
469500 -- (-1115.313) [-1116.058] (-1116.581) (-1116.483) * (-1118.156) (-1114.333) (-1115.344) [-1116.983] -- 0:00:32
470000 -- (-1115.300) (-1115.475) [-1116.241] (-1117.104) * (-1117.505) [-1115.186] (-1116.321) (-1117.630) -- 0:00:32
Average standard deviation of split frequencies: 0.010955
470500 -- (-1113.922) [-1116.684] (-1115.234) (-1113.479) * (-1115.054) (-1114.920) (-1118.906) [-1118.847] -- 0:00:32
471000 -- (-1115.278) (-1117.866) [-1117.284] (-1118.906) * (-1114.800) [-1119.756] (-1114.979) (-1116.479) -- 0:00:32
471500 -- (-1115.245) (-1119.214) [-1115.585] (-1119.646) * (-1120.489) (-1116.092) (-1115.445) [-1114.892] -- 0:00:32
472000 -- (-1115.475) (-1114.734) [-1116.856] (-1114.797) * (-1119.088) (-1115.176) [-1116.121] (-1113.874) -- 0:00:32
472500 -- (-1115.224) (-1114.898) [-1116.892] (-1118.080) * (-1114.653) (-1114.470) [-1116.858] (-1117.266) -- 0:00:32
473000 -- (-1115.229) [-1115.282] (-1115.899) (-1114.764) * (-1117.800) (-1114.316) (-1115.717) [-1114.999] -- 0:00:32
473500 -- (-1116.641) [-1115.690] (-1114.881) (-1115.027) * [-1115.358] (-1114.214) (-1115.928) (-1116.323) -- 0:00:32
474000 -- (-1116.372) [-1115.261] (-1114.056) (-1116.141) * (-1116.712) (-1116.946) (-1114.773) [-1115.270] -- 0:00:32
474500 -- (-1114.890) [-1115.305] (-1116.602) (-1117.090) * [-1118.802] (-1114.345) (-1115.458) (-1116.647) -- 0:00:33
475000 -- [-1113.967] (-1114.867) (-1115.270) (-1119.035) * (-1116.232) (-1114.510) [-1114.451] (-1114.451) -- 0:00:33
Average standard deviation of split frequencies: 0.010956
475500 -- [-1113.630] (-1114.867) (-1113.936) (-1115.961) * (-1118.140) (-1115.512) (-1120.322) [-1114.053] -- 0:00:33
476000 -- (-1115.779) (-1116.725) (-1114.911) [-1115.823] * [-1116.276] (-1116.078) (-1115.341) (-1113.353) -- 0:00:33
476500 -- (-1116.560) (-1113.747) [-1117.211] (-1116.571) * (-1115.222) (-1114.448) [-1115.117] (-1116.032) -- 0:00:32
477000 -- (-1113.548) [-1114.406] (-1115.167) (-1115.434) * [-1114.717] (-1115.975) (-1118.728) (-1114.771) -- 0:00:32
477500 -- (-1115.249) (-1115.380) [-1114.142] (-1114.112) * (-1113.524) [-1115.469] (-1116.640) (-1115.181) -- 0:00:32
478000 -- (-1113.243) (-1114.246) (-1117.269) [-1113.726] * [-1115.550] (-1117.441) (-1117.088) (-1113.823) -- 0:00:32
478500 -- (-1113.943) (-1119.853) [-1113.498] (-1114.043) * (-1115.270) [-1114.929] (-1116.117) (-1113.757) -- 0:00:32
479000 -- (-1117.028) (-1119.307) [-1113.528] (-1114.177) * (-1114.642) (-1113.915) (-1116.534) [-1115.538] -- 0:00:32
479500 -- (-1119.672) (-1113.959) [-1114.725] (-1115.154) * (-1114.611) (-1115.054) (-1114.617) [-1117.190] -- 0:00:32
480000 -- (-1115.713) (-1116.487) (-1114.693) [-1114.007] * (-1118.853) [-1118.719] (-1113.867) (-1115.330) -- 0:00:32
Average standard deviation of split frequencies: 0.010727
480500 -- [-1115.675] (-1117.301) (-1115.655) (-1117.855) * (-1117.286) [-1113.840] (-1119.210) (-1114.592) -- 0:00:32
481000 -- (-1115.621) (-1119.745) [-1114.233] (-1115.348) * (-1117.104) (-1114.077) (-1116.362) [-1115.766] -- 0:00:32
481500 -- [-1114.720] (-1113.875) (-1116.251) (-1115.904) * (-1113.886) [-1113.398] (-1116.847) (-1115.772) -- 0:00:32
482000 -- [-1119.296] (-1115.598) (-1120.199) (-1115.904) * (-1116.656) [-1114.250] (-1118.138) (-1114.939) -- 0:00:32
482500 -- (-1115.738) (-1113.177) [-1116.272] (-1117.296) * (-1113.577) (-1114.454) [-1114.630] (-1118.662) -- 0:00:32
483000 -- (-1115.227) (-1117.911) [-1120.060] (-1116.474) * [-1114.962] (-1114.458) (-1116.287) (-1113.779) -- 0:00:32
483500 -- (-1115.323) (-1117.484) [-1116.794] (-1114.768) * (-1114.045) (-1116.885) [-1116.782] (-1113.779) -- 0:00:32
484000 -- (-1117.212) [-1115.066] (-1114.491) (-1116.718) * [-1114.486] (-1118.444) (-1115.638) (-1114.036) -- 0:00:31
484500 -- (-1121.533) (-1116.814) [-1115.583] (-1118.417) * (-1114.553) (-1116.500) (-1115.301) [-1115.022] -- 0:00:31
485000 -- (-1123.311) (-1115.675) [-1115.515] (-1115.193) * (-1115.897) [-1114.095] (-1114.316) (-1116.348) -- 0:00:31
Average standard deviation of split frequencies: 0.010327
485500 -- (-1118.668) (-1116.909) (-1119.475) [-1115.432] * (-1117.037) [-1113.944] (-1117.974) (-1115.987) -- 0:00:31
486000 -- (-1117.808) (-1116.572) [-1118.048] (-1115.372) * [-1118.736] (-1118.559) (-1116.610) (-1116.935) -- 0:00:31
486500 -- (-1116.472) (-1114.988) (-1118.048) [-1114.318] * (-1117.304) (-1114.474) [-1118.188] (-1114.227) -- 0:00:31
487000 -- (-1119.199) [-1115.563] (-1114.858) (-1114.636) * [-1115.800] (-1116.564) (-1114.386) (-1114.255) -- 0:00:31
487500 -- [-1117.102] (-1118.628) (-1115.450) (-1114.058) * (-1118.111) (-1114.190) [-1114.380] (-1115.821) -- 0:00:31
488000 -- (-1118.719) (-1114.131) (-1116.897) [-1115.259] * [-1118.252] (-1114.001) (-1116.107) (-1114.554) -- 0:00:31
488500 -- (-1115.431) (-1114.910) (-1116.467) [-1115.618] * [-1114.017] (-1115.488) (-1115.826) (-1116.690) -- 0:00:31
489000 -- (-1113.804) (-1115.290) (-1116.813) [-1114.947] * (-1114.399) (-1117.039) [-1118.200] (-1116.698) -- 0:00:31
489500 -- (-1114.363) (-1121.212) (-1114.592) [-1116.148] * (-1114.398) [-1117.787] (-1114.598) (-1115.828) -- 0:00:31
490000 -- [-1113.189] (-1116.911) (-1114.235) (-1115.232) * (-1114.858) (-1117.425) [-1114.838] (-1115.535) -- 0:00:31
Average standard deviation of split frequencies: 0.011416
490500 -- (-1116.531) (-1114.380) (-1115.649) [-1116.220] * [-1114.626] (-1122.268) (-1115.830) (-1115.203) -- 0:00:32
491000 -- [-1116.120] (-1116.386) (-1115.029) (-1115.913) * [-1114.235] (-1118.447) (-1114.415) (-1115.840) -- 0:00:32
491500 -- (-1119.204) [-1115.464] (-1115.753) (-1114.588) * [-1114.745] (-1117.892) (-1115.360) (-1114.487) -- 0:00:32
492000 -- [-1115.266] (-1115.484) (-1114.361) (-1114.905) * (-1114.199) [-1116.226] (-1113.667) (-1116.912) -- 0:00:32
492500 -- (-1117.348) (-1114.171) [-1114.541] (-1115.422) * (-1114.293) (-1116.116) (-1114.813) [-1114.255] -- 0:00:31
493000 -- [-1117.742] (-1116.514) (-1114.165) (-1117.697) * (-1115.966) [-1116.507] (-1115.810) (-1116.871) -- 0:00:31
493500 -- (-1118.995) (-1114.772) (-1115.037) [-1114.262] * (-1116.045) (-1113.742) (-1114.353) [-1117.930] -- 0:00:31
494000 -- (-1117.702) (-1119.500) (-1117.572) [-1114.057] * (-1115.659) (-1114.320) [-1114.038] (-1114.319) -- 0:00:31
494500 -- (-1117.645) [-1115.762] (-1114.323) (-1114.407) * (-1116.737) (-1117.092) [-1114.422] (-1115.664) -- 0:00:31
495000 -- [-1113.498] (-1115.965) (-1114.865) (-1115.590) * (-1115.993) (-1114.670) (-1114.455) [-1115.133] -- 0:00:31
Average standard deviation of split frequencies: 0.011573
495500 -- [-1113.623] (-1114.617) (-1115.465) (-1114.678) * [-1114.042] (-1115.308) (-1114.682) (-1114.216) -- 0:00:31
496000 -- (-1115.571) (-1116.911) [-1114.734] (-1113.785) * (-1114.499) (-1115.355) [-1114.590] (-1115.385) -- 0:00:31
496500 -- (-1115.718) [-1114.953] (-1114.276) (-1114.459) * (-1113.999) [-1115.400] (-1116.236) (-1114.039) -- 0:00:31
497000 -- (-1116.839) (-1113.649) [-1115.390] (-1116.012) * (-1114.570) (-1119.826) [-1115.709] (-1114.340) -- 0:00:31
497500 -- (-1120.345) (-1117.022) [-1116.223] (-1114.490) * [-1115.537] (-1122.266) (-1115.675) (-1116.058) -- 0:00:31
498000 -- (-1118.646) (-1115.507) [-1121.115] (-1114.042) * (-1117.632) (-1116.326) (-1113.796) [-1114.665] -- 0:00:31
498500 -- (-1114.882) (-1115.001) [-1118.057] (-1114.879) * (-1117.661) (-1116.889) [-1113.690] (-1115.034) -- 0:00:31
499000 -- [-1115.823] (-1117.814) (-1116.939) (-1118.158) * (-1117.873) [-1113.465] (-1115.224) (-1115.356) -- 0:00:31
499500 -- [-1116.725] (-1116.685) (-1118.865) (-1114.478) * (-1118.237) [-1116.223] (-1114.830) (-1117.651) -- 0:00:31
500000 -- (-1116.975) (-1116.586) (-1115.646) [-1117.225] * (-1116.113) (-1118.519) (-1114.251) [-1114.935] -- 0:00:31
Average standard deviation of split frequencies: 0.010769
500500 -- [-1117.252] (-1118.615) (-1114.411) (-1117.358) * [-1115.430] (-1118.819) (-1116.794) (-1117.181) -- 0:00:30
501000 -- (-1115.323) (-1118.262) [-1117.296] (-1115.262) * (-1117.481) (-1118.298) (-1113.864) [-1116.058] -- 0:00:30
501500 -- (-1114.296) [-1118.389] (-1115.439) (-1119.247) * (-1115.261) (-1119.269) [-1114.531] (-1118.905) -- 0:00:30
502000 -- [-1114.329] (-1117.819) (-1115.470) (-1116.209) * (-1117.873) (-1115.778) [-1118.411] (-1117.774) -- 0:00:30
502500 -- [-1114.302] (-1118.449) (-1116.346) (-1114.698) * (-1115.858) (-1115.517) [-1115.857] (-1116.239) -- 0:00:30
503000 -- (-1116.779) (-1115.171) (-1116.023) [-1115.158] * (-1115.875) [-1115.307] (-1115.429) (-1115.867) -- 0:00:30
503500 -- [-1116.771] (-1114.463) (-1116.369) (-1118.988) * (-1114.943) (-1116.216) [-1114.602] (-1117.836) -- 0:00:30
504000 -- (-1113.622) [-1114.762] (-1118.534) (-1116.092) * (-1115.306) (-1116.922) [-1116.046] (-1114.970) -- 0:00:30
504500 -- (-1116.727) (-1118.301) (-1119.423) [-1114.688] * (-1115.642) (-1115.009) [-1114.920] (-1116.291) -- 0:00:30
505000 -- [-1114.705] (-1115.041) (-1121.413) (-1116.818) * (-1115.357) (-1115.484) [-1115.551] (-1115.032) -- 0:00:30
Average standard deviation of split frequencies: 0.010577
505500 -- [-1115.718] (-1116.973) (-1117.507) (-1116.511) * (-1114.406) [-1117.300] (-1115.459) (-1114.547) -- 0:00:30
506000 -- (-1116.566) (-1116.246) [-1113.759] (-1115.611) * (-1114.918) (-1115.284) (-1116.722) [-1114.975] -- 0:00:30
506500 -- (-1114.481) (-1115.886) (-1114.316) [-1115.966] * (-1115.045) [-1120.067] (-1120.430) (-1114.758) -- 0:00:30
507000 -- [-1115.461] (-1116.238) (-1115.264) (-1115.952) * [-1115.461] (-1117.750) (-1120.131) (-1114.785) -- 0:00:31
507500 -- [-1114.723] (-1115.571) (-1116.154) (-1113.592) * (-1117.129) [-1116.852] (-1120.199) (-1114.158) -- 0:00:31
508000 -- (-1120.670) (-1117.464) [-1114.287] (-1114.312) * [-1115.267] (-1119.499) (-1117.844) (-1116.421) -- 0:00:30
508500 -- [-1113.544] (-1120.661) (-1115.827) (-1113.909) * [-1115.480] (-1114.427) (-1118.443) (-1122.248) -- 0:00:30
509000 -- (-1114.834) (-1116.965) [-1116.555] (-1113.872) * [-1116.899] (-1118.079) (-1118.204) (-1115.229) -- 0:00:30
509500 -- [-1114.060] (-1118.381) (-1115.129) (-1115.773) * (-1114.642) (-1118.674) [-1114.085] (-1117.807) -- 0:00:30
510000 -- (-1114.799) (-1117.236) (-1117.779) [-1114.508] * [-1114.920] (-1115.247) (-1116.528) (-1118.140) -- 0:00:30
Average standard deviation of split frequencies: 0.010270
510500 -- [-1115.003] (-1117.288) (-1115.286) (-1116.965) * [-1115.243] (-1116.279) (-1118.550) (-1115.947) -- 0:00:30
511000 -- (-1115.484) (-1114.871) (-1118.286) [-1115.199] * (-1117.764) [-1117.177] (-1115.193) (-1116.533) -- 0:00:30
511500 -- (-1116.875) (-1116.021) [-1114.792] (-1115.351) * (-1120.012) (-1117.165) (-1115.115) [-1116.053] -- 0:00:30
512000 -- (-1118.628) (-1115.022) (-1114.130) [-1115.487] * [-1115.087] (-1115.157) (-1114.878) (-1117.068) -- 0:00:30
512500 -- (-1117.547) [-1114.383] (-1114.058) (-1115.547) * (-1117.460) (-1116.858) [-1116.479] (-1119.200) -- 0:00:30
513000 -- [-1117.468] (-1114.244) (-1115.732) (-1121.510) * (-1114.213) (-1117.616) (-1119.255) [-1114.190] -- 0:00:30
513500 -- [-1118.768] (-1116.321) (-1117.077) (-1121.019) * (-1114.084) (-1117.219) [-1117.582] (-1123.786) -- 0:00:30
514000 -- (-1115.658) (-1118.752) (-1116.958) [-1117.573] * (-1114.337) [-1116.633] (-1115.704) (-1114.771) -- 0:00:30
514500 -- (-1115.114) (-1114.703) (-1114.488) [-1114.156] * (-1117.701) (-1115.557) [-1115.895] (-1116.694) -- 0:00:30
515000 -- [-1114.225] (-1116.442) (-1115.565) (-1115.366) * (-1115.000) [-1116.529] (-1114.644) (-1113.940) -- 0:00:30
Average standard deviation of split frequencies: 0.008622
515500 -- (-1114.142) (-1114.077) [-1115.512] (-1116.417) * (-1114.700) (-1115.791) (-1114.461) [-1116.139] -- 0:00:30
516000 -- (-1117.850) (-1119.658) (-1114.026) [-1114.595] * (-1114.202) (-1124.554) (-1115.710) [-1115.319] -- 0:00:30
516500 -- (-1117.849) (-1116.624) (-1116.095) [-1115.130] * (-1115.752) (-1119.746) (-1119.392) [-1115.365] -- 0:00:29
517000 -- [-1116.543] (-1114.981) (-1119.496) (-1116.136) * (-1118.038) [-1115.227] (-1120.408) (-1116.025) -- 0:00:29
517500 -- (-1115.090) (-1116.299) (-1118.291) [-1115.561] * (-1119.830) (-1117.209) (-1118.201) [-1113.775] -- 0:00:29
518000 -- (-1116.626) (-1118.408) (-1115.185) [-1116.095] * [-1118.478] (-1114.699) (-1116.617) (-1116.763) -- 0:00:29
518500 -- [-1118.748] (-1117.349) (-1114.706) (-1115.875) * (-1117.594) [-1114.313] (-1117.765) (-1115.010) -- 0:00:29
519000 -- (-1116.123) (-1118.998) [-1115.261] (-1116.085) * (-1115.939) [-1114.157] (-1115.920) (-1114.883) -- 0:00:29
519500 -- (-1115.453) (-1117.231) [-1114.242] (-1115.249) * (-1113.980) (-1113.948) [-1115.903] (-1115.102) -- 0:00:29
520000 -- (-1115.420) (-1115.072) [-1114.235] (-1117.480) * (-1117.169) (-1114.342) [-1116.069] (-1118.618) -- 0:00:29
Average standard deviation of split frequencies: 0.009676
520500 -- (-1121.556) (-1114.714) [-1115.299] (-1117.739) * (-1115.607) (-1114.131) [-1114.958] (-1116.085) -- 0:00:29
521000 -- [-1113.891] (-1116.458) (-1115.668) (-1117.794) * (-1114.184) (-1115.817) (-1117.020) [-1116.048] -- 0:00:29
521500 -- (-1115.683) (-1114.495) [-1115.884] (-1116.655) * (-1116.109) [-1113.661] (-1117.462) (-1116.220) -- 0:00:29
522000 -- (-1113.268) [-1113.649] (-1115.722) (-1114.236) * (-1114.926) (-1113.771) (-1114.963) [-1117.294] -- 0:00:29
522500 -- (-1114.026) (-1113.969) [-1114.916] (-1114.379) * (-1117.115) [-1115.512] (-1117.592) (-1115.562) -- 0:00:29
523000 -- (-1114.339) (-1117.812) [-1115.201] (-1117.260) * (-1113.707) [-1116.730] (-1115.681) (-1114.484) -- 0:00:29
523500 -- (-1115.564) (-1116.855) [-1117.410] (-1116.992) * (-1113.805) [-1114.967] (-1119.042) (-1115.132) -- 0:00:30
524000 -- (-1119.960) (-1116.079) [-1115.739] (-1118.203) * (-1115.337) [-1118.350] (-1116.433) (-1114.399) -- 0:00:29
524500 -- [-1114.314] (-1115.660) (-1121.582) (-1114.848) * (-1114.438) [-1116.326] (-1114.280) (-1115.398) -- 0:00:29
525000 -- (-1114.811) (-1115.275) [-1115.028] (-1115.438) * [-1116.046] (-1119.460) (-1115.347) (-1115.081) -- 0:00:29
Average standard deviation of split frequencies: 0.010306
525500 -- (-1116.580) [-1114.894] (-1116.582) (-1115.168) * (-1116.777) (-1114.930) (-1114.860) [-1118.521] -- 0:00:29
526000 -- (-1115.741) (-1115.994) (-1119.403) [-1115.076] * (-1114.469) (-1116.070) (-1114.179) [-1118.056] -- 0:00:29
526500 -- [-1114.252] (-1115.510) (-1116.986) (-1114.629) * [-1117.332] (-1114.371) (-1115.181) (-1115.364) -- 0:00:29
527000 -- [-1116.359] (-1118.748) (-1113.766) (-1113.937) * [-1116.330] (-1113.848) (-1115.195) (-1115.356) -- 0:00:29
527500 -- (-1117.428) [-1114.061] (-1114.874) (-1117.933) * (-1115.482) (-1114.408) [-1114.209] (-1113.838) -- 0:00:29
528000 -- (-1116.592) (-1114.061) [-1115.246] (-1116.625) * (-1117.548) (-1117.677) (-1114.231) [-1115.030] -- 0:00:29
528500 -- (-1115.164) (-1114.304) (-1120.243) [-1114.950] * (-1117.029) (-1114.854) [-1114.113] (-1115.914) -- 0:00:29
529000 -- [-1114.591] (-1115.001) (-1117.235) (-1116.852) * (-1114.880) [-1114.467] (-1116.029) (-1113.414) -- 0:00:29
529500 -- (-1116.545) (-1113.724) [-1115.066] (-1118.750) * (-1116.473) [-1114.632] (-1115.249) (-1117.493) -- 0:00:29
530000 -- (-1114.322) (-1114.535) (-1114.484) [-1114.844] * (-1113.648) [-1116.726] (-1114.931) (-1116.368) -- 0:00:29
Average standard deviation of split frequencies: 0.010660
530500 -- (-1114.224) (-1115.069) (-1115.532) [-1117.395] * [-1115.541] (-1114.686) (-1114.083) (-1115.751) -- 0:00:29
531000 -- [-1113.640] (-1114.918) (-1115.325) (-1117.966) * (-1115.696) (-1113.985) [-1113.899] (-1115.119) -- 0:00:29
531500 -- [-1113.809] (-1114.628) (-1119.999) (-1117.972) * (-1114.474) [-1114.650] (-1114.996) (-1115.496) -- 0:00:29
532000 -- (-1114.321) (-1117.417) (-1119.526) [-1114.706] * [-1114.110] (-1114.802) (-1117.044) (-1117.923) -- 0:00:29
532500 -- (-1116.088) [-1117.900] (-1117.885) (-1118.540) * (-1115.084) (-1114.382) (-1115.196) [-1121.179] -- 0:00:28
533000 -- (-1115.284) (-1116.801) (-1119.159) [-1115.568] * (-1117.982) (-1115.413) [-1116.534] (-1119.797) -- 0:00:28
533500 -- (-1117.741) (-1116.077) [-1119.170] (-1115.712) * (-1121.879) (-1115.517) [-1116.175] (-1114.000) -- 0:00:28
534000 -- (-1119.884) (-1115.896) [-1117.305] (-1116.673) * (-1118.802) (-1115.357) (-1116.334) [-1114.510] -- 0:00:28
534500 -- (-1118.479) [-1114.674] (-1117.054) (-1117.431) * (-1115.660) [-1114.395] (-1116.972) (-1116.032) -- 0:00:28
535000 -- (-1116.166) [-1113.826] (-1118.003) (-1117.669) * [-1115.047] (-1117.837) (-1116.060) (-1114.755) -- 0:00:28
Average standard deviation of split frequencies: 0.010829
535500 -- (-1113.894) (-1120.483) [-1116.820] (-1114.557) * (-1116.147) (-1119.155) (-1114.808) [-1115.061] -- 0:00:28
536000 -- (-1116.475) (-1116.478) [-1115.826] (-1115.354) * [-1115.641] (-1114.893) (-1113.864) (-1115.902) -- 0:00:28
536500 -- (-1115.168) (-1117.076) (-1115.185) [-1114.478] * [-1117.112] (-1116.410) (-1113.862) (-1115.690) -- 0:00:28
537000 -- (-1114.635) (-1116.874) [-1115.151] (-1116.556) * (-1116.184) (-1113.617) [-1115.572] (-1116.185) -- 0:00:28
537500 -- (-1116.069) (-1114.453) [-1113.959] (-1115.389) * (-1118.158) (-1117.173) (-1113.848) [-1115.000] -- 0:00:28
538000 -- (-1117.614) [-1116.873] (-1114.706) (-1115.279) * [-1114.704] (-1117.834) (-1115.534) (-1119.759) -- 0:00:28
538500 -- (-1116.563) (-1119.635) [-1120.070] (-1113.859) * [-1113.743] (-1119.663) (-1120.543) (-1116.750) -- 0:00:28
539000 -- (-1114.130) [-1115.799] (-1114.560) (-1114.687) * (-1117.516) [-1115.434] (-1114.898) (-1113.773) -- 0:00:28
539500 -- [-1114.499] (-1119.435) (-1115.774) (-1114.134) * (-1117.037) [-1117.392] (-1115.052) (-1113.999) -- 0:00:29
540000 -- [-1114.646] (-1114.593) (-1118.686) (-1116.720) * (-1117.520) (-1116.731) (-1115.902) [-1117.006] -- 0:00:28
Average standard deviation of split frequencies: 0.011117
540500 -- (-1113.895) [-1114.846] (-1114.477) (-1117.812) * (-1114.128) (-1113.668) [-1116.000] (-1117.814) -- 0:00:28
541000 -- (-1115.293) (-1115.796) (-1115.475) [-1118.552] * (-1114.041) [-1114.821] (-1116.567) (-1117.161) -- 0:00:28
541500 -- (-1115.287) [-1114.340] (-1115.408) (-1118.455) * [-1114.292] (-1115.055) (-1114.778) (-1117.507) -- 0:00:28
542000 -- [-1114.051] (-1120.202) (-1114.312) (-1115.816) * (-1117.878) (-1114.665) [-1114.600] (-1117.594) -- 0:00:28
542500 -- (-1114.359) (-1114.352) (-1114.864) [-1114.612] * [-1116.413] (-1116.099) (-1116.015) (-1117.190) -- 0:00:28
543000 -- [-1115.889] (-1114.131) (-1115.444) (-1113.834) * [-1115.950] (-1116.467) (-1114.473) (-1116.645) -- 0:00:28
543500 -- (-1116.432) [-1114.526] (-1115.600) (-1113.446) * [-1113.642] (-1116.013) (-1115.394) (-1115.713) -- 0:00:28
544000 -- (-1116.366) [-1116.826] (-1115.568) (-1113.868) * (-1117.807) (-1114.641) (-1115.304) [-1114.534] -- 0:00:28
544500 -- (-1121.241) (-1114.633) [-1116.319] (-1113.597) * [-1113.635] (-1115.091) (-1119.565) (-1114.593) -- 0:00:28
545000 -- (-1117.452) (-1114.309) [-1115.590] (-1114.616) * (-1113.965) [-1115.560] (-1115.169) (-1115.760) -- 0:00:28
Average standard deviation of split frequencies: 0.010411
545500 -- (-1114.280) [-1115.599] (-1122.384) (-1113.954) * [-1119.593] (-1115.489) (-1115.615) (-1113.757) -- 0:00:28
546000 -- [-1114.460] (-1114.037) (-1117.544) (-1113.543) * [-1114.607] (-1115.725) (-1113.734) (-1117.069) -- 0:00:28
546500 -- (-1117.671) (-1117.202) [-1116.100] (-1116.387) * (-1113.859) [-1114.645] (-1118.699) (-1117.672) -- 0:00:28
547000 -- (-1116.506) (-1115.657) [-1116.211] (-1115.224) * [-1114.576] (-1118.493) (-1116.642) (-1114.291) -- 0:00:28
547500 -- (-1114.649) (-1113.573) [-1116.077] (-1118.644) * (-1114.159) (-1117.983) [-1114.615] (-1114.473) -- 0:00:28
548000 -- (-1116.347) (-1113.481) [-1115.248] (-1119.515) * [-1117.527] (-1115.051) (-1115.778) (-1115.374) -- 0:00:28
548500 -- (-1115.882) (-1119.049) [-1114.390] (-1115.518) * (-1116.316) [-1115.076] (-1115.175) (-1113.974) -- 0:00:27
549000 -- (-1115.051) (-1115.887) (-1115.324) [-1116.368] * (-1113.814) [-1114.679] (-1115.078) (-1117.346) -- 0:00:27
549500 -- [-1114.908] (-1115.320) (-1117.293) (-1114.408) * [-1120.315] (-1114.934) (-1114.902) (-1119.111) -- 0:00:27
550000 -- (-1118.005) (-1114.084) [-1117.615] (-1116.232) * (-1117.373) (-1118.289) [-1114.906] (-1119.486) -- 0:00:27
Average standard deviation of split frequencies: 0.010754
550500 -- (-1113.891) (-1113.725) [-1119.474] (-1115.638) * (-1117.746) [-1117.691] (-1115.306) (-1114.623) -- 0:00:27
551000 -- (-1118.058) (-1117.724) [-1114.958] (-1118.541) * (-1114.820) [-1117.234] (-1118.143) (-1118.583) -- 0:00:27
551500 -- (-1116.492) (-1114.686) [-1114.919] (-1117.437) * [-1114.297] (-1117.063) (-1120.554) (-1121.409) -- 0:00:27
552000 -- [-1115.674] (-1118.306) (-1117.143) (-1116.650) * (-1115.638) (-1115.019) (-1119.164) [-1122.534] -- 0:00:27
552500 -- [-1115.508] (-1119.793) (-1117.105) (-1115.464) * [-1113.574] (-1115.477) (-1115.292) (-1119.750) -- 0:00:27
553000 -- (-1114.268) [-1116.978] (-1118.108) (-1115.347) * (-1113.756) (-1114.868) (-1116.855) [-1118.079] -- 0:00:27
553500 -- (-1115.234) (-1119.156) (-1116.598) [-1115.465] * (-1115.392) (-1114.774) [-1114.074] (-1116.702) -- 0:00:27
554000 -- (-1114.431) (-1114.759) [-1117.822] (-1118.200) * (-1116.857) (-1114.016) [-1116.450] (-1118.447) -- 0:00:27
554500 -- (-1116.479) [-1118.676] (-1116.701) (-1118.294) * [-1116.399] (-1115.818) (-1120.589) (-1115.857) -- 0:00:27
555000 -- (-1119.915) [-1114.005] (-1116.840) (-1113.663) * (-1116.268) [-1114.915] (-1120.586) (-1114.399) -- 0:00:27
Average standard deviation of split frequencies: 0.010068
555500 -- (-1115.608) (-1115.792) [-1115.004] (-1116.545) * [-1115.008] (-1115.079) (-1122.847) (-1121.894) -- 0:00:28
556000 -- (-1115.174) (-1114.565) [-1114.269] (-1117.674) * (-1114.451) [-1114.400] (-1114.187) (-1114.990) -- 0:00:27
556500 -- (-1115.791) (-1114.669) (-1119.162) [-1115.115] * (-1114.103) (-1113.818) (-1115.022) [-1115.973] -- 0:00:27
557000 -- [-1119.600] (-1119.708) (-1116.672) (-1115.485) * (-1114.555) (-1113.997) [-1116.787] (-1115.413) -- 0:00:27
557500 -- (-1118.754) (-1116.869) [-1113.851] (-1115.778) * (-1113.675) [-1114.036] (-1116.163) (-1115.338) -- 0:00:27
558000 -- [-1118.065] (-1114.628) (-1113.851) (-1116.405) * (-1115.307) (-1117.136) [-1115.152] (-1114.850) -- 0:00:27
558500 -- (-1117.310) (-1114.346) [-1116.985] (-1116.236) * (-1115.845) (-1116.091) [-1116.028] (-1119.417) -- 0:00:27
559000 -- [-1115.545] (-1114.161) (-1117.717) (-1116.221) * [-1114.448] (-1115.839) (-1116.938) (-1122.780) -- 0:00:27
559500 -- (-1116.756) (-1114.085) (-1119.712) [-1116.492] * [-1113.971] (-1116.203) (-1116.494) (-1116.469) -- 0:00:27
560000 -- (-1114.478) (-1118.023) (-1116.861) [-1116.496] * (-1114.961) (-1116.424) (-1115.272) [-1116.479] -- 0:00:27
Average standard deviation of split frequencies: 0.010247
560500 -- (-1115.287) [-1114.173] (-1114.463) (-1118.314) * (-1115.621) (-1114.934) (-1117.029) [-1117.807] -- 0:00:27
561000 -- [-1117.332] (-1115.749) (-1114.950) (-1115.166) * (-1114.793) (-1114.172) (-1117.667) [-1116.558] -- 0:00:27
561500 -- (-1115.136) [-1117.009] (-1116.553) (-1118.827) * (-1115.553) [-1113.378] (-1117.588) (-1115.980) -- 0:00:27
562000 -- (-1121.603) [-1114.735] (-1115.122) (-1114.824) * [-1115.559] (-1115.734) (-1115.599) (-1117.046) -- 0:00:27
562500 -- (-1119.837) [-1114.566] (-1113.984) (-1116.051) * (-1116.267) (-1114.916) [-1113.873] (-1117.862) -- 0:00:27
563000 -- (-1120.567) [-1115.342] (-1119.772) (-1114.001) * (-1114.170) (-1114.745) [-1114.034] (-1118.580) -- 0:00:27
563500 -- [-1114.126] (-1115.803) (-1119.437) (-1114.249) * [-1114.086] (-1114.725) (-1118.696) (-1116.817) -- 0:00:27
564000 -- (-1114.895) (-1117.016) (-1116.613) [-1116.403] * (-1117.196) [-1116.761] (-1117.790) (-1113.630) -- 0:00:27
564500 -- (-1117.041) (-1115.918) [-1116.398] (-1118.038) * (-1113.860) (-1113.653) (-1116.593) [-1114.680] -- 0:00:27
565000 -- (-1115.769) [-1116.671] (-1115.400) (-1117.125) * (-1114.423) [-1116.656] (-1118.262) (-1115.064) -- 0:00:26
Average standard deviation of split frequencies: 0.010239
565500 -- (-1115.329) (-1116.255) [-1115.128] (-1115.491) * (-1114.173) (-1114.507) [-1115.929] (-1115.745) -- 0:00:26
566000 -- (-1114.214) [-1115.492] (-1114.815) (-1117.439) * (-1113.771) [-1113.704] (-1116.469) (-1118.445) -- 0:00:26
566500 -- (-1114.308) [-1114.636] (-1115.066) (-1114.917) * (-1114.432) [-1115.838] (-1116.157) (-1114.981) -- 0:00:26
567000 -- (-1113.905) (-1120.174) (-1115.784) [-1116.384] * (-1115.782) [-1116.581] (-1117.398) (-1114.831) -- 0:00:26
567500 -- (-1113.796) (-1119.453) (-1118.056) [-1115.753] * [-1115.189] (-1113.734) (-1119.272) (-1114.395) -- 0:00:26
568000 -- [-1113.669] (-1124.329) (-1114.942) (-1115.023) * (-1116.468) (-1116.664) [-1114.944] (-1113.708) -- 0:00:26
568500 -- (-1113.563) [-1121.052] (-1114.801) (-1115.005) * (-1114.578) (-1117.553) [-1114.275] (-1115.130) -- 0:00:26
569000 -- (-1116.295) (-1118.352) (-1115.502) [-1115.833] * (-1116.662) (-1119.375) (-1115.606) [-1113.172] -- 0:00:26
569500 -- [-1115.679] (-1118.241) (-1115.508) (-1113.787) * (-1115.603) [-1119.550] (-1115.514) (-1113.346) -- 0:00:26
570000 -- (-1115.890) (-1123.588) [-1113.961] (-1115.070) * (-1121.326) [-1115.740] (-1116.283) (-1117.250) -- 0:00:26
Average standard deviation of split frequencies: 0.009330
570500 -- (-1117.559) [-1118.930] (-1116.231) (-1120.884) * [-1116.095] (-1114.738) (-1115.977) (-1115.888) -- 0:00:26
571000 -- (-1114.242) (-1117.526) (-1117.309) [-1115.254] * [-1116.741] (-1116.998) (-1116.609) (-1117.035) -- 0:00:26
571500 -- (-1113.645) (-1118.692) [-1115.400] (-1119.484) * (-1114.124) (-1118.612) [-1118.735] (-1114.790) -- 0:00:26
572000 -- (-1114.650) [-1114.659] (-1117.024) (-1115.472) * (-1113.915) (-1114.875) [-1114.219] (-1113.966) -- 0:00:26
572500 -- (-1115.568) (-1116.175) [-1116.397] (-1116.179) * (-1114.901) (-1117.918) [-1117.719] (-1115.240) -- 0:00:26
573000 -- (-1115.082) (-1114.726) [-1114.729] (-1116.028) * (-1116.872) (-1113.742) [-1115.079] (-1114.878) -- 0:00:26
573500 -- (-1114.532) (-1116.161) [-1114.218] (-1116.288) * (-1116.977) (-1114.622) (-1116.773) [-1115.433] -- 0:00:26
574000 -- [-1114.532] (-1115.645) (-1117.039) (-1116.769) * (-1117.167) (-1116.630) (-1118.168) [-1114.537] -- 0:00:26
574500 -- [-1114.478] (-1116.532) (-1116.921) (-1115.471) * [-1115.898] (-1114.564) (-1114.879) (-1122.267) -- 0:00:26
575000 -- (-1115.379) (-1117.041) [-1114.406] (-1116.929) * (-1116.899) (-1114.905) [-1115.920] (-1114.575) -- 0:00:26
Average standard deviation of split frequencies: 0.009003
575500 -- (-1116.087) [-1116.064] (-1115.479) (-1117.308) * (-1117.398) (-1117.736) (-1114.850) [-1113.693] -- 0:00:26
576000 -- (-1117.580) (-1115.925) [-1116.607] (-1116.392) * (-1117.792) (-1116.459) [-1115.127] (-1116.453) -- 0:00:26
576500 -- (-1115.619) (-1116.389) (-1115.649) [-1116.478] * (-1116.562) (-1113.665) (-1119.213) [-1113.449] -- 0:00:26
577000 -- (-1120.284) (-1117.276) [-1117.564] (-1116.592) * (-1117.381) (-1118.437) [-1115.844] (-1115.473) -- 0:00:26
577500 -- [-1114.316] (-1116.718) (-1116.298) (-1115.315) * (-1116.644) (-1116.711) [-1115.978] (-1114.166) -- 0:00:26
578000 -- (-1113.997) (-1115.451) [-1115.423] (-1118.517) * [-1114.898] (-1117.632) (-1119.247) (-1115.080) -- 0:00:26
578500 -- (-1114.933) (-1117.475) (-1115.371) [-1113.344] * (-1114.298) [-1114.996] (-1113.757) (-1117.495) -- 0:00:26
579000 -- (-1113.580) (-1113.413) [-1116.102] (-1115.607) * [-1114.170] (-1115.167) (-1114.551) (-1118.303) -- 0:00:26
579500 -- (-1116.518) (-1114.183) [-1114.511] (-1116.993) * (-1115.516) (-1114.311) (-1117.286) [-1117.288] -- 0:00:26
580000 -- (-1115.950) (-1116.209) (-1115.633) [-1115.683] * (-1115.199) [-1113.631] (-1114.364) (-1116.679) -- 0:00:26
Average standard deviation of split frequencies: 0.008626
580500 -- [-1116.029] (-1114.357) (-1114.882) (-1113.219) * (-1114.056) (-1116.015) [-1113.482] (-1117.036) -- 0:00:26
581000 -- (-1114.369) (-1115.175) (-1116.150) [-1113.321] * (-1116.407) (-1114.818) (-1115.076) [-1113.817] -- 0:00:25
581500 -- (-1115.112) (-1116.008) (-1116.772) [-1113.439] * (-1116.983) [-1117.741] (-1118.955) (-1121.666) -- 0:00:25
582000 -- (-1114.621) (-1117.632) (-1114.228) [-1113.136] * (-1117.859) (-1113.736) (-1114.358) [-1116.835] -- 0:00:25
582500 -- (-1114.744) [-1115.303] (-1116.089) (-1118.329) * (-1116.989) (-1113.968) [-1116.981] (-1115.461) -- 0:00:25
583000 -- (-1114.038) [-1116.340] (-1117.833) (-1121.881) * (-1115.901) [-1114.271] (-1116.824) (-1115.868) -- 0:00:25
583500 -- (-1114.032) [-1115.458] (-1116.553) (-1116.543) * (-1114.732) [-1116.183] (-1116.556) (-1113.740) -- 0:00:25
584000 -- (-1117.377) [-1116.786] (-1113.686) (-1116.357) * (-1115.037) [-1115.447] (-1115.599) (-1114.419) -- 0:00:25
584500 -- (-1113.638) (-1114.549) (-1116.776) [-1114.327] * (-1115.221) (-1114.108) (-1114.562) [-1113.651] -- 0:00:25
585000 -- (-1114.045) (-1115.125) (-1118.222) [-1114.504] * [-1116.505] (-1116.834) (-1116.276) (-1115.246) -- 0:00:25
Average standard deviation of split frequencies: 0.008497
585500 -- (-1114.084) (-1116.559) [-1114.456] (-1113.972) * (-1115.534) [-1117.503] (-1114.862) (-1118.119) -- 0:00:25
586000 -- (-1114.084) (-1119.642) (-1113.915) [-1117.639] * (-1118.942) (-1118.146) (-1115.177) [-1116.450] -- 0:00:25
586500 -- [-1114.629] (-1117.681) (-1114.291) (-1115.399) * (-1116.188) (-1114.737) (-1115.060) [-1117.751] -- 0:00:25
587000 -- (-1113.412) [-1114.127] (-1115.745) (-1115.399) * (-1114.900) (-1116.202) (-1118.991) [-1115.593] -- 0:00:25
587500 -- [-1115.359] (-1114.810) (-1115.318) (-1116.553) * (-1114.315) (-1116.546) [-1117.383] (-1119.750) -- 0:00:25
588000 -- [-1116.848] (-1115.460) (-1116.041) (-1114.608) * [-1116.275] (-1119.054) (-1116.064) (-1115.749) -- 0:00:25
588500 -- (-1116.792) (-1113.893) (-1118.022) [-1114.256] * [-1114.429] (-1119.042) (-1114.289) (-1116.576) -- 0:00:25
589000 -- (-1121.127) [-1115.178] (-1115.659) (-1114.465) * [-1113.682] (-1113.614) (-1115.696) (-1113.587) -- 0:00:25
589500 -- (-1126.993) (-1115.041) [-1114.975] (-1115.295) * (-1114.509) (-1113.763) (-1116.910) [-1116.260] -- 0:00:25
590000 -- (-1119.652) [-1119.871] (-1115.180) (-1116.307) * (-1116.582) (-1116.002) [-1118.534] (-1115.863) -- 0:00:25
Average standard deviation of split frequencies: 0.008380
590500 -- (-1115.692) (-1118.678) [-1116.206] (-1117.615) * (-1124.193) (-1115.563) [-1115.172] (-1114.922) -- 0:00:25
591000 -- [-1117.483] (-1115.940) (-1119.440) (-1115.251) * [-1114.611] (-1115.304) (-1115.747) (-1117.926) -- 0:00:25
591500 -- [-1116.716] (-1116.290) (-1114.135) (-1117.604) * (-1113.592) [-1116.662] (-1115.091) (-1116.971) -- 0:00:25
592000 -- [-1114.407] (-1116.753) (-1117.103) (-1120.387) * (-1116.433) (-1115.987) [-1117.545] (-1115.472) -- 0:00:25
592500 -- (-1114.478) (-1114.917) (-1116.434) [-1114.347] * [-1114.983] (-1114.754) (-1116.021) (-1117.540) -- 0:00:25
593000 -- [-1116.431] (-1121.077) (-1114.508) (-1114.620) * (-1115.508) (-1114.990) (-1121.852) [-1115.206] -- 0:00:25
593500 -- [-1114.988] (-1116.280) (-1115.178) (-1114.250) * [-1119.555] (-1113.946) (-1119.207) (-1114.983) -- 0:00:25
594000 -- (-1115.320) [-1114.898] (-1114.239) (-1115.711) * (-1114.927) (-1116.436) (-1120.873) [-1115.586] -- 0:00:25
594500 -- (-1116.142) (-1117.177) (-1114.145) [-1114.775] * (-1114.488) [-1114.620] (-1114.857) (-1116.809) -- 0:00:25
595000 -- [-1114.664] (-1116.433) (-1116.066) (-1113.906) * (-1114.783) [-1115.190] (-1114.753) (-1114.137) -- 0:00:25
Average standard deviation of split frequencies: 0.008206
595500 -- (-1113.922) [-1114.107] (-1116.399) (-1114.064) * (-1115.876) [-1114.540] (-1118.288) (-1114.185) -- 0:00:25
596000 -- (-1118.800) [-1115.926] (-1116.341) (-1115.759) * (-1115.611) [-1113.402] (-1117.411) (-1115.584) -- 0:00:25
596500 -- (-1114.270) (-1120.196) (-1119.054) [-1114.912] * (-1118.757) (-1113.716) [-1115.606] (-1114.065) -- 0:00:25
597000 -- [-1116.265] (-1115.857) (-1117.657) (-1116.754) * [-1114.898] (-1114.992) (-1116.870) (-1113.707) -- 0:00:24
597500 -- (-1114.633) (-1114.669) [-1115.443] (-1119.166) * (-1117.036) (-1115.613) [-1113.656] (-1116.073) -- 0:00:24
598000 -- (-1116.350) [-1114.173] (-1113.630) (-1122.292) * (-1113.841) [-1116.175] (-1114.200) (-1119.855) -- 0:00:24
598500 -- [-1115.035] (-1121.169) (-1117.952) (-1117.391) * (-1114.401) (-1114.360) (-1118.653) [-1118.537] -- 0:00:24
599000 -- (-1115.183) (-1121.232) [-1116.829] (-1116.496) * (-1113.839) (-1116.366) [-1114.416] (-1118.037) -- 0:00:24
599500 -- (-1116.353) [-1117.286] (-1117.801) (-1114.430) * (-1114.841) (-1116.968) (-1116.018) [-1115.366] -- 0:00:24
600000 -- (-1113.781) (-1115.116) [-1114.526] (-1116.021) * [-1115.966] (-1115.108) (-1119.668) (-1114.039) -- 0:00:24
Average standard deviation of split frequencies: 0.008267
600500 -- [-1116.762] (-1114.995) (-1114.534) (-1115.783) * (-1114.093) (-1114.732) (-1115.762) [-1115.333] -- 0:00:24
601000 -- (-1117.603) [-1116.965] (-1115.618) (-1117.589) * (-1114.696) (-1117.242) (-1115.344) [-1114.246] -- 0:00:24
601500 -- (-1116.456) (-1113.833) [-1115.937] (-1114.293) * (-1116.415) (-1114.530) [-1117.004] (-1115.429) -- 0:00:24
602000 -- [-1115.731] (-1115.154) (-1114.902) (-1117.131) * (-1115.774) [-1114.530] (-1113.853) (-1116.001) -- 0:00:24
602500 -- (-1120.531) [-1121.117] (-1116.716) (-1117.505) * [-1113.867] (-1114.648) (-1113.793) (-1117.382) -- 0:00:24
603000 -- (-1117.378) (-1118.704) [-1117.898] (-1114.978) * [-1115.444] (-1114.665) (-1113.907) (-1116.141) -- 0:00:24
603500 -- [-1115.880] (-1114.466) (-1116.886) (-1119.647) * (-1116.260) (-1114.192) (-1115.739) [-1115.443] -- 0:00:24
604000 -- (-1116.667) [-1115.561] (-1118.687) (-1117.458) * (-1116.214) [-1114.446] (-1115.739) (-1114.555) -- 0:00:24
604500 -- (-1114.731) [-1114.804] (-1114.608) (-1118.370) * (-1113.953) (-1114.754) [-1113.452] (-1116.961) -- 0:00:24
605000 -- (-1115.249) (-1115.888) [-1120.017] (-1116.716) * (-1113.702) (-1116.639) [-1113.454] (-1116.605) -- 0:00:24
Average standard deviation of split frequencies: 0.008246
605500 -- (-1116.457) (-1116.785) (-1117.018) [-1115.426] * (-1117.133) (-1115.934) [-1113.392] (-1113.984) -- 0:00:24
606000 -- (-1117.368) [-1115.021] (-1116.361) (-1117.673) * (-1115.487) (-1114.241) [-1113.464] (-1115.366) -- 0:00:24
606500 -- [-1116.399] (-1115.377) (-1116.765) (-1115.324) * (-1115.492) [-1113.620] (-1117.683) (-1118.213) -- 0:00:24
607000 -- (-1115.467) [-1114.742] (-1117.701) (-1115.311) * [-1115.287] (-1113.895) (-1115.427) (-1115.258) -- 0:00:24
607500 -- (-1114.865) [-1116.102] (-1115.940) (-1115.770) * [-1116.828] (-1116.548) (-1116.763) (-1115.564) -- 0:00:24
608000 -- (-1113.885) (-1115.956) (-1115.301) [-1115.008] * (-1115.444) (-1116.613) (-1116.235) [-1114.044] -- 0:00:24
608500 -- (-1113.911) [-1116.871] (-1116.447) (-1115.749) * [-1115.789] (-1114.864) (-1116.583) (-1117.957) -- 0:00:24
609000 -- (-1114.607) (-1118.387) (-1115.340) [-1113.843] * (-1113.983) (-1115.852) [-1115.782] (-1114.960) -- 0:00:24
609500 -- (-1113.607) (-1120.301) (-1115.820) [-1115.618] * (-1116.027) [-1114.737] (-1121.453) (-1114.980) -- 0:00:24
610000 -- (-1115.436) (-1113.694) (-1115.483) [-1117.108] * (-1116.895) [-1115.270] (-1114.350) (-1114.949) -- 0:00:24
Average standard deviation of split frequencies: 0.007874
610500 -- [-1114.180] (-1115.871) (-1117.293) (-1114.584) * (-1118.314) (-1115.724) [-1116.487] (-1115.107) -- 0:00:24
611000 -- (-1115.688) (-1113.970) [-1116.671] (-1115.830) * (-1117.365) (-1115.546) (-1115.435) [-1114.406] -- 0:00:24
611500 -- [-1113.674] (-1116.611) (-1114.865) (-1117.127) * (-1114.783) (-1114.024) [-1116.568] (-1116.596) -- 0:00:24
612000 -- (-1117.380) (-1113.899) [-1114.301] (-1117.592) * (-1113.610) (-1115.300) [-1114.106] (-1116.313) -- 0:00:24
612500 -- (-1113.901) (-1113.520) (-1114.035) [-1116.001] * (-1116.019) [-1114.858] (-1114.395) (-1116.254) -- 0:00:24
613000 -- (-1114.945) [-1115.799] (-1115.771) (-1114.652) * (-1114.267) [-1116.009] (-1115.985) (-1117.013) -- 0:00:23
613500 -- (-1116.283) (-1115.154) (-1115.737) [-1116.334] * (-1114.660) (-1115.262) [-1115.655] (-1116.497) -- 0:00:23
614000 -- (-1119.100) [-1114.214] (-1115.349) (-1115.107) * [-1113.962] (-1117.789) (-1118.499) (-1114.650) -- 0:00:23
614500 -- [-1118.926] (-1114.544) (-1118.041) (-1114.242) * (-1116.190) [-1118.435] (-1116.060) (-1114.931) -- 0:00:23
615000 -- (-1117.720) (-1116.715) [-1114.752] (-1115.028) * (-1114.754) [-1120.431] (-1116.938) (-1113.528) -- 0:00:23
Average standard deviation of split frequencies: 0.007806
615500 -- (-1115.628) [-1115.313] (-1115.317) (-1114.500) * (-1116.229) [-1114.378] (-1115.737) (-1114.699) -- 0:00:23
616000 -- [-1115.284] (-1116.736) (-1117.359) (-1116.324) * (-1115.132) (-1116.265) (-1114.559) [-1117.459] -- 0:00:23
616500 -- (-1117.743) (-1118.772) [-1121.276] (-1118.658) * (-1114.949) (-1116.805) [-1114.078] (-1116.220) -- 0:00:23
617000 -- (-1114.984) (-1116.592) [-1118.200] (-1120.262) * [-1115.458] (-1116.374) (-1116.745) (-1117.470) -- 0:00:23
617500 -- [-1119.014] (-1117.424) (-1118.138) (-1117.919) * (-1116.699) [-1116.215] (-1119.651) (-1115.193) -- 0:00:23
618000 -- (-1116.057) [-1114.105] (-1113.583) (-1116.460) * [-1114.941] (-1116.588) (-1117.298) (-1117.513) -- 0:00:23
618500 -- [-1116.377] (-1115.601) (-1117.294) (-1114.865) * (-1116.539) (-1116.337) (-1117.162) [-1115.254] -- 0:00:23
619000 -- (-1117.025) [-1116.089] (-1118.383) (-1118.336) * (-1115.738) (-1113.901) [-1117.098] (-1113.498) -- 0:00:23
619500 -- (-1115.238) (-1116.759) [-1115.322] (-1116.738) * [-1113.964] (-1116.770) (-1118.964) (-1114.096) -- 0:00:23
620000 -- (-1115.384) (-1116.863) [-1117.178] (-1118.885) * (-1115.555) (-1113.955) [-1115.462] (-1117.236) -- 0:00:23
Average standard deviation of split frequencies: 0.007848
620500 -- (-1116.293) (-1117.707) (-1125.138) [-1116.358] * (-1118.773) (-1114.099) [-1115.893] (-1118.597) -- 0:00:23
621000 -- (-1115.335) [-1116.068] (-1115.208) (-1115.543) * (-1118.230) [-1113.515] (-1117.475) (-1117.421) -- 0:00:23
621500 -- (-1117.019) [-1115.041] (-1118.512) (-1114.014) * [-1113.748] (-1113.633) (-1113.515) (-1114.994) -- 0:00:23
622000 -- (-1114.062) (-1117.840) (-1118.754) [-1114.929] * (-1114.565) (-1115.553) [-1113.546] (-1114.598) -- 0:00:23
622500 -- (-1116.911) (-1119.312) [-1116.798] (-1115.556) * (-1113.734) [-1117.306] (-1113.861) (-1116.234) -- 0:00:23
623000 -- (-1114.395) [-1117.317] (-1118.298) (-1114.111) * [-1116.657] (-1119.185) (-1113.861) (-1116.721) -- 0:00:23
623500 -- (-1114.881) [-1116.251] (-1116.283) (-1118.670) * (-1116.781) (-1118.380) [-1114.750] (-1117.875) -- 0:00:23
624000 -- (-1114.848) [-1114.886] (-1117.348) (-1118.849) * (-1114.526) (-1114.116) (-1114.511) [-1114.767] -- 0:00:23
624500 -- (-1118.171) (-1116.467) (-1116.528) [-1117.567] * (-1114.190) (-1115.509) [-1113.829] (-1114.828) -- 0:00:23
625000 -- (-1115.876) (-1121.227) (-1116.496) [-1116.104] * (-1116.498) [-1115.510] (-1114.124) (-1114.892) -- 0:00:23
Average standard deviation of split frequencies: 0.007530
625500 -- (-1115.880) [-1117.129] (-1114.373) (-1116.039) * (-1115.052) (-1116.530) (-1113.337) [-1114.067] -- 0:00:23
626000 -- (-1117.962) [-1117.341] (-1113.829) (-1118.616) * [-1114.737] (-1117.147) (-1113.786) (-1115.317) -- 0:00:23
626500 -- [-1114.580] (-1117.441) (-1120.538) (-1114.069) * (-1115.099) (-1116.608) [-1114.508] (-1115.312) -- 0:00:23
627000 -- (-1115.795) [-1122.458] (-1117.103) (-1114.911) * (-1117.515) [-1115.368] (-1114.067) (-1117.213) -- 0:00:23
627500 -- (-1115.903) [-1116.036] (-1118.857) (-1117.003) * (-1113.596) [-1117.056] (-1114.994) (-1115.909) -- 0:00:23
628000 -- (-1119.990) (-1115.761) (-1123.965) [-1116.673] * (-1117.241) (-1113.997) [-1115.786] (-1114.500) -- 0:00:23
628500 -- (-1114.572) [-1114.634] (-1118.862) (-1118.250) * (-1116.802) (-1114.322) [-1113.726] (-1117.979) -- 0:00:23
629000 -- (-1117.594) (-1114.531) [-1115.292] (-1114.266) * (-1116.964) (-1114.623) (-1113.790) [-1114.870] -- 0:00:23
629500 -- (-1116.362) [-1113.789] (-1117.111) (-1116.335) * (-1114.172) (-1114.113) [-1114.276] (-1117.465) -- 0:00:22
630000 -- (-1118.171) (-1116.130) [-1113.718] (-1118.188) * (-1115.136) (-1115.951) [-1115.928] (-1115.268) -- 0:00:22
Average standard deviation of split frequencies: 0.007774
630500 -- (-1114.888) (-1117.264) [-1114.060] (-1114.305) * [-1114.266] (-1117.134) (-1115.669) (-1115.840) -- 0:00:22
631000 -- (-1114.436) (-1116.207) (-1114.899) [-1115.628] * (-1114.863) (-1115.307) [-1114.646] (-1117.339) -- 0:00:22
631500 -- (-1114.166) (-1114.756) [-1113.890] (-1120.618) * (-1116.015) (-1114.862) [-1114.055] (-1116.243) -- 0:00:22
632000 -- [-1114.715] (-1114.767) (-1120.408) (-1115.594) * (-1114.734) (-1114.502) [-1113.768] (-1115.478) -- 0:00:22
632500 -- (-1114.154) [-1115.310] (-1115.894) (-1116.022) * [-1115.485] (-1116.320) (-1116.038) (-1116.773) -- 0:00:22
633000 -- (-1113.951) (-1115.344) (-1114.569) [-1117.590] * (-1117.994) (-1118.326) [-1117.956] (-1114.156) -- 0:00:22
633500 -- (-1113.764) [-1114.795] (-1122.109) (-1117.795) * [-1114.504] (-1113.866) (-1115.760) (-1115.135) -- 0:00:22
634000 -- (-1113.567) [-1115.776] (-1118.094) (-1114.538) * [-1115.844] (-1113.789) (-1116.631) (-1114.457) -- 0:00:22
634500 -- (-1116.546) [-1115.338] (-1115.551) (-1114.767) * [-1114.084] (-1113.676) (-1117.629) (-1114.403) -- 0:00:22
635000 -- [-1115.427] (-1117.253) (-1116.268) (-1116.542) * (-1115.425) [-1114.572] (-1116.912) (-1114.852) -- 0:00:22
Average standard deviation of split frequencies: 0.007116
635500 -- [-1114.244] (-1117.516) (-1113.532) (-1114.155) * [-1116.271] (-1117.771) (-1115.554) (-1115.067) -- 0:00:22
636000 -- (-1121.862) (-1114.865) [-1115.182] (-1114.960) * [-1116.610] (-1115.828) (-1116.656) (-1116.812) -- 0:00:22
636500 -- (-1117.230) (-1117.948) [-1114.879] (-1115.526) * (-1114.357) (-1114.760) (-1114.775) [-1114.278] -- 0:00:22
637000 -- (-1114.220) (-1116.024) (-1116.831) [-1113.880] * (-1116.401) [-1117.525] (-1118.116) (-1116.277) -- 0:00:22
637500 -- [-1115.448] (-1120.182) (-1116.553) (-1113.995) * (-1116.804) [-1116.796] (-1115.541) (-1115.231) -- 0:00:22
638000 -- (-1116.755) (-1121.574) (-1116.926) [-1114.757] * (-1118.491) (-1116.927) (-1116.590) [-1116.587] -- 0:00:22
638500 -- (-1115.413) [-1117.060] (-1116.248) (-1115.643) * [-1116.638] (-1116.982) (-1114.289) (-1116.139) -- 0:00:22
639000 -- [-1120.511] (-1116.806) (-1115.850) (-1115.648) * (-1115.943) (-1113.256) [-1114.889] (-1116.548) -- 0:00:22
639500 -- (-1117.028) [-1117.426] (-1117.067) (-1115.241) * [-1114.784] (-1115.040) (-1113.635) (-1115.724) -- 0:00:22
640000 -- (-1117.494) (-1114.408) (-1117.932) [-1116.731] * (-1118.199) (-1117.045) (-1113.842) [-1114.784] -- 0:00:22
Average standard deviation of split frequencies: 0.006671
640500 -- (-1114.981) [-1114.770] (-1114.427) (-1115.757) * (-1115.969) (-1117.224) (-1115.662) [-1115.562] -- 0:00:22
641000 -- (-1115.790) (-1116.540) (-1115.078) [-1113.935] * (-1115.268) (-1114.947) (-1118.178) [-1115.941] -- 0:00:22
641500 -- (-1114.962) (-1115.709) (-1118.075) [-1114.798] * (-1116.163) (-1117.734) [-1115.862] (-1114.125) -- 0:00:22
642000 -- (-1115.641) (-1114.338) (-1115.176) [-1115.398] * (-1117.692) [-1117.316] (-1116.033) (-1113.758) -- 0:00:22
642500 -- (-1115.552) [-1113.977] (-1114.140) (-1114.449) * (-1113.778) (-1122.704) (-1113.945) [-1115.788] -- 0:00:22
643000 -- (-1114.921) [-1116.415] (-1114.544) (-1114.249) * (-1115.017) [-1116.762] (-1117.240) (-1114.910) -- 0:00:22
643500 -- (-1115.263) (-1115.296) [-1116.282] (-1116.435) * (-1114.719) (-1119.919) (-1115.816) [-1115.483] -- 0:00:22
644000 -- (-1118.315) [-1115.722] (-1114.022) (-1118.249) * (-1114.488) (-1116.276) [-1118.666] (-1114.787) -- 0:00:22
644500 -- (-1116.894) (-1115.814) [-1114.569] (-1124.838) * [-1114.842] (-1117.267) (-1116.375) (-1116.396) -- 0:00:22
645000 -- (-1114.675) (-1118.044) (-1114.464) [-1116.183] * [-1114.481] (-1118.500) (-1117.150) (-1113.959) -- 0:00:22
Average standard deviation of split frequencies: 0.006750
645500 -- (-1115.483) (-1115.778) (-1116.851) [-1115.035] * (-1115.711) [-1119.433] (-1113.870) (-1113.725) -- 0:00:21
646000 -- (-1115.174) (-1115.158) [-1115.569] (-1117.374) * [-1114.371] (-1114.594) (-1115.497) (-1114.828) -- 0:00:21
646500 -- [-1114.541] (-1114.384) (-1114.636) (-1120.582) * (-1115.612) (-1114.587) (-1116.532) [-1115.186] -- 0:00:21
647000 -- (-1114.953) (-1115.522) [-1119.527] (-1117.911) * (-1115.540) (-1116.139) [-1115.624] (-1114.669) -- 0:00:21
647500 -- (-1117.733) [-1115.662] (-1115.082) (-1117.201) * [-1114.777] (-1113.895) (-1117.551) (-1114.804) -- 0:00:21
648000 -- (-1115.678) (-1115.517) [-1115.206] (-1114.613) * (-1114.269) (-1116.198) [-1113.599] (-1116.766) -- 0:00:21
648500 -- (-1120.107) (-1117.308) [-1116.861] (-1120.570) * [-1113.674] (-1115.219) (-1114.017) (-1115.805) -- 0:00:21
649000 -- [-1117.489] (-1114.369) (-1117.671) (-1114.185) * (-1115.587) (-1114.626) (-1117.503) [-1115.883] -- 0:00:21
649500 -- (-1115.441) (-1114.539) [-1114.710] (-1115.361) * (-1116.929) (-1115.068) [-1117.179] (-1115.589) -- 0:00:21
650000 -- (-1115.940) [-1118.675] (-1118.326) (-1115.545) * (-1117.928) (-1114.120) (-1118.834) [-1114.401] -- 0:00:21
Average standard deviation of split frequencies: 0.007426
650500 -- (-1117.222) (-1121.337) (-1115.059) [-1114.753] * (-1117.138) (-1115.028) (-1116.859) [-1115.258] -- 0:00:21
651000 -- (-1118.095) [-1114.224] (-1114.513) (-1114.037) * (-1115.645) (-1114.890) (-1114.312) [-1116.595] -- 0:00:21
651500 -- (-1115.842) (-1114.318) (-1114.957) [-1115.669] * (-1115.857) (-1116.902) (-1115.354) [-1118.186] -- 0:00:21
652000 -- (-1114.483) (-1116.384) (-1114.302) [-1116.642] * (-1117.115) (-1115.522) (-1114.689) [-1114.591] -- 0:00:21
652500 -- (-1118.100) (-1115.085) [-1115.371] (-1115.443) * (-1115.676) (-1114.569) (-1113.813) [-1115.717] -- 0:00:21
653000 -- [-1115.436] (-1115.604) (-1119.358) (-1116.898) * (-1115.175) (-1116.364) [-1114.475] (-1117.813) -- 0:00:21
653500 -- (-1114.089) [-1114.173] (-1118.820) (-1115.499) * (-1115.761) (-1117.555) (-1116.765) [-1115.188] -- 0:00:21
654000 -- (-1114.902) (-1116.949) [-1117.026] (-1115.627) * (-1113.719) (-1117.132) (-1114.827) [-1117.593] -- 0:00:21
654500 -- (-1115.022) [-1115.977] (-1115.099) (-1114.182) * (-1117.722) (-1118.451) (-1117.009) [-1118.001] -- 0:00:21
655000 -- (-1116.249) [-1116.839] (-1117.174) (-1118.692) * (-1117.000) [-1118.841] (-1118.161) (-1115.200) -- 0:00:21
Average standard deviation of split frequencies: 0.007713
655500 -- [-1115.737] (-1115.622) (-1115.675) (-1118.335) * (-1115.842) (-1117.193) [-1116.030] (-1115.443) -- 0:00:21
656000 -- (-1115.459) [-1114.596] (-1117.201) (-1123.305) * (-1118.244) (-1116.776) [-1116.747] (-1116.937) -- 0:00:21
656500 -- (-1118.335) [-1113.481] (-1118.157) (-1124.072) * [-1116.900] (-1114.813) (-1118.147) (-1114.740) -- 0:00:21
657000 -- [-1114.015] (-1116.627) (-1115.406) (-1117.277) * (-1119.133) (-1116.631) [-1115.543] (-1119.946) -- 0:00:21
657500 -- (-1114.932) (-1114.633) [-1114.484] (-1114.732) * (-1114.785) [-1115.048] (-1114.506) (-1115.674) -- 0:00:21
658000 -- (-1114.788) [-1114.868] (-1115.356) (-1116.286) * (-1115.041) (-1118.101) [-1114.236] (-1128.353) -- 0:00:21
658500 -- (-1117.781) [-1115.251] (-1115.029) (-1116.160) * (-1117.967) (-1115.840) [-1116.372] (-1115.790) -- 0:00:21
659000 -- [-1116.006] (-1116.448) (-1115.009) (-1120.285) * (-1118.265) [-1115.867] (-1114.912) (-1115.182) -- 0:00:21
659500 -- [-1116.839] (-1116.347) (-1114.127) (-1118.078) * (-1118.317) (-1118.099) [-1114.555] (-1115.983) -- 0:00:21
660000 -- (-1114.824) [-1115.119] (-1115.904) (-1117.112) * (-1117.324) (-1115.786) (-1114.665) [-1114.385] -- 0:00:21
Average standard deviation of split frequencies: 0.007849
660500 -- (-1123.697) (-1119.466) [-1113.337] (-1115.561) * (-1114.272) (-1117.001) [-1114.411] (-1114.389) -- 0:00:21
661000 -- [-1117.745] (-1115.697) (-1115.381) (-1117.588) * (-1118.033) [-1115.511] (-1114.396) (-1114.284) -- 0:00:21
661500 -- (-1115.748) (-1121.691) [-1115.360] (-1118.357) * (-1118.794) (-1115.867) (-1118.386) [-1114.028] -- 0:00:20
662000 -- (-1114.524) (-1114.733) (-1115.608) [-1115.295] * (-1113.871) [-1113.658] (-1117.220) (-1113.817) -- 0:00:20
662500 -- (-1115.223) (-1115.360) [-1117.997] (-1115.824) * (-1114.201) (-1113.347) (-1119.910) [-1115.498] -- 0:00:20
663000 -- [-1116.319] (-1116.493) (-1117.897) (-1113.937) * (-1114.287) (-1115.538) [-1120.337] (-1114.169) -- 0:00:20
663500 -- (-1116.251) (-1118.312) (-1114.521) [-1115.093] * [-1113.567] (-1114.943) (-1117.929) (-1114.826) -- 0:00:20
664000 -- (-1116.346) [-1115.877] (-1116.167) (-1113.756) * (-1114.590) (-1116.431) [-1113.288] (-1122.483) -- 0:00:20
664500 -- [-1115.115] (-1117.021) (-1116.477) (-1115.932) * (-1116.092) (-1115.581) [-1117.522] (-1115.254) -- 0:00:20
665000 -- (-1115.279) (-1115.643) (-1113.804) [-1114.607] * (-1116.519) (-1114.381) (-1119.604) [-1115.051] -- 0:00:20
Average standard deviation of split frequencies: 0.007786
665500 -- (-1115.826) (-1115.740) [-1113.785] (-1114.874) * (-1115.399) (-1114.534) [-1114.599] (-1114.769) -- 0:00:20
666000 -- (-1114.426) (-1115.314) [-1114.272] (-1115.775) * (-1113.798) [-1114.319] (-1115.648) (-1115.374) -- 0:00:20
666500 -- (-1116.732) (-1115.577) [-1113.813] (-1116.030) * [-1115.015] (-1115.043) (-1114.831) (-1117.473) -- 0:00:20
667000 -- [-1114.952] (-1116.816) (-1120.639) (-1115.959) * (-1116.753) [-1115.918] (-1115.078) (-1117.478) -- 0:00:20
667500 -- (-1116.364) [-1118.242] (-1116.034) (-1116.334) * (-1116.922) (-1115.519) [-1114.775] (-1116.130) -- 0:00:20
668000 -- (-1114.688) (-1116.101) (-1119.125) [-1119.879] * (-1117.513) [-1119.850] (-1115.037) (-1114.929) -- 0:00:20
668500 -- (-1113.767) (-1119.336) [-1114.450] (-1114.236) * (-1115.764) (-1115.203) [-1113.655] (-1116.028) -- 0:00:20
669000 -- (-1115.220) (-1122.915) (-1114.746) [-1115.199] * [-1115.553] (-1114.719) (-1117.839) (-1114.977) -- 0:00:20
669500 -- (-1115.624) (-1123.066) [-1115.618] (-1119.066) * (-1117.578) (-1114.578) (-1114.630) [-1113.597] -- 0:00:20
670000 -- (-1115.268) (-1113.866) [-1114.923] (-1114.057) * (-1121.708) (-1119.747) (-1114.151) [-1116.100] -- 0:00:20
Average standard deviation of split frequencies: 0.007951
670500 -- (-1115.134) (-1116.919) [-1114.545] (-1114.639) * (-1115.777) [-1116.135] (-1117.239) (-1115.935) -- 0:00:20
671000 -- (-1115.933) (-1114.463) (-1113.959) [-1115.980] * (-1115.430) (-1115.348) [-1114.402] (-1114.515) -- 0:00:20
671500 -- (-1115.568) (-1114.943) (-1114.418) [-1116.423] * (-1114.313) (-1114.844) [-1117.297] (-1115.589) -- 0:00:20
672000 -- (-1115.148) [-1115.650] (-1113.587) (-1114.748) * [-1113.978] (-1114.719) (-1117.122) (-1115.675) -- 0:00:20
672500 -- (-1115.896) [-1119.372] (-1113.851) (-1114.823) * (-1117.893) (-1117.275) [-1116.215] (-1117.588) -- 0:00:20
673000 -- [-1114.557] (-1118.641) (-1116.787) (-1115.468) * (-1119.216) (-1114.558) (-1116.898) [-1118.963] -- 0:00:20
673500 -- (-1115.688) (-1116.553) [-1116.509] (-1116.802) * (-1115.810) (-1114.244) (-1114.134) [-1118.831] -- 0:00:20
674000 -- (-1113.287) [-1115.556] (-1120.948) (-1116.710) * (-1113.484) [-1116.458] (-1116.941) (-1116.443) -- 0:00:20
674500 -- [-1113.578] (-1116.385) (-1114.692) (-1116.033) * (-1113.586) (-1114.753) [-1115.016] (-1121.039) -- 0:00:20
675000 -- (-1120.157) (-1119.388) (-1116.461) [-1115.257] * (-1117.117) (-1113.425) [-1114.933] (-1117.408) -- 0:00:20
Average standard deviation of split frequencies: 0.007671
675500 -- [-1115.117] (-1114.013) (-1118.862) (-1114.931) * (-1116.468) (-1114.594) [-1114.959] (-1116.706) -- 0:00:20
676000 -- (-1119.852) (-1118.075) (-1118.117) [-1115.884] * (-1115.300) (-1114.919) [-1118.572] (-1115.987) -- 0:00:20
676500 -- (-1116.238) [-1115.637] (-1115.752) (-1113.975) * (-1113.691) (-1114.041) [-1115.666] (-1116.092) -- 0:00:20
677000 -- [-1115.169] (-1114.718) (-1113.731) (-1115.291) * (-1114.780) [-1114.260] (-1116.750) (-1115.378) -- 0:00:20
677500 -- [-1117.397] (-1114.611) (-1113.469) (-1114.912) * [-1114.383] (-1113.611) (-1118.166) (-1114.808) -- 0:00:19
678000 -- (-1117.105) [-1115.049] (-1113.528) (-1117.125) * (-1114.903) (-1113.819) (-1118.398) [-1114.492] -- 0:00:19
678500 -- [-1115.695] (-1115.740) (-1114.657) (-1114.313) * (-1115.143) (-1114.014) (-1118.447) [-1113.660] -- 0:00:19
679000 -- (-1117.319) [-1115.044] (-1119.890) (-1114.334) * (-1114.984) [-1115.821] (-1118.127) (-1114.924) -- 0:00:19
679500 -- (-1118.523) [-1115.666] (-1118.594) (-1114.743) * (-1114.277) (-1115.859) [-1114.807] (-1113.693) -- 0:00:19
680000 -- (-1118.358) [-1115.281] (-1114.922) (-1116.215) * (-1118.504) [-1116.263] (-1114.545) (-1119.141) -- 0:00:19
Average standard deviation of split frequencies: 0.007229
680500 -- (-1114.937) (-1114.590) (-1114.801) [-1119.338] * (-1115.061) [-1114.385] (-1114.928) (-1117.210) -- 0:00:19
681000 -- (-1114.269) (-1119.118) (-1117.472) [-1116.035] * [-1115.734] (-1114.164) (-1114.296) (-1118.010) -- 0:00:19
681500 -- (-1115.514) [-1115.908] (-1116.983) (-1114.600) * [-1116.424] (-1114.540) (-1115.929) (-1116.356) -- 0:00:19
682000 -- (-1116.609) (-1115.002) (-1115.750) [-1114.228] * [-1115.911] (-1116.950) (-1117.135) (-1114.282) -- 0:00:19
682500 -- (-1117.175) (-1122.195) (-1115.812) [-1119.490] * [-1114.057] (-1114.344) (-1115.910) (-1114.754) -- 0:00:19
683000 -- (-1118.059) [-1122.613] (-1114.955) (-1115.003) * [-1114.180] (-1114.885) (-1115.670) (-1117.121) -- 0:00:19
683500 -- (-1116.489) (-1120.233) [-1114.336] (-1115.733) * (-1114.412) (-1114.692) (-1114.680) [-1114.989] -- 0:00:19
684000 -- [-1114.895] (-1121.467) (-1115.084) (-1115.565) * (-1115.369) (-1118.649) [-1114.477] (-1115.028) -- 0:00:19
684500 -- (-1115.898) (-1116.568) (-1116.683) [-1116.850] * (-1116.451) (-1114.315) (-1115.080) [-1114.793] -- 0:00:19
685000 -- (-1114.012) [-1116.302] (-1116.246) (-1116.169) * [-1121.761] (-1114.803) (-1115.018) (-1116.503) -- 0:00:19
Average standard deviation of split frequencies: 0.007001
685500 -- (-1116.525) (-1115.191) [-1114.716] (-1115.515) * (-1116.200) (-1116.918) [-1114.403] (-1117.475) -- 0:00:19
686000 -- (-1114.881) (-1115.305) [-1114.241] (-1116.379) * (-1115.923) [-1114.302] (-1115.871) (-1121.600) -- 0:00:19
686500 -- (-1115.056) (-1118.915) [-1114.542] (-1115.860) * (-1115.963) (-1114.356) (-1116.552) [-1119.139] -- 0:00:19
687000 -- (-1118.627) (-1117.698) (-1115.560) [-1115.285] * (-1115.131) [-1114.862] (-1121.009) (-1118.099) -- 0:00:19
687500 -- (-1116.874) (-1120.215) [-1115.711] (-1115.367) * (-1114.618) (-1114.828) (-1120.040) [-1114.866] -- 0:00:19
688000 -- (-1114.542) [-1114.801] (-1116.389) (-1118.353) * [-1115.873] (-1114.838) (-1114.029) (-1118.504) -- 0:00:19
688500 -- [-1114.327] (-1117.595) (-1115.471) (-1116.388) * (-1114.350) (-1114.247) [-1116.385] (-1117.411) -- 0:00:19
689000 -- (-1116.232) [-1118.365] (-1116.465) (-1114.857) * (-1115.019) (-1115.792) (-1114.460) [-1115.745] -- 0:00:19
689500 -- [-1115.233] (-1117.021) (-1116.713) (-1114.879) * (-1117.350) [-1116.052] (-1114.548) (-1115.097) -- 0:00:19
690000 -- (-1115.761) [-1114.753] (-1115.210) (-1117.227) * [-1115.765] (-1115.204) (-1114.314) (-1113.346) -- 0:00:19
Average standard deviation of split frequencies: 0.006697
690500 -- [-1117.412] (-1114.549) (-1118.339) (-1115.948) * (-1115.836) (-1117.710) [-1117.776] (-1116.711) -- 0:00:19
691000 -- [-1118.078] (-1116.992) (-1117.753) (-1114.356) * (-1115.448) [-1118.654] (-1115.661) (-1121.537) -- 0:00:19
691500 -- [-1116.999] (-1116.384) (-1114.564) (-1114.429) * (-1115.623) (-1118.751) (-1114.350) [-1117.286] -- 0:00:19
692000 -- [-1115.214] (-1118.994) (-1113.515) (-1117.804) * (-1114.660) (-1117.322) [-1113.897] (-1115.721) -- 0:00:19
692500 -- (-1116.596) [-1118.415] (-1116.947) (-1120.466) * (-1119.063) (-1114.797) (-1114.789) [-1113.788] -- 0:00:19
693000 -- [-1114.678] (-1116.224) (-1124.531) (-1120.845) * (-1117.608) (-1113.527) (-1114.747) [-1116.101] -- 0:00:19
693500 -- [-1115.462] (-1115.833) (-1123.213) (-1118.124) * (-1117.043) (-1113.908) (-1115.603) [-1118.239] -- 0:00:19
694000 -- (-1115.297) [-1113.944] (-1114.737) (-1116.823) * (-1116.660) [-1113.908] (-1115.088) (-1114.192) -- 0:00:18
694500 -- (-1113.604) (-1115.674) [-1117.368] (-1117.262) * [-1114.471] (-1115.070) (-1113.422) (-1116.939) -- 0:00:18
695000 -- (-1115.978) (-1116.233) (-1115.271) [-1113.889] * (-1113.313) [-1116.068] (-1113.426) (-1117.104) -- 0:00:18
Average standard deviation of split frequencies: 0.006985
695500 -- (-1114.639) [-1113.595] (-1115.874) (-1116.377) * (-1115.664) [-1114.693] (-1117.643) (-1118.090) -- 0:00:18
696000 -- [-1113.798] (-1116.271) (-1115.329) (-1117.919) * (-1116.677) [-1114.204] (-1117.588) (-1117.837) -- 0:00:18
696500 -- (-1114.970) (-1114.450) (-1117.761) [-1115.996] * (-1115.852) [-1114.472] (-1115.587) (-1114.189) -- 0:00:18
697000 -- (-1113.391) (-1114.155) (-1116.676) [-1115.214] * (-1115.811) [-1117.078] (-1119.403) (-1114.462) -- 0:00:18
697500 -- (-1114.098) (-1113.772) (-1117.385) [-1121.681] * (-1114.912) (-1117.721) [-1114.737] (-1114.060) -- 0:00:18
698000 -- (-1118.566) (-1116.739) [-1116.862] (-1118.983) * [-1115.949] (-1114.713) (-1115.623) (-1114.935) -- 0:00:18
698500 -- [-1117.258] (-1116.555) (-1115.350) (-1116.887) * [-1114.052] (-1114.807) (-1116.046) (-1113.973) -- 0:00:18
699000 -- (-1115.932) [-1116.267] (-1113.221) (-1116.473) * (-1114.532) [-1117.637] (-1116.347) (-1115.618) -- 0:00:18
699500 -- (-1117.959) [-1117.347] (-1114.222) (-1117.392) * [-1118.427] (-1118.304) (-1115.671) (-1115.618) -- 0:00:18
700000 -- (-1114.566) (-1114.523) (-1116.896) [-1114.573] * (-1116.450) (-1118.284) [-1113.836] (-1114.328) -- 0:00:18
Average standard deviation of split frequencies: 0.007401
700500 -- (-1114.995) (-1113.386) [-1114.719] (-1115.384) * (-1118.063) [-1114.884] (-1114.929) (-1114.397) -- 0:00:18
701000 -- (-1115.573) (-1115.304) [-1116.719] (-1114.338) * (-1119.019) (-1118.181) (-1120.620) [-1114.136] -- 0:00:18
701500 -- [-1113.545] (-1116.002) (-1115.674) (-1115.155) * (-1114.995) (-1115.638) (-1122.028) [-1116.339] -- 0:00:18
702000 -- [-1114.561] (-1117.734) (-1117.218) (-1115.250) * (-1115.842) (-1113.705) [-1115.276] (-1114.680) -- 0:00:18
702500 -- (-1116.511) [-1115.222] (-1116.997) (-1117.689) * (-1114.511) [-1116.248] (-1117.225) (-1113.334) -- 0:00:18
703000 -- (-1116.624) [-1116.114] (-1116.982) (-1117.556) * (-1115.858) (-1116.268) [-1114.084] (-1117.593) -- 0:00:18
703500 -- [-1115.486] (-1116.634) (-1114.878) (-1115.603) * [-1114.421] (-1116.171) (-1115.419) (-1119.164) -- 0:00:18
704000 -- (-1114.483) (-1117.941) (-1115.683) [-1115.259] * [-1117.409] (-1117.628) (-1115.068) (-1117.508) -- 0:00:18
704500 -- (-1114.629) (-1115.725) [-1115.029] (-1117.467) * (-1120.636) (-1116.057) [-1114.362] (-1114.959) -- 0:00:18
705000 -- (-1116.471) [-1115.731] (-1115.282) (-1113.994) * [-1115.656] (-1115.446) (-1114.040) (-1117.362) -- 0:00:18
Average standard deviation of split frequencies: 0.007804
705500 -- (-1114.902) [-1114.925] (-1116.650) (-1114.514) * (-1115.973) (-1117.515) (-1114.763) [-1117.383] -- 0:00:18
706000 -- (-1116.081) (-1117.586) [-1121.020] (-1113.973) * [-1115.559] (-1115.203) (-1115.383) (-1118.404) -- 0:00:18
706500 -- (-1118.350) (-1114.368) [-1116.221] (-1113.454) * (-1115.188) [-1117.188] (-1116.406) (-1116.225) -- 0:00:18
707000 -- (-1117.412) [-1113.959] (-1115.664) (-1113.776) * (-1114.066) [-1116.075] (-1115.743) (-1114.716) -- 0:00:18
707500 -- (-1114.633) (-1115.714) (-1118.860) [-1115.205] * (-1118.489) (-1114.178) [-1115.405] (-1114.538) -- 0:00:18
708000 -- (-1115.313) (-1113.974) (-1119.203) [-1115.100] * [-1114.925] (-1115.793) (-1119.483) (-1116.727) -- 0:00:18
708500 -- [-1114.576] (-1116.331) (-1115.743) (-1114.982) * [-1114.046] (-1115.994) (-1114.009) (-1115.837) -- 0:00:18
709000 -- (-1117.346) (-1113.762) [-1116.265] (-1114.221) * (-1114.604) (-1115.506) (-1117.363) [-1114.642] -- 0:00:18
709500 -- (-1117.002) [-1113.334] (-1116.046) (-1114.770) * (-1116.584) [-1114.083] (-1114.819) (-1117.338) -- 0:00:18
710000 -- [-1120.936] (-1113.315) (-1118.952) (-1114.156) * [-1115.052] (-1114.249) (-1114.298) (-1117.748) -- 0:00:17
Average standard deviation of split frequencies: 0.007753
710500 -- (-1114.619) (-1114.198) (-1114.447) [-1114.534] * (-1114.462) (-1117.310) (-1117.169) [-1118.045] -- 0:00:17
711000 -- (-1114.276) [-1118.163] (-1114.480) (-1115.642) * (-1116.665) (-1118.450) [-1114.971] (-1116.209) -- 0:00:17
711500 -- (-1116.700) (-1119.008) (-1116.352) [-1114.627] * (-1115.965) (-1115.127) [-1115.339] (-1117.074) -- 0:00:17
712000 -- (-1116.770) [-1114.733] (-1116.379) (-1115.084) * [-1114.283] (-1117.165) (-1113.991) (-1117.997) -- 0:00:17
712500 -- (-1115.582) (-1117.044) (-1115.601) [-1118.739] * (-1114.813) (-1115.646) (-1114.590) [-1114.388] -- 0:00:17
713000 -- [-1114.784] (-1114.833) (-1114.596) (-1118.654) * (-1116.879) [-1114.929] (-1115.897) (-1113.987) -- 0:00:17
713500 -- (-1115.317) (-1114.186) [-1113.893] (-1116.189) * [-1115.295] (-1117.812) (-1116.229) (-1113.878) -- 0:00:17
714000 -- (-1116.328) [-1115.452] (-1114.391) (-1117.858) * (-1115.042) [-1116.986] (-1114.537) (-1114.558) -- 0:00:17
714500 -- [-1118.092] (-1116.826) (-1113.828) (-1118.169) * (-1116.166) (-1116.598) (-1115.312) [-1114.083] -- 0:00:17
715000 -- (-1114.809) (-1114.531) (-1113.862) [-1114.983] * (-1121.428) (-1116.095) (-1113.634) [-1116.667] -- 0:00:17
Average standard deviation of split frequencies: 0.007571
715500 -- (-1114.737) [-1114.731] (-1115.362) (-1115.555) * [-1114.200] (-1116.334) (-1114.800) (-1115.610) -- 0:00:17
716000 -- (-1118.249) [-1117.223] (-1117.267) (-1116.144) * (-1115.867) [-1113.518] (-1114.251) (-1117.698) -- 0:00:17
716500 -- [-1115.055] (-1118.187) (-1116.550) (-1115.060) * [-1114.577] (-1115.159) (-1114.908) (-1116.030) -- 0:00:17
717000 -- (-1116.705) (-1113.952) (-1113.486) [-1114.463] * (-1116.740) (-1116.029) [-1114.101] (-1117.948) -- 0:00:17
717500 -- (-1113.716) (-1115.601) [-1114.676] (-1116.678) * (-1117.227) [-1116.611] (-1115.921) (-1114.260) -- 0:00:17
718000 -- (-1114.055) (-1120.469) (-1118.322) [-1115.609] * (-1116.347) (-1115.187) (-1116.087) [-1113.760] -- 0:00:17
718500 -- [-1113.707] (-1115.102) (-1113.708) (-1116.145) * (-1114.866) [-1115.441] (-1118.199) (-1114.058) -- 0:00:17
719000 -- (-1114.869) [-1114.991] (-1114.825) (-1120.190) * [-1113.634] (-1115.258) (-1117.417) (-1114.062) -- 0:00:17
719500 -- (-1114.828) (-1115.459) [-1116.313] (-1117.207) * (-1114.187) (-1117.594) (-1117.069) [-1113.730] -- 0:00:17
720000 -- [-1113.670] (-1115.416) (-1115.784) (-1114.711) * (-1113.900) [-1116.144] (-1116.024) (-1114.047) -- 0:00:17
Average standard deviation of split frequencies: 0.007318
720500 -- [-1113.788] (-1116.655) (-1116.664) (-1116.069) * (-1115.227) (-1114.078) [-1115.611] (-1116.418) -- 0:00:17
721000 -- (-1113.404) (-1114.310) (-1114.997) [-1117.230] * (-1114.105) (-1114.736) (-1114.650) [-1115.764] -- 0:00:17
721500 -- (-1115.027) (-1114.862) [-1114.991] (-1115.999) * [-1119.244] (-1114.961) (-1117.312) (-1116.431) -- 0:00:17
722000 -- [-1114.993] (-1115.350) (-1125.114) (-1122.060) * (-1114.602) (-1116.097) (-1117.171) [-1116.824] -- 0:00:17
722500 -- (-1114.205) (-1117.536) [-1114.515] (-1114.965) * (-1114.724) (-1116.865) (-1118.457) [-1118.514] -- 0:00:17
723000 -- (-1114.100) [-1115.237] (-1114.289) (-1115.128) * (-1113.700) (-1118.781) [-1117.057] (-1116.875) -- 0:00:17
723500 -- (-1113.926) (-1113.983) [-1113.795] (-1115.626) * (-1116.147) (-1118.423) [-1114.267] (-1115.802) -- 0:00:17
724000 -- (-1113.910) [-1113.408] (-1117.150) (-1115.101) * (-1116.670) (-1118.427) (-1115.698) [-1113.883] -- 0:00:17
724500 -- [-1113.932] (-1117.245) (-1117.946) (-1117.088) * (-1116.578) (-1119.344) [-1114.687] (-1115.636) -- 0:00:17
725000 -- [-1113.390] (-1114.741) (-1115.172) (-1113.992) * (-1117.456) (-1117.685) [-1116.521] (-1118.034) -- 0:00:17
Average standard deviation of split frequencies: 0.007508
725500 -- [-1114.996] (-1115.791) (-1113.272) (-1115.446) * (-1117.325) (-1114.581) [-1114.946] (-1118.362) -- 0:00:17
726000 -- (-1115.171) (-1115.147) (-1114.523) [-1116.123] * [-1116.526] (-1114.460) (-1114.351) (-1117.556) -- 0:00:16
726500 -- (-1115.169) (-1114.253) (-1114.439) [-1115.352] * (-1116.006) (-1114.436) [-1115.120] (-1116.374) -- 0:00:16
727000 -- [-1116.566] (-1114.241) (-1116.363) (-1113.765) * (-1115.653) [-1114.825] (-1115.585) (-1114.278) -- 0:00:16
727500 -- (-1115.163) (-1117.608) [-1114.831] (-1115.105) * (-1114.683) (-1117.414) [-1116.190] (-1116.252) -- 0:00:16
728000 -- (-1116.948) (-1114.154) [-1114.489] (-1120.001) * (-1116.743) [-1119.803] (-1114.158) (-1120.441) -- 0:00:16
728500 -- [-1115.888] (-1120.503) (-1116.366) (-1118.048) * (-1115.838) (-1113.662) [-1115.077] (-1115.405) -- 0:00:16
729000 -- (-1117.656) [-1116.552] (-1118.373) (-1115.301) * (-1115.025) [-1113.245] (-1116.799) (-1114.584) -- 0:00:16
729500 -- (-1114.133) (-1114.304) (-1119.164) [-1114.312] * [-1114.273] (-1115.218) (-1115.248) (-1113.767) -- 0:00:16
730000 -- (-1114.457) (-1116.943) (-1114.040) [-1117.188] * (-1114.664) [-1115.696] (-1115.993) (-1113.771) -- 0:00:16
Average standard deviation of split frequencies: 0.007863
730500 -- (-1114.472) (-1116.283) [-1114.380] (-1118.061) * [-1115.032] (-1116.271) (-1114.665) (-1115.580) -- 0:00:16
731000 -- (-1114.858) [-1113.552] (-1115.279) (-1115.692) * [-1115.921] (-1115.076) (-1114.951) (-1114.683) -- 0:00:16
731500 -- (-1115.175) [-1116.067] (-1118.696) (-1117.334) * (-1117.011) (-1121.583) [-1117.373] (-1114.120) -- 0:00:16
732000 -- (-1114.866) [-1115.494] (-1119.394) (-1113.986) * (-1115.630) (-1113.481) (-1122.271) [-1113.419] -- 0:00:16
732500 -- (-1118.255) (-1119.247) (-1115.624) [-1114.599] * (-1114.280) (-1115.971) [-1116.423] (-1114.045) -- 0:00:16
733000 -- (-1115.217) [-1117.404] (-1115.873) (-1114.024) * (-1119.720) (-1114.983) (-1115.115) [-1113.436] -- 0:00:16
733500 -- [-1113.944] (-1124.585) (-1113.936) (-1117.278) * (-1120.482) [-1115.170] (-1116.267) (-1117.879) -- 0:00:16
734000 -- (-1119.702) [-1115.691] (-1114.579) (-1115.835) * [-1115.993] (-1114.155) (-1113.907) (-1116.967) -- 0:00:16
734500 -- (-1117.585) [-1116.385] (-1114.032) (-1114.637) * (-1121.407) [-1114.229] (-1116.501) (-1118.401) -- 0:00:16
735000 -- [-1115.178] (-1115.490) (-1117.121) (-1115.133) * [-1119.398] (-1114.681) (-1118.785) (-1114.712) -- 0:00:16
Average standard deviation of split frequencies: 0.007726
735500 -- (-1114.759) [-1113.394] (-1114.013) (-1115.553) * (-1116.857) (-1115.520) (-1114.839) [-1115.114] -- 0:00:16
736000 -- (-1114.645) [-1117.406] (-1115.655) (-1117.270) * (-1114.720) (-1114.107) [-1114.849] (-1118.981) -- 0:00:16
736500 -- (-1115.548) [-1115.359] (-1115.826) (-1115.861) * (-1113.892) (-1119.275) [-1116.036] (-1117.139) -- 0:00:16
737000 -- [-1114.402] (-1114.406) (-1116.712) (-1114.315) * (-1113.984) (-1116.675) (-1115.559) [-1115.026] -- 0:00:16
737500 -- [-1114.984] (-1115.403) (-1115.833) (-1114.784) * (-1116.405) [-1114.854] (-1115.556) (-1115.683) -- 0:00:16
738000 -- [-1114.585] (-1115.041) (-1114.275) (-1116.939) * (-1118.446) (-1115.076) [-1114.102] (-1114.490) -- 0:00:16
738500 -- (-1118.840) (-1115.037) [-1114.520] (-1117.755) * (-1114.788) [-1116.157] (-1113.554) (-1117.391) -- 0:00:16
739000 -- (-1119.186) [-1116.156] (-1121.146) (-1116.965) * (-1113.615) [-1113.258] (-1113.712) (-1117.346) -- 0:00:16
739500 -- (-1115.169) (-1114.783) (-1119.638) [-1113.754] * (-1114.546) [-1114.147] (-1116.198) (-1113.815) -- 0:00:16
740000 -- (-1118.580) [-1115.614] (-1115.615) (-1115.091) * (-1113.405) (-1119.587) [-1115.462] (-1117.265) -- 0:00:16
Average standard deviation of split frequencies: 0.007213
740500 -- [-1117.774] (-1114.990) (-1114.597) (-1115.732) * (-1114.987) (-1118.807) (-1113.989) [-1117.730] -- 0:00:16
741000 -- [-1116.159] (-1117.079) (-1116.699) (-1115.816) * (-1114.501) (-1118.571) (-1114.398) [-1113.978] -- 0:00:16
741500 -- (-1114.537) (-1114.787) [-1115.844] (-1120.023) * (-1116.405) (-1116.101) (-1116.247) [-1114.129] -- 0:00:16
742000 -- (-1115.900) (-1114.565) (-1114.593) [-1114.631] * (-1116.299) (-1116.743) [-1118.367] (-1116.423) -- 0:00:15
742500 -- (-1116.989) (-1116.693) [-1115.326] (-1119.297) * (-1117.533) (-1117.602) (-1118.034) [-1118.798] -- 0:00:15
743000 -- (-1116.356) (-1118.696) (-1113.556) [-1116.545] * (-1115.149) (-1114.985) [-1115.758] (-1118.956) -- 0:00:15
743500 -- (-1117.347) (-1114.281) [-1113.649] (-1122.044) * (-1117.189) [-1113.767] (-1114.805) (-1116.312) -- 0:00:15
744000 -- (-1119.148) [-1113.890] (-1115.047) (-1114.571) * (-1120.905) [-1115.537] (-1114.901) (-1116.314) -- 0:00:15
744500 -- (-1114.144) [-1116.061] (-1114.273) (-1114.700) * (-1114.460) (-1116.373) (-1113.999) [-1116.092] -- 0:00:15
745000 -- (-1114.586) (-1116.182) [-1114.726] (-1115.772) * (-1115.226) (-1117.840) (-1118.029) [-1114.700] -- 0:00:15
Average standard deviation of split frequencies: 0.007543
745500 -- (-1114.948) (-1117.047) [-1120.269] (-1115.035) * (-1119.007) (-1114.377) [-1114.146] (-1113.552) -- 0:00:15
746000 -- (-1114.452) [-1114.400] (-1114.412) (-1116.763) * (-1114.532) [-1114.366] (-1117.477) (-1114.235) -- 0:00:15
746500 -- (-1114.509) [-1114.909] (-1121.176) (-1115.346) * (-1116.165) (-1120.524) (-1115.547) [-1116.104] -- 0:00:15
747000 -- [-1116.870] (-1115.327) (-1117.195) (-1115.422) * [-1114.078] (-1113.747) (-1118.549) (-1116.177) -- 0:00:15
747500 -- (-1116.542) (-1115.194) (-1116.082) [-1117.727] * (-1114.922) (-1114.500) (-1114.964) [-1114.408] -- 0:00:15
748000 -- [-1117.301] (-1114.513) (-1116.607) (-1117.721) * (-1115.598) [-1116.414] (-1115.579) (-1116.408) -- 0:00:15
748500 -- [-1115.990] (-1121.726) (-1114.374) (-1119.888) * [-1113.998] (-1114.135) (-1115.312) (-1115.009) -- 0:00:15
749000 -- [-1115.656] (-1114.101) (-1116.980) (-1113.571) * (-1119.051) [-1115.360] (-1117.884) (-1114.870) -- 0:00:15
749500 -- [-1115.224] (-1115.698) (-1117.242) (-1113.527) * (-1117.863) (-1116.270) [-1114.929] (-1115.646) -- 0:00:15
750000 -- (-1113.439) (-1117.170) [-1120.085] (-1114.161) * [-1116.582] (-1118.843) (-1114.832) (-1115.469) -- 0:00:15
Average standard deviation of split frequencies: 0.007300
750500 -- [-1113.344] (-1119.635) (-1116.751) (-1115.189) * [-1114.216] (-1116.040) (-1117.984) (-1115.777) -- 0:00:15
751000 -- (-1113.962) (-1119.508) [-1116.959] (-1115.199) * (-1114.259) (-1117.569) [-1114.571] (-1116.301) -- 0:00:15
751500 -- (-1114.670) [-1115.563] (-1120.571) (-1118.228) * [-1113.736] (-1118.281) (-1114.157) (-1115.077) -- 0:00:15
752000 -- (-1115.401) (-1114.297) [-1114.727] (-1116.876) * (-1121.483) (-1114.370) (-1113.410) [-1116.726] -- 0:00:15
752500 -- (-1115.076) (-1114.195) [-1116.697] (-1116.084) * (-1120.390) (-1113.814) (-1113.362) [-1114.184] -- 0:00:15
753000 -- (-1114.703) [-1113.858] (-1115.366) (-1115.563) * [-1114.977] (-1115.111) (-1116.020) (-1117.526) -- 0:00:15
753500 -- (-1114.873) [-1116.628] (-1115.787) (-1114.980) * (-1115.947) (-1115.948) (-1114.455) [-1115.409] -- 0:00:15
754000 -- (-1114.343) (-1115.392) [-1119.692] (-1115.057) * (-1115.137) [-1118.643] (-1121.984) (-1115.815) -- 0:00:15
754500 -- (-1114.395) (-1114.312) [-1115.508] (-1117.211) * (-1116.470) (-1117.706) (-1114.409) [-1114.781] -- 0:00:15
755000 -- (-1114.052) [-1115.204] (-1114.829) (-1116.832) * (-1114.765) (-1117.795) (-1118.648) [-1117.683] -- 0:00:15
Average standard deviation of split frequencies: 0.007561
755500 -- (-1114.324) (-1118.281) (-1118.676) [-1113.452] * (-1116.435) (-1114.987) [-1116.424] (-1114.263) -- 0:00:15
756000 -- (-1114.255) (-1115.870) [-1115.981] (-1113.470) * (-1116.072) (-1118.260) [-1114.795] (-1115.550) -- 0:00:15
756500 -- (-1114.055) (-1115.964) (-1115.508) [-1114.040] * (-1114.345) (-1114.145) (-1115.703) [-1114.142] -- 0:00:15
757000 -- [-1113.804] (-1116.944) (-1116.614) (-1113.959) * (-1115.429) (-1116.497) (-1114.652) [-1113.567] -- 0:00:15
757500 -- [-1114.975] (-1116.877) (-1114.523) (-1115.373) * (-1116.001) (-1113.989) [-1115.652] (-1113.639) -- 0:00:15
758000 -- (-1116.842) (-1115.982) (-1114.716) [-1119.317] * [-1116.580] (-1113.469) (-1113.776) (-1115.289) -- 0:00:15
758500 -- (-1113.557) (-1113.926) (-1116.044) [-1115.292] * (-1116.467) (-1113.371) [-1114.804] (-1114.287) -- 0:00:14
759000 -- [-1114.682] (-1114.490) (-1115.026) (-1115.321) * (-1117.413) [-1115.618] (-1115.481) (-1114.590) -- 0:00:14
759500 -- (-1115.990) (-1116.141) (-1114.639) [-1116.116] * (-1117.396) (-1115.690) (-1116.029) [-1115.308] -- 0:00:14
760000 -- (-1116.135) (-1116.585) (-1117.236) [-1115.574] * (-1115.131) (-1118.043) [-1114.036] (-1118.668) -- 0:00:14
Average standard deviation of split frequencies: 0.007321
760500 -- (-1116.595) (-1116.021) (-1116.249) [-1116.685] * [-1113.535] (-1115.728) (-1114.915) (-1117.613) -- 0:00:14
761000 -- (-1114.034) (-1115.526) [-1117.102] (-1114.673) * (-1113.655) [-1115.754] (-1115.458) (-1114.846) -- 0:00:14
761500 -- (-1116.015) (-1115.209) [-1118.955] (-1114.015) * (-1117.417) (-1117.011) (-1116.380) [-1115.073] -- 0:00:14
762000 -- [-1115.186] (-1115.703) (-1117.906) (-1115.657) * (-1114.806) (-1116.608) [-1115.693] (-1115.744) -- 0:00:14
762500 -- [-1114.258] (-1114.801) (-1119.939) (-1117.323) * [-1115.030] (-1121.055) (-1115.243) (-1116.501) -- 0:00:14
763000 -- (-1114.315) [-1116.026] (-1116.923) (-1116.750) * (-1118.663) (-1120.514) (-1114.903) [-1116.302] -- 0:00:14
763500 -- (-1115.299) (-1115.090) (-1114.650) [-1116.678] * (-1115.544) (-1117.324) (-1118.042) [-1117.192] -- 0:00:14
764000 -- (-1114.904) (-1117.136) [-1114.127] (-1120.062) * (-1115.346) (-1115.851) [-1115.651] (-1115.550) -- 0:00:14
764500 -- (-1113.628) (-1114.857) [-1114.784] (-1120.356) * (-1114.545) (-1114.848) [-1118.652] (-1120.950) -- 0:00:14
765000 -- (-1113.357) [-1116.829] (-1114.734) (-1115.833) * [-1114.757] (-1120.135) (-1117.902) (-1114.341) -- 0:00:14
Average standard deviation of split frequencies: 0.007270
765500 -- (-1113.625) (-1118.242) [-1115.119] (-1115.240) * (-1116.051) (-1115.404) (-1120.009) [-1114.550] -- 0:00:14
766000 -- (-1115.848) (-1114.734) [-1114.115] (-1115.196) * (-1115.792) (-1114.596) (-1117.705) [-1113.455] -- 0:00:14
766500 -- (-1113.864) (-1116.287) [-1113.821] (-1114.583) * [-1114.517] (-1114.124) (-1114.179) (-1113.936) -- 0:00:14
767000 -- (-1115.097) (-1114.304) [-1114.122] (-1115.562) * [-1114.501] (-1115.250) (-1120.673) (-1115.571) -- 0:00:14
767500 -- [-1114.912] (-1114.401) (-1116.865) (-1117.419) * (-1115.308) [-1114.090] (-1115.424) (-1115.249) -- 0:00:14
768000 -- (-1122.574) [-1115.746] (-1113.910) (-1120.533) * (-1115.931) (-1114.326) [-1116.319] (-1114.558) -- 0:00:14
768500 -- [-1117.479] (-1116.563) (-1119.749) (-1113.964) * (-1119.376) (-1115.173) [-1116.933] (-1119.869) -- 0:00:14
769000 -- (-1115.452) (-1116.757) (-1116.559) [-1114.258] * (-1113.861) (-1123.382) (-1117.208) [-1116.603] -- 0:00:14
769500 -- (-1114.757) (-1117.110) (-1119.179) [-1116.071] * [-1114.140] (-1120.141) (-1114.337) (-1114.288) -- 0:00:14
770000 -- (-1114.074) (-1119.211) [-1114.948] (-1116.858) * [-1115.741] (-1117.038) (-1114.675) (-1116.146) -- 0:00:14
Average standard deviation of split frequencies: 0.007226
770500 -- (-1117.511) (-1114.741) [-1117.181] (-1117.342) * (-1118.310) (-1114.417) (-1116.725) [-1116.766] -- 0:00:14
771000 -- (-1115.573) [-1115.990] (-1114.911) (-1116.032) * (-1117.048) (-1116.273) [-1117.481] (-1115.033) -- 0:00:14
771500 -- (-1118.201) (-1116.433) [-1115.003] (-1116.046) * [-1116.035] (-1118.717) (-1114.944) (-1116.226) -- 0:00:14
772000 -- (-1116.121) (-1119.740) [-1115.461] (-1116.210) * [-1117.075] (-1113.520) (-1117.108) (-1114.908) -- 0:00:14
772500 -- (-1119.615) [-1116.462] (-1118.648) (-1114.768) * (-1116.179) [-1113.662] (-1116.034) (-1114.259) -- 0:00:14
773000 -- [-1115.618] (-1114.536) (-1117.550) (-1113.705) * (-1117.890) [-1114.672] (-1119.884) (-1114.477) -- 0:00:14
773500 -- [-1115.329] (-1115.929) (-1114.755) (-1115.379) * (-1117.999) (-1115.618) [-1115.569] (-1113.528) -- 0:00:14
774000 -- (-1114.309) (-1117.108) (-1114.668) [-1114.856] * (-1119.285) (-1114.516) [-1115.382] (-1114.297) -- 0:00:14
774500 -- (-1114.050) [-1114.601] (-1114.566) (-1120.415) * (-1114.851) (-1115.648) (-1114.587) [-1114.435] -- 0:00:13
775000 -- (-1115.237) [-1117.163] (-1115.757) (-1114.577) * (-1117.372) [-1115.404] (-1115.151) (-1117.323) -- 0:00:13
Average standard deviation of split frequencies: 0.007480
775500 -- (-1115.404) [-1118.986] (-1118.832) (-1114.577) * (-1116.992) (-1120.853) (-1114.383) [-1114.271] -- 0:00:13
776000 -- (-1119.509) [-1115.445] (-1116.562) (-1114.045) * (-1115.607) (-1117.146) (-1115.745) [-1119.183] -- 0:00:13
776500 -- (-1119.341) [-1117.976] (-1114.374) (-1115.628) * (-1116.033) (-1118.421) [-1115.745] (-1116.076) -- 0:00:13
777000 -- (-1114.665) [-1115.013] (-1114.127) (-1115.301) * [-1115.905] (-1117.026) (-1117.120) (-1117.343) -- 0:00:13
777500 -- (-1115.751) (-1116.361) (-1113.865) [-1115.470] * (-1114.430) (-1115.096) [-1115.550] (-1117.378) -- 0:00:13
778000 -- (-1117.434) (-1115.478) (-1114.716) [-1117.233] * (-1116.944) [-1115.269] (-1116.570) (-1117.099) -- 0:00:13
778500 -- [-1115.713] (-1116.709) (-1115.604) (-1117.329) * [-1116.156] (-1115.948) (-1116.247) (-1115.252) -- 0:00:13
779000 -- (-1115.175) (-1113.471) [-1115.340] (-1115.320) * (-1116.945) (-1118.869) (-1116.791) [-1117.371] -- 0:00:13
779500 -- (-1114.400) [-1114.818] (-1118.713) (-1115.012) * (-1118.772) (-1115.308) [-1113.873] (-1115.897) -- 0:00:13
780000 -- [-1116.350] (-1117.032) (-1116.993) (-1116.901) * (-1115.589) (-1119.885) (-1116.504) [-1117.746] -- 0:00:13
Average standard deviation of split frequencies: 0.007133
780500 -- (-1115.537) (-1114.736) [-1116.671] (-1115.411) * (-1114.847) (-1115.581) [-1115.318] (-1114.994) -- 0:00:13
781000 -- (-1114.618) [-1113.659] (-1115.214) (-1115.412) * (-1116.532) [-1114.147] (-1115.015) (-1114.015) -- 0:00:13
781500 -- [-1114.185] (-1113.283) (-1114.154) (-1115.454) * (-1117.748) (-1114.262) (-1117.505) [-1115.811] -- 0:00:13
782000 -- (-1118.131) (-1113.452) (-1114.746) [-1117.359] * (-1117.730) [-1113.591] (-1116.766) (-1115.241) -- 0:00:13
782500 -- (-1117.994) [-1114.064] (-1115.758) (-1114.851) * (-1115.819) (-1115.308) [-1118.592] (-1115.271) -- 0:00:13
783000 -- (-1115.563) (-1113.359) (-1115.896) [-1114.754] * (-1116.980) [-1117.800] (-1118.655) (-1115.323) -- 0:00:13
783500 -- [-1115.758] (-1116.042) (-1116.247) (-1115.625) * (-1115.179) (-1115.283) [-1116.778] (-1114.540) -- 0:00:13
784000 -- (-1117.817) (-1114.931) [-1115.154] (-1116.768) * [-1115.125] (-1115.265) (-1116.134) (-1117.640) -- 0:00:13
784500 -- (-1116.847) (-1114.931) (-1118.310) [-1118.513] * (-1114.040) (-1113.625) (-1117.895) [-1114.572] -- 0:00:13
785000 -- (-1118.115) (-1113.797) (-1114.938) [-1115.115] * (-1114.449) (-1117.196) (-1114.278) [-1116.149] -- 0:00:13
Average standard deviation of split frequencies: 0.007085
785500 -- (-1118.525) (-1113.914) [-1114.274] (-1114.515) * (-1114.479) (-1114.523) (-1116.466) [-1114.234] -- 0:00:13
786000 -- (-1115.665) [-1113.934] (-1114.576) (-1116.121) * [-1115.306] (-1116.522) (-1115.872) (-1121.278) -- 0:00:13
786500 -- (-1114.899) [-1113.953] (-1114.247) (-1115.622) * (-1115.795) (-1119.093) (-1118.174) [-1114.984] -- 0:00:13
787000 -- [-1115.578] (-1115.576) (-1114.247) (-1114.965) * (-1115.055) (-1118.249) [-1113.913] (-1115.397) -- 0:00:13
787500 -- (-1113.623) (-1115.085) (-1117.977) [-1114.739] * (-1114.855) (-1118.086) [-1114.841] (-1116.937) -- 0:00:13
788000 -- (-1113.324) (-1115.785) [-1114.863] (-1114.516) * (-1116.084) (-1115.983) (-1116.283) [-1115.441] -- 0:00:13
788500 -- [-1115.222] (-1115.313) (-1116.300) (-1115.606) * [-1115.852] (-1115.076) (-1117.092) (-1115.346) -- 0:00:13
789000 -- [-1114.638] (-1118.263) (-1117.054) (-1116.803) * (-1115.451) [-1114.771] (-1114.396) (-1115.910) -- 0:00:13
789500 -- (-1118.150) (-1115.755) (-1115.719) [-1113.881] * [-1116.088] (-1114.542) (-1113.783) (-1117.257) -- 0:00:13
790000 -- (-1116.003) [-1115.325] (-1121.011) (-1113.583) * (-1116.273) [-1114.207] (-1113.319) (-1116.069) -- 0:00:13
Average standard deviation of split frequencies: 0.006596
790500 -- (-1114.782) (-1119.140) [-1122.490] (-1115.235) * (-1116.377) (-1115.615) [-1113.745] (-1115.355) -- 0:00:12
791000 -- (-1115.707) [-1115.836] (-1114.130) (-1117.999) * [-1113.494] (-1115.843) (-1114.439) (-1118.266) -- 0:00:12
791500 -- [-1116.002] (-1123.266) (-1117.620) (-1116.066) * (-1116.741) (-1115.787) (-1117.397) [-1118.866] -- 0:00:12
792000 -- [-1115.529] (-1120.438) (-1116.260) (-1117.844) * (-1115.363) (-1115.798) [-1116.759] (-1117.305) -- 0:00:12
792500 -- (-1118.709) (-1115.043) (-1115.434) [-1117.493] * (-1120.489) (-1113.949) [-1115.751] (-1118.979) -- 0:00:12
793000 -- (-1114.234) (-1113.776) [-1114.439] (-1117.584) * (-1114.361) (-1115.172) (-1115.392) [-1117.407] -- 0:00:12
793500 -- (-1114.262) [-1114.479] (-1119.955) (-1113.979) * [-1113.309] (-1114.359) (-1114.490) (-1115.689) -- 0:00:12
794000 -- (-1114.261) (-1114.875) [-1116.784] (-1115.600) * (-1114.782) (-1113.949) (-1115.377) [-1116.100] -- 0:00:12
794500 -- [-1115.312] (-1114.583) (-1117.574) (-1114.451) * (-1116.282) [-1114.030] (-1115.757) (-1119.325) -- 0:00:12
795000 -- (-1116.020) [-1114.505] (-1120.229) (-1113.603) * (-1115.726) (-1114.928) (-1116.103) [-1117.042] -- 0:00:12
Average standard deviation of split frequencies: 0.006218
795500 -- (-1115.876) (-1115.598) (-1115.965) [-1115.526] * (-1114.866) (-1119.310) [-1118.566] (-1116.648) -- 0:00:12
796000 -- (-1118.455) (-1115.301) [-1115.520] (-1114.674) * (-1115.190) (-1117.102) (-1115.475) [-1115.533] -- 0:00:12
796500 -- (-1115.871) [-1116.009] (-1115.627) (-1115.309) * (-1116.437) (-1116.092) (-1114.397) [-1117.155] -- 0:00:12
797000 -- (-1114.984) (-1120.213) [-1117.610] (-1115.297) * (-1114.228) (-1114.696) (-1114.140) [-1114.495] -- 0:00:12
797500 -- (-1119.602) (-1116.893) [-1115.522] (-1114.469) * [-1114.759] (-1115.780) (-1115.841) (-1114.125) -- 0:00:12
798000 -- (-1117.129) [-1115.422] (-1118.073) (-1114.503) * [-1115.022] (-1115.130) (-1114.778) (-1114.441) -- 0:00:12
798500 -- (-1121.306) (-1118.935) [-1115.364] (-1114.293) * (-1113.877) [-1117.990] (-1115.837) (-1116.162) -- 0:00:12
799000 -- (-1115.657) [-1117.479] (-1115.015) (-1114.268) * (-1114.703) (-1116.280) [-1114.689] (-1114.665) -- 0:00:12
799500 -- [-1114.476] (-1117.904) (-1115.557) (-1115.995) * (-1115.109) (-1120.279) [-1115.974] (-1117.284) -- 0:00:12
800000 -- [-1114.785] (-1114.238) (-1115.320) (-1114.039) * (-1114.239) [-1114.082] (-1116.430) (-1117.941) -- 0:00:12
Average standard deviation of split frequencies: 0.006108
800500 -- [-1115.030] (-1113.621) (-1115.868) (-1119.884) * (-1114.305) [-1114.172] (-1116.206) (-1116.776) -- 0:00:12
801000 -- (-1117.869) (-1115.359) (-1116.021) [-1116.844] * (-1115.054) [-1116.399] (-1114.379) (-1119.423) -- 0:00:12
801500 -- (-1115.346) (-1114.852) (-1114.260) [-1117.670] * [-1115.970] (-1116.445) (-1116.430) (-1116.555) -- 0:00:12
802000 -- [-1118.755] (-1117.748) (-1113.463) (-1120.857) * (-1116.302) [-1119.596] (-1117.885) (-1121.430) -- 0:00:12
802500 -- (-1118.335) (-1117.916) [-1114.203] (-1119.208) * (-1116.249) (-1115.528) [-1118.402] (-1115.509) -- 0:00:12
803000 -- (-1119.286) [-1117.614] (-1116.436) (-1115.809) * (-1118.232) (-1113.888) [-1115.713] (-1115.450) -- 0:00:12
803500 -- (-1115.753) (-1115.050) [-1114.301] (-1116.008) * (-1115.167) (-1114.089) (-1120.063) [-1115.036] -- 0:00:12
804000 -- (-1116.259) (-1119.250) [-1115.302] (-1115.704) * (-1115.070) (-1114.726) [-1115.281] (-1115.670) -- 0:00:12
804500 -- [-1116.501] (-1116.329) (-1114.995) (-1115.859) * [-1114.645] (-1116.093) (-1116.720) (-1116.595) -- 0:00:12
805000 -- (-1114.584) (-1116.724) (-1115.697) [-1115.231] * (-1116.577) [-1115.794] (-1117.309) (-1115.148) -- 0:00:12
Average standard deviation of split frequencies: 0.006397
805500 -- (-1117.429) (-1115.226) [-1114.220] (-1117.961) * [-1115.316] (-1114.076) (-1118.815) (-1117.052) -- 0:00:12
806000 -- (-1116.661) [-1115.597] (-1115.886) (-1119.238) * (-1117.043) (-1116.197) (-1115.807) [-1114.676] -- 0:00:12
806500 -- [-1117.717] (-1116.041) (-1116.413) (-1118.272) * [-1118.363] (-1115.707) (-1115.294) (-1113.974) -- 0:00:11
807000 -- [-1116.302] (-1118.338) (-1118.544) (-1114.811) * [-1116.804] (-1115.204) (-1114.802) (-1116.563) -- 0:00:11
807500 -- (-1116.155) [-1115.420] (-1115.784) (-1115.667) * (-1116.094) (-1115.932) [-1113.791] (-1120.465) -- 0:00:11
808000 -- (-1117.925) [-1116.934] (-1115.630) (-1115.281) * [-1117.445] (-1115.910) (-1114.096) (-1121.754) -- 0:00:11
808500 -- (-1114.695) [-1114.498] (-1116.431) (-1115.606) * [-1115.129] (-1117.696) (-1113.808) (-1114.846) -- 0:00:11
809000 -- [-1118.404] (-1118.537) (-1113.725) (-1114.321) * (-1117.091) (-1117.239) (-1116.670) [-1115.515] -- 0:00:11
809500 -- (-1117.089) [-1117.631] (-1115.284) (-1114.195) * [-1116.094] (-1116.087) (-1115.266) (-1114.178) -- 0:00:11
810000 -- (-1117.674) (-1114.655) [-1116.134] (-1114.735) * (-1117.641) [-1114.753] (-1114.595) (-1114.553) -- 0:00:11
Average standard deviation of split frequencies: 0.006687
810500 -- (-1117.340) [-1114.648] (-1115.372) (-1115.081) * (-1115.108) (-1116.582) [-1114.536] (-1116.121) -- 0:00:11
811000 -- (-1113.899) (-1116.902) (-1115.121) [-1117.753] * (-1115.485) [-1118.056] (-1119.222) (-1116.121) -- 0:00:11
811500 -- (-1117.159) [-1116.457] (-1114.569) (-1122.616) * (-1117.723) (-1115.170) [-1116.177] (-1118.624) -- 0:00:11
812000 -- (-1115.986) (-1116.696) (-1114.532) [-1119.805] * (-1115.276) (-1116.157) (-1116.255) [-1116.728] -- 0:00:11
812500 -- (-1116.067) (-1115.300) [-1116.650] (-1119.545) * (-1114.446) [-1114.878] (-1113.339) (-1118.817) -- 0:00:11
813000 -- (-1117.281) [-1116.381] (-1116.107) (-1118.655) * (-1113.580) [-1113.923] (-1113.259) (-1116.613) -- 0:00:11
813500 -- (-1117.072) (-1117.027) (-1124.144) [-1118.962] * (-1114.628) (-1114.794) [-1114.190] (-1114.610) -- 0:00:11
814000 -- (-1113.890) (-1114.260) (-1114.538) [-1115.777] * (-1116.380) [-1118.245] (-1114.516) (-1115.608) -- 0:00:11
814500 -- (-1113.401) (-1114.405) (-1114.524) [-1113.232] * [-1117.273] (-1118.023) (-1115.809) (-1118.682) -- 0:00:11
815000 -- [-1115.709] (-1115.548) (-1114.232) (-1117.922) * (-1114.531) [-1116.942] (-1113.445) (-1121.180) -- 0:00:11
Average standard deviation of split frequencies: 0.006716
815500 -- (-1113.690) (-1114.476) [-1116.004] (-1114.578) * (-1116.411) (-1115.006) [-1116.966] (-1115.930) -- 0:00:11
816000 -- (-1114.083) (-1115.304) [-1115.744] (-1116.831) * (-1117.595) (-1113.648) [-1117.920] (-1114.213) -- 0:00:11
816500 -- (-1115.603) (-1115.450) [-1114.267] (-1116.953) * [-1116.996] (-1116.012) (-1117.839) (-1113.672) -- 0:00:11
817000 -- (-1118.419) [-1114.117] (-1114.605) (-1118.657) * (-1116.723) (-1117.326) (-1116.196) [-1113.665] -- 0:00:11
817500 -- [-1114.912] (-1116.887) (-1115.660) (-1114.878) * (-1114.848) (-1115.331) [-1114.630] (-1113.710) -- 0:00:11
818000 -- [-1113.994] (-1119.199) (-1114.638) (-1117.735) * (-1114.778) (-1118.305) (-1114.404) [-1114.471] -- 0:00:11
818500 -- (-1113.579) (-1117.833) [-1116.452] (-1116.190) * (-1115.156) [-1117.946] (-1116.068) (-1114.491) -- 0:00:11
819000 -- (-1114.507) (-1117.702) [-1114.246] (-1117.239) * [-1114.535] (-1117.012) (-1115.854) (-1114.696) -- 0:00:11
819500 -- (-1115.197) (-1116.326) [-1115.628] (-1116.460) * [-1119.205] (-1115.520) (-1114.656) (-1115.199) -- 0:00:11
820000 -- [-1117.646] (-1116.682) (-1116.078) (-1114.886) * [-1114.207] (-1114.796) (-1114.368) (-1113.994) -- 0:00:11
Average standard deviation of split frequencies: 0.006785
820500 -- (-1116.671) [-1116.601] (-1114.647) (-1116.568) * (-1118.276) [-1115.791] (-1114.838) (-1114.650) -- 0:00:11
821000 -- (-1117.753) (-1117.489) (-1114.412) [-1117.000] * [-1113.849] (-1116.732) (-1114.662) (-1114.463) -- 0:00:11
821500 -- (-1113.369) (-1118.374) (-1117.030) [-1114.540] * [-1113.499] (-1115.157) (-1114.883) (-1117.712) -- 0:00:11
822000 -- (-1114.141) (-1117.244) [-1116.237] (-1116.621) * (-1115.872) (-1115.091) [-1115.507] (-1115.913) -- 0:00:11
822500 -- [-1116.691] (-1116.475) (-1120.177) (-1114.971) * (-1115.097) (-1117.804) (-1114.013) [-1115.400] -- 0:00:11
823000 -- (-1115.964) [-1115.901] (-1114.733) (-1114.137) * (-1115.418) (-1118.119) [-1115.228] (-1115.333) -- 0:00:10
823500 -- [-1118.866] (-1114.761) (-1117.054) (-1117.088) * (-1113.996) [-1117.430] (-1116.604) (-1116.106) -- 0:00:10
824000 -- (-1113.844) [-1113.920] (-1118.108) (-1114.383) * (-1113.909) (-1115.035) [-1114.368] (-1116.455) -- 0:00:10
824500 -- [-1113.627] (-1114.098) (-1115.323) (-1114.402) * (-1114.278) (-1116.531) [-1115.771] (-1122.911) -- 0:00:11
825000 -- (-1114.374) [-1113.839] (-1114.163) (-1117.511) * (-1114.402) [-1119.271] (-1115.677) (-1116.859) -- 0:00:11
Average standard deviation of split frequencies: 0.007098
825500 -- (-1113.449) (-1114.950) (-1114.345) [-1115.903] * [-1114.350] (-1116.288) (-1119.086) (-1116.712) -- 0:00:10
826000 -- [-1114.174] (-1116.108) (-1115.265) (-1117.215) * (-1115.212) (-1115.036) [-1116.637] (-1118.275) -- 0:00:10
826500 -- (-1117.002) (-1114.577) (-1116.174) [-1115.452] * (-1115.814) [-1115.340] (-1117.404) (-1116.116) -- 0:00:10
827000 -- [-1116.226] (-1114.911) (-1114.699) (-1118.368) * (-1115.959) (-1115.562) [-1118.751] (-1114.844) -- 0:00:10
827500 -- [-1114.173] (-1115.234) (-1115.861) (-1116.160) * (-1115.496) [-1115.440] (-1117.959) (-1117.228) -- 0:00:10
828000 -- [-1115.876] (-1115.721) (-1116.778) (-1117.456) * (-1121.501) (-1113.676) [-1116.502] (-1114.457) -- 0:00:10
828500 -- (-1115.108) (-1116.050) (-1116.842) [-1115.870] * (-1117.461) [-1120.888] (-1114.468) (-1115.603) -- 0:00:10
829000 -- (-1115.910) (-1114.249) [-1118.714] (-1116.615) * [-1115.391] (-1116.011) (-1115.641) (-1115.816) -- 0:00:10
829500 -- (-1115.242) (-1115.362) (-1119.537) [-1115.155] * (-1118.389) (-1119.096) (-1118.125) [-1116.679] -- 0:00:10
830000 -- (-1113.985) (-1114.625) [-1114.531] (-1116.122) * [-1114.798] (-1119.503) (-1116.494) (-1118.678) -- 0:00:10
Average standard deviation of split frequencies: 0.007448
830500 -- [-1114.464] (-1115.119) (-1114.206) (-1115.767) * [-1115.424] (-1116.133) (-1116.118) (-1116.424) -- 0:00:10
831000 -- [-1115.029] (-1116.487) (-1114.329) (-1119.425) * (-1114.208) (-1114.110) (-1114.538) [-1117.514] -- 0:00:10
831500 -- (-1115.219) (-1115.994) [-1117.047] (-1119.266) * (-1115.353) (-1116.413) (-1115.198) [-1119.672] -- 0:00:10
832000 -- (-1115.482) (-1115.260) [-1115.395] (-1115.525) * (-1114.375) (-1115.010) (-1115.671) [-1119.522] -- 0:00:10
832500 -- [-1113.788] (-1114.882) (-1114.969) (-1115.631) * (-1114.162) (-1114.431) [-1117.364] (-1116.376) -- 0:00:10
833000 -- (-1115.090) (-1120.408) [-1117.288] (-1121.454) * [-1115.322] (-1117.678) (-1114.990) (-1115.546) -- 0:00:10
833500 -- (-1114.462) [-1118.151] (-1115.818) (-1116.734) * (-1117.715) [-1116.875] (-1116.471) (-1115.674) -- 0:00:10
834000 -- (-1114.805) [-1114.660] (-1113.503) (-1116.226) * (-1114.329) (-1114.793) [-1117.831] (-1114.428) -- 0:00:10
834500 -- [-1116.518] (-1114.065) (-1115.510) (-1118.256) * [-1113.703] (-1115.041) (-1114.555) (-1115.529) -- 0:00:10
835000 -- (-1116.629) (-1114.203) [-1116.151] (-1115.848) * (-1123.627) (-1114.001) (-1115.614) [-1115.489] -- 0:00:10
Average standard deviation of split frequencies: 0.007612
835500 -- [-1118.830] (-1116.035) (-1117.568) (-1113.228) * (-1115.574) (-1113.842) [-1116.526] (-1115.557) -- 0:00:10
836000 -- (-1122.315) (-1117.136) [-1115.607] (-1113.266) * (-1116.414) (-1113.493) [-1115.596] (-1119.547) -- 0:00:10
836500 -- [-1114.150] (-1116.649) (-1115.496) (-1115.003) * (-1116.267) [-1114.356] (-1115.226) (-1119.134) -- 0:00:10
837000 -- (-1114.266) (-1115.830) (-1113.517) [-1118.150] * (-1115.389) (-1114.952) (-1113.554) [-1116.218] -- 0:00:10
837500 -- [-1115.973] (-1115.586) (-1115.586) (-1117.596) * (-1114.549) [-1115.237] (-1115.175) (-1114.431) -- 0:00:10
838000 -- (-1114.808) (-1115.172) [-1114.841] (-1114.023) * [-1114.327] (-1114.392) (-1118.144) (-1118.512) -- 0:00:10
838500 -- [-1113.726] (-1115.086) (-1114.078) (-1116.126) * [-1114.407] (-1114.491) (-1119.624) (-1114.131) -- 0:00:10
839000 -- (-1117.833) (-1115.513) (-1113.714) [-1114.033] * (-1115.775) (-1120.775) (-1117.321) [-1115.777] -- 0:00:09
839500 -- (-1118.450) (-1116.951) [-1115.614] (-1116.190) * [-1114.372] (-1116.507) (-1115.430) (-1116.086) -- 0:00:09
840000 -- (-1115.245) [-1117.211] (-1114.166) (-1115.171) * (-1115.220) [-1117.914] (-1115.393) (-1117.885) -- 0:00:09
Average standard deviation of split frequencies: 0.007220
840500 -- (-1113.938) [-1116.190] (-1115.237) (-1116.064) * (-1115.516) (-1117.372) [-1113.722] (-1114.122) -- 0:00:10
841000 -- (-1114.373) [-1118.395] (-1114.473) (-1118.282) * (-1116.593) (-1118.396) [-1114.169] (-1114.462) -- 0:00:10
841500 -- (-1114.401) [-1117.649] (-1118.756) (-1114.919) * (-1115.578) (-1116.958) [-1118.363] (-1113.385) -- 0:00:09
842000 -- (-1116.390) (-1115.543) (-1115.573) [-1114.543] * (-1117.963) (-1122.690) [-1116.072] (-1115.183) -- 0:00:09
842500 -- [-1116.521] (-1118.736) (-1119.780) (-1116.398) * [-1116.621] (-1119.001) (-1116.431) (-1114.425) -- 0:00:09
843000 -- (-1114.914) (-1119.234) [-1116.599] (-1115.141) * (-1115.242) (-1118.034) [-1114.412] (-1113.898) -- 0:00:09
843500 -- [-1116.473] (-1117.796) (-1119.843) (-1116.657) * [-1115.274] (-1117.985) (-1118.708) (-1115.912) -- 0:00:09
844000 -- [-1119.259] (-1116.303) (-1118.287) (-1115.059) * [-1115.657] (-1113.965) (-1115.148) (-1119.004) -- 0:00:09
844500 -- [-1119.136] (-1114.120) (-1115.898) (-1117.831) * (-1116.281) (-1116.208) (-1116.223) [-1114.066] -- 0:00:09
845000 -- [-1114.604] (-1115.049) (-1115.439) (-1121.041) * (-1116.961) (-1113.533) [-1118.253] (-1117.150) -- 0:00:09
Average standard deviation of split frequencies: 0.007313
845500 -- (-1116.608) (-1114.011) (-1118.764) [-1114.214] * (-1116.808) [-1114.334] (-1116.017) (-1114.378) -- 0:00:09
846000 -- [-1116.117] (-1114.374) (-1113.380) (-1117.283) * (-1116.623) (-1118.585) (-1118.787) [-1114.673] -- 0:00:09
846500 -- (-1117.708) (-1113.564) (-1115.114) [-1115.998] * [-1114.721] (-1117.025) (-1114.310) (-1118.672) -- 0:00:09
847000 -- (-1115.287) [-1115.706] (-1118.841) (-1117.511) * (-1115.432) (-1113.504) (-1116.008) [-1114.723] -- 0:00:09
847500 -- [-1115.716] (-1115.739) (-1114.500) (-1118.987) * (-1114.041) (-1114.739) [-1116.997] (-1115.860) -- 0:00:09
848000 -- (-1117.582) (-1120.763) [-1121.155] (-1118.325) * (-1114.011) (-1117.514) [-1115.598] (-1116.471) -- 0:00:09
848500 -- [-1116.069] (-1117.589) (-1115.127) (-1117.686) * (-1114.532) [-1114.439] (-1115.328) (-1113.727) -- 0:00:09
849000 -- (-1118.378) [-1115.832] (-1114.893) (-1115.498) * (-1114.869) [-1115.044] (-1115.109) (-1116.089) -- 0:00:09
849500 -- (-1116.571) [-1114.490] (-1116.225) (-1124.974) * (-1114.377) [-1119.079] (-1114.545) (-1115.651) -- 0:00:09
850000 -- [-1115.617] (-1114.308) (-1115.054) (-1116.362) * (-1115.382) (-1115.687) [-1117.211] (-1115.141) -- 0:00:09
Average standard deviation of split frequencies: 0.006996
850500 -- (-1117.760) (-1113.995) [-1114.476] (-1114.530) * (-1115.941) (-1116.903) [-1116.058] (-1115.246) -- 0:00:09
851000 -- (-1115.102) [-1113.643] (-1114.976) (-1115.440) * [-1114.815] (-1114.806) (-1116.562) (-1118.487) -- 0:00:09
851500 -- [-1116.653] (-1115.118) (-1120.778) (-1115.292) * (-1117.935) [-1117.717] (-1116.027) (-1115.036) -- 0:00:09
852000 -- (-1115.616) (-1114.678) [-1117.700] (-1116.373) * (-1115.855) (-1116.517) [-1116.420] (-1116.363) -- 0:00:09
852500 -- (-1115.528) (-1113.880) (-1119.560) [-1114.272] * (-1118.664) (-1115.799) [-1113.997] (-1113.341) -- 0:00:09
853000 -- (-1118.323) [-1113.884] (-1115.467) (-1116.818) * (-1113.990) (-1114.516) [-1113.821] (-1114.556) -- 0:00:09
853500 -- (-1117.067) (-1116.899) [-1114.334] (-1115.734) * (-1113.835) [-1114.441] (-1114.077) (-1115.385) -- 0:00:09
854000 -- [-1115.529] (-1113.952) (-1116.981) (-1114.755) * (-1115.272) (-1115.453) (-1114.705) [-1117.002] -- 0:00:09
854500 -- (-1117.763) [-1114.279] (-1113.863) (-1118.098) * (-1115.141) (-1115.929) [-1113.694] (-1120.056) -- 0:00:09
855000 -- [-1115.288] (-1115.454) (-1114.402) (-1115.290) * (-1114.000) [-1114.583] (-1115.718) (-1113.875) -- 0:00:08
Average standard deviation of split frequencies: 0.007090
855500 -- (-1117.698) [-1115.094] (-1116.877) (-1116.600) * (-1117.782) (-1117.420) (-1115.052) [-1113.793] -- 0:00:08
856000 -- (-1116.750) (-1114.765) (-1119.286) [-1113.618] * [-1116.165] (-1115.746) (-1118.945) (-1117.375) -- 0:00:08
856500 -- (-1115.872) (-1115.902) (-1114.559) [-1114.207] * (-1118.928) (-1115.626) (-1115.841) [-1118.410] -- 0:00:09
857000 -- (-1115.589) (-1121.630) (-1116.657) [-1114.796] * (-1116.612) (-1114.570) [-1115.841] (-1118.235) -- 0:00:09
857500 -- (-1113.986) (-1118.276) (-1115.815) [-1117.648] * (-1114.035) (-1119.438) (-1114.580) [-1115.013] -- 0:00:08
858000 -- (-1114.083) [-1116.512] (-1118.250) (-1119.192) * (-1115.458) [-1117.255] (-1114.331) (-1115.452) -- 0:00:08
858500 -- (-1113.601) (-1114.596) (-1116.827) [-1116.875] * (-1114.369) [-1114.430] (-1114.259) (-1115.295) -- 0:00:08
859000 -- [-1116.261] (-1116.793) (-1114.945) (-1115.515) * (-1120.708) [-1114.185] (-1114.084) (-1114.692) -- 0:00:08
859500 -- [-1115.909] (-1116.346) (-1115.396) (-1114.689) * (-1114.200) (-1114.016) (-1114.896) [-1114.760] -- 0:00:08
860000 -- (-1115.267) [-1115.657] (-1115.215) (-1115.163) * (-1116.161) (-1115.291) (-1116.819) [-1117.206] -- 0:00:08
Average standard deviation of split frequencies: 0.006778
860500 -- (-1116.677) [-1115.089] (-1119.610) (-1119.383) * (-1115.595) (-1113.907) (-1117.938) [-1114.108] -- 0:00:08
861000 -- [-1114.250] (-1115.883) (-1115.704) (-1116.482) * (-1116.321) (-1113.970) [-1114.651] (-1114.637) -- 0:00:08
861500 -- (-1114.513) (-1115.436) (-1115.452) [-1114.995] * (-1120.039) (-1113.382) [-1115.831] (-1117.031) -- 0:00:08
862000 -- [-1115.838] (-1116.950) (-1120.769) (-1114.699) * [-1114.557] (-1113.384) (-1114.347) (-1115.476) -- 0:00:08
862500 -- (-1116.286) (-1116.382) (-1121.636) [-1115.536] * (-1116.821) [-1117.333] (-1116.866) (-1116.707) -- 0:00:08
863000 -- (-1114.926) (-1117.358) (-1118.573) [-1115.758] * (-1115.762) (-1113.983) [-1114.127] (-1116.378) -- 0:00:08
863500 -- (-1114.118) (-1115.090) (-1118.582) [-1116.281] * (-1114.212) (-1117.508) (-1115.300) [-1115.945] -- 0:00:08
864000 -- (-1115.751) (-1114.607) [-1114.859] (-1115.016) * (-1115.024) (-1116.543) (-1114.889) [-1115.119] -- 0:00:08
864500 -- (-1114.694) (-1115.450) (-1114.192) [-1115.949] * (-1116.381) [-1115.450] (-1115.074) (-1115.443) -- 0:00:08
865000 -- (-1113.316) (-1118.157) [-1115.997] (-1116.751) * (-1116.393) (-1118.802) (-1113.496) [-1113.693] -- 0:00:08
Average standard deviation of split frequencies: 0.007042
865500 -- (-1114.537) [-1117.777] (-1118.495) (-1114.953) * (-1117.514) (-1117.199) (-1113.469) [-1116.555] -- 0:00:08
866000 -- (-1120.762) (-1118.272) [-1113.796] (-1115.746) * [-1115.362] (-1115.020) (-1117.226) (-1124.562) -- 0:00:08
866500 -- (-1117.176) (-1115.535) (-1115.852) [-1120.751] * (-1118.185) [-1117.467] (-1113.984) (-1116.828) -- 0:00:08
867000 -- (-1116.537) (-1117.266) [-1113.734] (-1119.899) * [-1115.086] (-1113.863) (-1113.936) (-1118.055) -- 0:00:08
867500 -- (-1117.122) (-1115.603) [-1115.639] (-1120.509) * [-1117.168] (-1116.494) (-1114.839) (-1116.638) -- 0:00:08
868000 -- (-1120.215) (-1114.358) (-1114.029) [-1115.770] * (-1114.685) (-1118.408) [-1115.543] (-1117.532) -- 0:00:08
868500 -- (-1118.213) (-1119.072) [-1114.830] (-1115.278) * (-1116.457) [-1114.518] (-1114.913) (-1115.589) -- 0:00:08
869000 -- (-1116.824) (-1116.131) (-1117.527) [-1114.881] * [-1116.079] (-1114.890) (-1116.065) (-1116.481) -- 0:00:08
869500 -- (-1115.324) (-1114.218) (-1114.087) [-1115.101] * (-1119.304) (-1115.817) (-1115.012) [-1114.300] -- 0:00:08
870000 -- (-1115.886) (-1115.185) [-1116.479] (-1114.834) * [-1117.794] (-1116.278) (-1121.285) (-1113.462) -- 0:00:08
Average standard deviation of split frequencies: 0.007039
870500 -- (-1117.382) (-1113.771) (-1118.644) [-1114.038] * (-1116.376) [-1115.811] (-1115.970) (-1113.474) -- 0:00:08
871000 -- (-1123.291) [-1116.016] (-1113.997) (-1115.216) * [-1113.550] (-1113.852) (-1115.617) (-1115.545) -- 0:00:07
871500 -- (-1116.273) [-1115.847] (-1114.985) (-1114.892) * (-1116.412) (-1116.479) [-1117.856] (-1113.948) -- 0:00:07
872000 -- (-1113.939) [-1114.908] (-1114.127) (-1114.072) * (-1116.060) (-1114.975) (-1115.049) [-1115.750] -- 0:00:07
872500 -- (-1114.929) [-1113.944] (-1118.609) (-1114.176) * (-1116.489) [-1113.621] (-1114.119) (-1115.494) -- 0:00:07
873000 -- (-1117.910) [-1114.143] (-1117.866) (-1113.607) * (-1116.071) (-1115.779) (-1113.697) [-1113.865] -- 0:00:08
873500 -- (-1116.213) (-1116.806) (-1116.081) [-1113.643] * (-1119.996) [-1115.001] (-1113.675) (-1114.504) -- 0:00:07
874000 -- (-1113.975) [-1116.922] (-1114.544) (-1113.997) * (-1117.167) (-1115.349) [-1117.037] (-1117.690) -- 0:00:07
874500 -- (-1114.492) (-1115.667) (-1117.822) [-1114.293] * [-1114.277] (-1118.232) (-1114.370) (-1119.106) -- 0:00:07
875000 -- [-1118.599] (-1120.473) (-1115.461) (-1113.357) * (-1113.938) [-1114.812] (-1114.604) (-1118.176) -- 0:00:07
Average standard deviation of split frequencies: 0.006794
875500 -- (-1117.321) [-1116.058] (-1116.443) (-1114.245) * (-1113.765) (-1114.009) [-1117.178] (-1119.078) -- 0:00:07
876000 -- (-1116.321) (-1122.102) [-1113.671] (-1116.616) * (-1114.505) [-1115.664] (-1117.351) (-1115.139) -- 0:00:07
876500 -- (-1115.687) (-1113.478) (-1117.161) [-1114.610] * (-1118.543) (-1115.521) (-1115.008) [-1115.664] -- 0:00:07
877000 -- [-1119.187] (-1115.444) (-1115.433) (-1115.436) * (-1114.793) [-1115.114] (-1114.358) (-1114.950) -- 0:00:07
877500 -- (-1116.809) [-1114.207] (-1117.072) (-1114.060) * [-1113.657] (-1116.611) (-1114.394) (-1114.757) -- 0:00:07
878000 -- [-1121.602] (-1113.772) (-1116.390) (-1114.783) * (-1114.122) (-1118.472) [-1114.485] (-1122.182) -- 0:00:07
878500 -- [-1117.500] (-1115.991) (-1115.863) (-1115.901) * (-1118.294) (-1116.773) (-1115.255) [-1115.663] -- 0:00:07
879000 -- (-1117.509) (-1115.559) (-1117.912) [-1115.074] * (-1114.429) (-1114.365) (-1118.419) [-1115.775] -- 0:00:07
879500 -- (-1116.870) (-1117.449) (-1115.182) [-1115.156] * (-1115.645) (-1114.368) (-1118.274) [-1113.820] -- 0:00:07
880000 -- (-1115.842) [-1113.651] (-1116.272) (-1114.619) * (-1114.552) (-1113.657) [-1114.808] (-1121.523) -- 0:00:07
Average standard deviation of split frequencies: 0.006925
880500 -- [-1115.498] (-1114.426) (-1115.890) (-1116.437) * (-1118.962) [-1114.184] (-1117.312) (-1116.351) -- 0:00:07
881000 -- (-1117.967) (-1114.438) (-1118.505) [-1115.425] * (-1117.128) (-1116.537) (-1115.633) [-1114.761] -- 0:00:07
881500 -- [-1117.664] (-1114.900) (-1116.497) (-1115.714) * (-1115.070) (-1117.267) [-1114.802] (-1115.772) -- 0:00:07
882000 -- (-1116.235) (-1114.183) [-1113.698] (-1115.474) * (-1114.182) [-1117.755] (-1115.529) (-1114.943) -- 0:00:07
882500 -- (-1116.192) [-1114.492] (-1115.968) (-1115.684) * (-1114.835) (-1114.980) [-1115.209] (-1116.934) -- 0:00:07
883000 -- (-1116.868) (-1115.464) [-1114.744] (-1117.240) * [-1113.648] (-1117.590) (-1120.897) (-1117.879) -- 0:00:07
883500 -- (-1114.279) (-1117.434) [-1115.345] (-1118.823) * [-1114.591] (-1114.188) (-1116.194) (-1117.404) -- 0:00:07
884000 -- (-1114.279) (-1116.771) (-1117.628) [-1114.237] * (-1114.473) (-1115.110) [-1114.014] (-1114.268) -- 0:00:07
884500 -- (-1115.700) (-1115.257) [-1116.878] (-1115.421) * (-1118.056) [-1114.127] (-1114.270) (-1114.372) -- 0:00:07
885000 -- (-1115.994) [-1118.180] (-1116.377) (-1121.119) * (-1116.878) [-1114.149] (-1114.664) (-1114.234) -- 0:00:07
Average standard deviation of split frequencies: 0.007349
885500 -- (-1115.992) [-1114.231] (-1115.668) (-1117.647) * (-1116.194) (-1114.156) [-1115.786] (-1118.187) -- 0:00:07
886000 -- (-1115.494) [-1116.745] (-1113.589) (-1116.088) * (-1114.494) [-1115.004] (-1114.516) (-1119.990) -- 0:00:07
886500 -- (-1115.171) [-1116.740] (-1115.566) (-1114.906) * [-1116.069] (-1115.930) (-1113.750) (-1115.194) -- 0:00:07
887000 -- [-1115.971] (-1120.761) (-1114.613) (-1116.190) * (-1114.773) [-1113.877] (-1116.665) (-1117.745) -- 0:00:07
887500 -- [-1116.047] (-1113.997) (-1116.409) (-1115.344) * [-1114.770] (-1118.936) (-1114.994) (-1115.600) -- 0:00:06
888000 -- (-1114.864) (-1114.812) [-1115.244] (-1113.959) * (-1116.981) (-1115.185) [-1118.154] (-1114.354) -- 0:00:06
888500 -- (-1116.459) [-1117.558] (-1116.226) (-1113.959) * [-1115.795] (-1113.765) (-1119.388) (-1115.662) -- 0:00:06
889000 -- (-1115.332) (-1114.789) [-1114.535] (-1118.473) * [-1114.830] (-1113.704) (-1113.822) (-1115.815) -- 0:00:06
889500 -- [-1115.105] (-1113.785) (-1114.940) (-1115.517) * (-1114.992) [-1116.546] (-1117.578) (-1116.713) -- 0:00:06
890000 -- (-1114.233) (-1116.700) (-1116.244) [-1115.516] * (-1114.785) (-1116.450) [-1117.027] (-1115.217) -- 0:00:06
Average standard deviation of split frequencies: 0.007476
890500 -- (-1116.974) (-1116.444) (-1115.676) [-1115.558] * (-1113.799) (-1114.587) (-1114.216) [-1117.742] -- 0:00:06
891000 -- (-1114.557) (-1116.588) [-1114.760] (-1115.415) * [-1116.074] (-1113.723) (-1114.213) (-1113.364) -- 0:00:06
891500 -- [-1117.175] (-1119.939) (-1116.897) (-1118.783) * (-1116.870) (-1116.879) [-1114.414] (-1113.602) -- 0:00:06
892000 -- (-1115.276) [-1115.233] (-1114.656) (-1114.426) * (-1114.389) (-1117.630) (-1115.884) [-1114.184] -- 0:00:06
892500 -- (-1119.539) (-1117.880) (-1114.551) [-1114.784] * (-1114.512) (-1114.587) [-1118.563] (-1119.474) -- 0:00:06
893000 -- (-1114.821) [-1113.940] (-1116.855) (-1115.411) * [-1115.909] (-1115.148) (-1116.152) (-1122.631) -- 0:00:06
893500 -- (-1116.947) (-1114.875) (-1121.576) [-1115.113] * (-1114.627) [-1116.644] (-1115.715) (-1116.772) -- 0:00:06
894000 -- [-1121.867] (-1114.268) (-1120.525) (-1115.123) * [-1115.923] (-1115.687) (-1118.192) (-1116.772) -- 0:00:06
894500 -- (-1114.879) [-1116.223] (-1115.780) (-1114.261) * (-1114.684) [-1115.068] (-1118.515) (-1115.662) -- 0:00:06
895000 -- (-1116.960) (-1122.296) (-1117.228) [-1113.651] * [-1115.568] (-1115.923) (-1115.022) (-1115.742) -- 0:00:06
Average standard deviation of split frequencies: 0.007662
895500 -- (-1113.804) (-1117.393) [-1114.939] (-1113.803) * (-1115.080) [-1114.737] (-1117.871) (-1114.925) -- 0:00:06
896000 -- (-1113.700) [-1116.717] (-1116.273) (-1117.710) * (-1116.674) (-1115.857) [-1114.121] (-1115.063) -- 0:00:06
896500 -- (-1116.036) (-1115.872) [-1116.464] (-1117.341) * [-1114.012] (-1114.415) (-1114.497) (-1115.472) -- 0:00:06
897000 -- [-1114.330] (-1114.858) (-1116.399) (-1117.235) * [-1115.588] (-1116.699) (-1117.279) (-1114.442) -- 0:00:06
897500 -- [-1116.352] (-1116.422) (-1120.352) (-1118.641) * (-1115.982) (-1116.240) [-1115.102] (-1114.622) -- 0:00:06
898000 -- (-1117.065) [-1114.211] (-1117.052) (-1116.434) * (-1116.434) [-1113.760] (-1116.851) (-1114.760) -- 0:00:06
898500 -- (-1114.640) (-1113.563) [-1115.831] (-1115.563) * [-1115.246] (-1114.157) (-1121.256) (-1118.082) -- 0:00:06
899000 -- (-1113.700) (-1115.018) (-1116.223) [-1119.017] * (-1114.576) (-1117.357) (-1121.136) [-1116.187] -- 0:00:06
899500 -- (-1114.914) [-1115.234] (-1115.724) (-1119.179) * [-1113.548] (-1114.466) (-1116.323) (-1120.382) -- 0:00:06
900000 -- (-1114.724) (-1116.073) [-1114.819] (-1118.507) * (-1113.773) (-1114.707) (-1118.233) [-1114.840] -- 0:00:06
Average standard deviation of split frequencies: 0.007687
900500 -- (-1116.191) (-1116.482) [-1114.512] (-1116.232) * (-1115.320) [-1115.862] (-1113.983) (-1117.987) -- 0:00:06
901000 -- [-1117.286] (-1118.408) (-1114.113) (-1117.791) * (-1114.808) (-1120.484) (-1118.578) [-1114.668] -- 0:00:06
901500 -- (-1117.423) (-1113.960) (-1114.400) [-1117.604] * (-1117.090) [-1115.221] (-1116.188) (-1119.733) -- 0:00:06
902000 -- [-1114.407] (-1117.672) (-1115.508) (-1117.460) * (-1114.682) (-1116.859) [-1116.270] (-1115.594) -- 0:00:06
902500 -- [-1114.436] (-1116.693) (-1115.660) (-1114.074) * (-1114.967) (-1116.511) [-1115.879] (-1115.034) -- 0:00:06
903000 -- [-1118.905] (-1113.890) (-1116.368) (-1113.978) * [-1114.743] (-1117.525) (-1116.255) (-1114.512) -- 0:00:06
903500 -- (-1115.570) (-1115.086) [-1114.370] (-1114.690) * (-1116.195) (-1117.647) (-1115.551) [-1116.498] -- 0:00:05
904000 -- [-1114.759] (-1117.691) (-1118.150) (-1115.329) * (-1115.181) [-1114.246] (-1114.860) (-1116.322) -- 0:00:05
904500 -- (-1116.868) [-1116.078] (-1114.906) (-1115.298) * (-1115.179) (-1116.293) (-1116.602) [-1115.349] -- 0:00:05
905000 -- (-1117.908) (-1119.584) (-1115.407) [-1115.619] * (-1115.508) [-1116.017] (-1114.953) (-1114.139) -- 0:00:05
Average standard deviation of split frequencies: 0.007805
905500 -- [-1114.790] (-1116.770) (-1117.302) (-1114.967) * (-1115.125) [-1115.312] (-1115.232) (-1114.939) -- 0:00:05
906000 -- (-1114.840) (-1115.914) (-1123.713) [-1116.025] * (-1114.868) (-1116.239) (-1116.534) [-1116.783] -- 0:00:05
906500 -- (-1113.721) [-1118.406] (-1115.741) (-1115.837) * [-1117.071] (-1114.981) (-1116.781) (-1117.836) -- 0:00:05
907000 -- (-1114.886) [-1115.025] (-1114.444) (-1115.653) * (-1115.176) (-1120.148) [-1114.803] (-1118.451) -- 0:00:05
907500 -- (-1116.832) (-1115.929) (-1116.718) [-1117.759] * [-1115.626] (-1116.467) (-1117.564) (-1114.191) -- 0:00:05
908000 -- (-1114.215) (-1116.773) (-1117.309) [-1114.512] * (-1113.700) [-1114.552] (-1119.602) (-1116.864) -- 0:00:05
908500 -- (-1115.305) (-1117.813) [-1114.080] (-1114.871) * (-1114.783) (-1115.989) [-1117.236] (-1115.970) -- 0:00:05
909000 -- [-1120.729] (-1115.735) (-1114.443) (-1114.645) * [-1116.773] (-1115.943) (-1123.212) (-1117.009) -- 0:00:05
909500 -- (-1118.028) (-1114.016) [-1115.030] (-1113.302) * (-1114.599) [-1115.684] (-1121.221) (-1115.650) -- 0:00:05
910000 -- (-1117.856) (-1113.902) (-1117.297) [-1114.987] * (-1114.101) [-1116.043] (-1117.885) (-1117.722) -- 0:00:05
Average standard deviation of split frequencies: 0.007704
910500 -- (-1113.785) [-1114.321] (-1114.751) (-1116.135) * (-1113.559) (-1117.553) [-1116.737] (-1116.375) -- 0:00:05
911000 -- (-1118.760) [-1113.498] (-1115.200) (-1115.060) * (-1115.146) (-1117.978) (-1115.117) [-1119.433] -- 0:00:05
911500 -- (-1121.101) [-1113.558] (-1114.806) (-1114.559) * (-1115.521) [-1115.153] (-1117.132) (-1125.173) -- 0:00:05
912000 -- (-1118.632) [-1113.503] (-1113.697) (-1113.988) * (-1117.251) (-1113.818) [-1115.483] (-1122.917) -- 0:00:05
912500 -- [-1117.390] (-1114.753) (-1116.466) (-1114.296) * (-1119.542) [-1115.415] (-1114.832) (-1117.223) -- 0:00:05
913000 -- [-1118.863] (-1113.882) (-1120.092) (-1115.369) * (-1116.980) [-1116.490] (-1116.963) (-1117.933) -- 0:00:05
913500 -- (-1117.759) (-1114.371) [-1117.332] (-1114.337) * (-1115.328) (-1119.968) [-1113.626] (-1114.455) -- 0:00:05
914000 -- (-1114.554) (-1116.193) [-1115.387] (-1114.731) * (-1114.183) (-1117.579) [-1113.870] (-1113.921) -- 0:00:05
914500 -- (-1114.704) [-1115.553] (-1114.914) (-1116.284) * [-1113.977] (-1117.281) (-1114.750) (-1113.540) -- 0:00:05
915000 -- (-1114.049) (-1116.721) [-1116.052] (-1117.538) * [-1116.424] (-1115.859) (-1114.813) (-1114.371) -- 0:00:05
Average standard deviation of split frequencies: 0.007720
915500 -- (-1114.301) (-1116.388) (-1116.684) [-1115.506] * (-1115.131) [-1117.961] (-1114.201) (-1119.566) -- 0:00:05
916000 -- (-1117.139) (-1118.851) [-1117.165] (-1115.197) * (-1114.958) (-1118.728) (-1116.311) [-1115.883] -- 0:00:05
916500 -- (-1115.694) [-1115.929] (-1117.099) (-1117.701) * [-1114.747] (-1115.329) (-1118.334) (-1114.049) -- 0:00:05
917000 -- (-1114.371) (-1114.271) [-1115.147] (-1117.619) * [-1114.545] (-1115.352) (-1116.095) (-1116.895) -- 0:00:05
917500 -- [-1116.514] (-1113.578) (-1114.978) (-1115.988) * (-1117.860) (-1115.160) (-1118.591) [-1115.040] -- 0:00:05
918000 -- (-1115.988) [-1115.276] (-1117.477) (-1114.549) * (-1116.816) (-1119.635) (-1117.371) [-1114.746] -- 0:00:05
918500 -- (-1117.271) [-1117.208] (-1119.190) (-1117.397) * [-1117.003] (-1116.068) (-1115.275) (-1115.121) -- 0:00:05
919000 -- (-1123.385) (-1114.156) (-1116.522) [-1115.513] * (-1115.074) (-1113.599) (-1117.842) [-1115.137] -- 0:00:05
919500 -- (-1117.106) (-1116.900) (-1120.000) [-1115.683] * (-1114.317) (-1115.905) [-1115.173] (-1117.381) -- 0:00:04
920000 -- (-1117.816) (-1117.550) (-1116.042) [-1115.047] * (-1114.950) [-1116.206] (-1118.820) (-1115.787) -- 0:00:04
Average standard deviation of split frequencies: 0.008012
920500 -- (-1116.862) (-1117.707) (-1117.277) [-1117.005] * (-1114.504) (-1118.108) [-1114.906] (-1114.556) -- 0:00:04
921000 -- [-1113.585] (-1118.961) (-1117.254) (-1115.485) * (-1113.499) (-1120.206) [-1114.273] (-1114.669) -- 0:00:04
921500 -- (-1115.546) [-1114.114] (-1119.185) (-1117.281) * [-1113.387] (-1115.828) (-1115.568) (-1119.071) -- 0:00:04
922000 -- (-1117.587) [-1116.737] (-1119.008) (-1116.610) * (-1117.592) (-1115.692) [-1115.895] (-1115.834) -- 0:00:04
922500 -- [-1118.958] (-1113.958) (-1116.994) (-1117.279) * (-1114.204) (-1115.009) [-1116.060] (-1116.201) -- 0:00:04
923000 -- (-1114.178) (-1113.204) (-1120.116) [-1115.772] * (-1118.965) (-1119.702) (-1115.828) [-1114.649] -- 0:00:04
923500 -- [-1116.038] (-1114.459) (-1121.808) (-1116.502) * (-1116.797) [-1115.241] (-1114.323) (-1114.968) -- 0:00:04
924000 -- (-1117.362) [-1114.447] (-1116.844) (-1116.673) * (-1115.420) (-1117.682) [-1116.800] (-1119.389) -- 0:00:04
924500 -- (-1113.743) (-1116.072) [-1115.875] (-1117.239) * (-1115.569) [-1117.475] (-1120.056) (-1114.636) -- 0:00:04
925000 -- (-1113.399) [-1114.466] (-1115.863) (-1114.369) * (-1115.997) [-1115.510] (-1116.215) (-1116.872) -- 0:00:04
Average standard deviation of split frequencies: 0.008145
925500 -- (-1114.045) (-1114.062) [-1115.822] (-1115.957) * (-1117.039) (-1117.137) [-1116.945] (-1115.110) -- 0:00:04
926000 -- (-1116.516) [-1114.834] (-1114.696) (-1119.177) * (-1115.526) (-1116.875) [-1118.577] (-1113.459) -- 0:00:04
926500 -- [-1115.725] (-1113.924) (-1114.915) (-1115.091) * [-1115.879] (-1115.150) (-1115.019) (-1117.867) -- 0:00:04
927000 -- (-1116.232) (-1115.180) [-1115.262] (-1116.302) * [-1115.286] (-1114.386) (-1114.401) (-1116.210) -- 0:00:04
927500 -- [-1114.902] (-1116.568) (-1118.768) (-1118.319) * (-1114.489) (-1113.827) [-1120.744] (-1115.976) -- 0:00:04
928000 -- (-1113.618) (-1114.627) [-1114.269] (-1119.135) * [-1115.410] (-1115.646) (-1113.842) (-1116.030) -- 0:00:04
928500 -- (-1114.672) [-1115.223] (-1115.019) (-1123.552) * [-1116.914] (-1114.802) (-1115.557) (-1115.148) -- 0:00:04
929000 -- (-1118.347) (-1114.760) (-1117.719) [-1117.946] * [-1118.795] (-1115.723) (-1115.242) (-1115.203) -- 0:00:04
929500 -- (-1120.498) (-1116.825) [-1115.149] (-1119.083) * [-1113.724] (-1116.545) (-1113.907) (-1117.137) -- 0:00:04
930000 -- (-1116.253) (-1117.234) [-1115.963] (-1115.830) * (-1117.625) [-1113.791] (-1114.026) (-1115.886) -- 0:00:04
Average standard deviation of split frequencies: 0.007926
930500 -- (-1122.039) (-1119.368) [-1115.465] (-1115.076) * [-1116.468] (-1116.575) (-1114.434) (-1117.566) -- 0:00:04
931000 -- (-1114.410) [-1116.979] (-1116.219) (-1115.833) * (-1119.534) (-1115.146) [-1115.221] (-1121.579) -- 0:00:04
931500 -- (-1116.297) [-1115.083] (-1114.320) (-1114.741) * (-1122.371) (-1113.660) (-1115.131) [-1114.193] -- 0:00:04
932000 -- (-1114.646) [-1113.904] (-1113.585) (-1119.288) * (-1114.593) (-1114.603) (-1115.746) [-1114.084] -- 0:00:04
932500 -- (-1114.528) (-1114.028) [-1120.603] (-1115.841) * (-1113.995) (-1115.607) (-1117.506) [-1114.921] -- 0:00:04
933000 -- (-1114.625) (-1114.818) [-1114.527] (-1116.412) * (-1116.256) [-1113.617] (-1118.606) (-1113.912) -- 0:00:04
933500 -- (-1116.320) (-1113.736) [-1113.937] (-1114.277) * [-1114.080] (-1116.174) (-1116.674) (-1114.453) -- 0:00:04
934000 -- (-1116.256) [-1115.725] (-1115.473) (-1114.761) * (-1118.295) [-1115.511] (-1116.345) (-1114.937) -- 0:00:04
934500 -- (-1117.877) (-1116.830) (-1114.843) [-1114.561] * (-1117.414) (-1116.214) [-1115.567] (-1117.784) -- 0:00:04
935000 -- [-1120.023] (-1119.973) (-1114.966) (-1118.135) * (-1113.645) [-1115.741] (-1115.596) (-1115.572) -- 0:00:04
Average standard deviation of split frequencies: 0.008206
935500 -- (-1115.398) [-1114.202] (-1120.670) (-1119.866) * (-1116.110) (-1114.031) (-1114.710) [-1115.908] -- 0:00:03
936000 -- (-1117.665) [-1114.512] (-1116.574) (-1114.808) * (-1115.499) (-1113.628) (-1114.232) [-1115.360] -- 0:00:03
936500 -- (-1115.726) (-1114.001) [-1117.781] (-1115.873) * (-1115.348) [-1115.279] (-1115.470) (-1114.817) -- 0:00:03
937000 -- (-1116.765) (-1114.137) [-1118.973] (-1114.885) * (-1116.777) (-1117.840) [-1115.472] (-1114.762) -- 0:00:03
937500 -- (-1114.461) (-1115.851) (-1114.558) [-1115.556] * (-1119.960) (-1116.595) [-1115.210] (-1115.704) -- 0:00:03
938000 -- [-1117.404] (-1116.941) (-1113.909) (-1114.019) * (-1117.075) (-1116.870) [-1116.283] (-1115.893) -- 0:00:03
938500 -- (-1119.881) (-1116.865) (-1115.863) [-1113.893] * (-1115.190) (-1115.471) [-1116.013] (-1116.521) -- 0:00:03
939000 -- (-1118.970) (-1118.044) (-1114.402) [-1114.303] * (-1115.025) (-1116.940) [-1117.267] (-1115.982) -- 0:00:03
939500 -- (-1117.392) [-1123.913] (-1115.577) (-1117.122) * (-1114.853) (-1116.469) (-1115.757) [-1115.950] -- 0:00:03
940000 -- (-1115.722) (-1123.177) (-1113.544) [-1114.408] * (-1115.094) (-1115.756) (-1116.239) [-1115.720] -- 0:00:03
Average standard deviation of split frequencies: 0.008136
940500 -- (-1116.531) (-1114.791) (-1120.142) [-1115.517] * (-1116.379) [-1116.590] (-1117.034) (-1115.069) -- 0:00:03
941000 -- (-1115.265) [-1120.065] (-1118.760) (-1114.493) * (-1122.075) (-1116.349) (-1118.043) [-1113.950] -- 0:00:03
941500 -- [-1116.390] (-1114.654) (-1119.966) (-1119.202) * (-1116.432) [-1114.439] (-1116.970) (-1114.088) -- 0:00:03
942000 -- [-1114.587] (-1113.573) (-1114.346) (-1116.524) * (-1117.927) (-1114.268) [-1116.815] (-1117.009) -- 0:00:03
942500 -- (-1115.166) [-1115.562] (-1113.997) (-1115.278) * (-1123.554) (-1117.889) [-1117.134] (-1113.480) -- 0:00:03
943000 -- (-1114.351) [-1116.999] (-1115.523) (-1114.914) * (-1125.558) [-1116.712] (-1118.324) (-1115.877) -- 0:00:03
943500 -- (-1114.574) [-1115.189] (-1115.133) (-1114.947) * (-1117.735) (-1118.040) (-1115.243) [-1120.897] -- 0:00:03
944000 -- (-1121.670) (-1114.956) (-1114.934) [-1114.741] * (-1115.482) (-1116.717) (-1115.885) [-1113.549] -- 0:00:03
944500 -- (-1116.019) (-1113.570) (-1115.823) [-1114.181] * (-1120.812) (-1116.606) [-1114.818] (-1113.879) -- 0:00:03
945000 -- [-1116.453] (-1117.848) (-1115.460) (-1115.241) * [-1119.808] (-1115.214) (-1116.169) (-1113.890) -- 0:00:03
Average standard deviation of split frequencies: 0.008002
945500 -- [-1113.700] (-1115.919) (-1114.888) (-1116.383) * (-1118.807) (-1115.634) (-1116.605) [-1114.346] -- 0:00:03
946000 -- [-1114.149] (-1116.082) (-1117.390) (-1116.970) * (-1115.799) [-1118.005] (-1115.379) (-1114.515) -- 0:00:03
946500 -- (-1117.558) [-1115.425] (-1116.111) (-1116.286) * (-1116.976) (-1120.140) (-1115.927) [-1115.357] -- 0:00:03
947000 -- (-1119.025) (-1117.072) (-1115.477) [-1117.771] * (-1117.042) (-1114.615) (-1118.834) [-1114.692] -- 0:00:03
947500 -- (-1115.832) [-1122.017] (-1117.561) (-1116.137) * (-1114.630) [-1113.955] (-1115.559) (-1115.360) -- 0:00:03
948000 -- (-1116.509) [-1118.293] (-1115.597) (-1118.156) * (-1115.877) [-1117.546] (-1116.414) (-1116.245) -- 0:00:03
948500 -- (-1117.650) (-1115.205) [-1116.866] (-1125.752) * [-1113.404] (-1120.273) (-1115.782) (-1115.080) -- 0:00:03
949000 -- (-1115.971) [-1114.226] (-1114.421) (-1124.663) * [-1113.967] (-1118.740) (-1115.385) (-1114.882) -- 0:00:03
949500 -- [-1115.977] (-1114.732) (-1116.298) (-1122.922) * (-1114.281) (-1114.662) [-1116.212] (-1116.096) -- 0:00:03
950000 -- (-1117.163) (-1114.834) [-1116.284] (-1121.422) * [-1115.671] (-1116.796) (-1118.164) (-1116.697) -- 0:00:03
Average standard deviation of split frequencies: 0.007701
950500 -- (-1118.940) (-1114.609) [-1114.507] (-1116.064) * [-1116.003] (-1119.649) (-1116.799) (-1118.760) -- 0:00:03
951000 -- (-1118.879) [-1116.761] (-1116.719) (-1119.372) * (-1115.008) [-1114.792] (-1116.480) (-1115.829) -- 0:00:03
951500 -- (-1113.571) (-1114.575) (-1117.099) [-1115.858] * (-1120.563) (-1115.205) (-1116.490) [-1115.182] -- 0:00:03
952000 -- (-1116.700) [-1114.071] (-1115.745) (-1115.209) * (-1116.422) (-1118.343) [-1120.652] (-1115.855) -- 0:00:02
952500 -- (-1120.206) [-1114.992] (-1115.925) (-1116.134) * (-1116.135) (-1117.911) [-1114.150] (-1115.788) -- 0:00:02
953000 -- [-1114.187] (-1115.006) (-1119.125) (-1115.964) * (-1116.068) (-1117.930) (-1114.991) [-1118.031] -- 0:00:02
953500 -- (-1114.764) [-1116.092] (-1115.856) (-1114.597) * (-1116.964) [-1116.259] (-1116.782) (-1118.014) -- 0:00:02
954000 -- (-1115.897) (-1116.621) [-1117.065] (-1117.170) * (-1116.214) (-1114.544) (-1118.495) [-1115.887] -- 0:00:02
954500 -- (-1115.330) (-1116.469) [-1115.243] (-1115.580) * (-1113.543) (-1116.637) [-1114.362] (-1117.598) -- 0:00:02
955000 -- (-1114.942) [-1115.689] (-1116.053) (-1114.782) * (-1114.421) [-1117.186] (-1117.418) (-1114.908) -- 0:00:02
Average standard deviation of split frequencies: 0.007687
955500 -- (-1113.750) (-1117.648) (-1115.461) [-1113.301] * (-1115.326) (-1120.647) (-1115.795) [-1114.487] -- 0:00:02
956000 -- [-1113.810] (-1116.679) (-1115.696) (-1116.981) * (-1116.523) [-1116.148] (-1117.472) (-1113.654) -- 0:00:02
956500 -- [-1114.105] (-1115.507) (-1115.998) (-1113.643) * (-1114.144) (-1119.611) (-1114.095) [-1116.089] -- 0:00:02
957000 -- (-1114.719) (-1115.428) [-1115.400] (-1117.564) * [-1117.943] (-1113.688) (-1115.019) (-1115.397) -- 0:00:02
957500 -- (-1115.484) (-1116.909) (-1116.397) [-1116.874] * [-1115.571] (-1116.131) (-1114.796) (-1117.780) -- 0:00:02
958000 -- (-1115.528) (-1113.434) (-1113.690) [-1114.622] * (-1116.459) (-1114.826) (-1116.761) [-1115.830] -- 0:00:02
958500 -- (-1117.399) [-1113.714] (-1113.828) (-1115.763) * (-1121.325) (-1114.659) [-1117.732] (-1115.013) -- 0:00:02
959000 -- (-1120.275) (-1114.772) (-1116.172) [-1115.747] * (-1115.476) [-1114.928] (-1114.589) (-1115.406) -- 0:00:02
959500 -- (-1118.832) (-1114.699) (-1120.920) [-1120.130] * (-1115.958) (-1118.278) (-1115.482) [-1114.968] -- 0:00:02
960000 -- (-1119.231) [-1113.880] (-1114.194) (-1115.124) * (-1118.817) [-1116.479] (-1114.714) (-1114.795) -- 0:00:02
Average standard deviation of split frequencies: 0.007794
960500 -- (-1114.178) (-1115.670) (-1114.060) [-1113.847] * [-1114.063] (-1113.564) (-1115.687) (-1118.886) -- 0:00:02
961000 -- (-1114.699) (-1117.837) [-1114.506] (-1114.340) * (-1118.518) [-1113.804] (-1113.925) (-1114.662) -- 0:00:02
961500 -- (-1114.439) (-1118.442) (-1115.758) [-1116.197] * [-1116.268] (-1117.354) (-1118.157) (-1114.663) -- 0:00:02
962000 -- [-1116.096] (-1117.416) (-1118.208) (-1114.981) * (-1117.459) (-1113.519) (-1115.267) [-1116.417] -- 0:00:02
962500 -- (-1116.106) [-1116.658] (-1116.466) (-1115.250) * (-1114.551) (-1117.617) (-1118.659) [-1116.467] -- 0:00:02
963000 -- (-1116.288) (-1121.070) (-1113.929) [-1117.342] * [-1114.135] (-1122.188) (-1115.709) (-1114.813) -- 0:00:02
963500 -- (-1116.218) (-1116.875) (-1119.395) [-1116.021] * [-1115.724] (-1118.753) (-1114.405) (-1114.724) -- 0:00:02
964000 -- (-1116.457) (-1115.123) (-1115.275) [-1114.688] * (-1114.749) (-1114.532) [-1115.808] (-1117.723) -- 0:00:02
964500 -- [-1116.090] (-1113.715) (-1113.773) (-1115.387) * [-1117.113] (-1115.796) (-1116.603) (-1114.050) -- 0:00:02
965000 -- [-1116.393] (-1117.850) (-1116.351) (-1117.675) * (-1115.487) [-1114.584] (-1115.096) (-1113.810) -- 0:00:02
Average standard deviation of split frequencies: 0.007779
965500 -- (-1116.469) (-1114.598) [-1115.056] (-1117.672) * (-1116.949) [-1114.991] (-1116.093) (-1118.102) -- 0:00:02
966000 -- [-1114.160] (-1118.282) (-1116.608) (-1116.556) * (-1118.155) (-1114.857) [-1126.635] (-1116.398) -- 0:00:02
966500 -- [-1116.351] (-1116.924) (-1119.090) (-1116.692) * (-1116.512) (-1117.170) [-1114.651] (-1116.308) -- 0:00:02
967000 -- [-1114.269] (-1114.648) (-1115.060) (-1117.678) * (-1115.748) [-1121.853] (-1115.501) (-1115.020) -- 0:00:02
967500 -- [-1113.576] (-1115.393) (-1114.657) (-1115.334) * (-1113.970) (-1113.984) (-1114.784) [-1115.136] -- 0:00:02
968000 -- (-1116.852) (-1115.470) (-1116.153) [-1115.073] * [-1115.386] (-1113.847) (-1116.345) (-1117.061) -- 0:00:01
968500 -- (-1115.923) [-1113.314] (-1115.849) (-1115.189) * [-1117.399] (-1114.961) (-1117.365) (-1115.476) -- 0:00:01
969000 -- [-1116.004] (-1113.351) (-1115.585) (-1115.740) * (-1114.024) (-1114.652) [-1115.068] (-1116.788) -- 0:00:01
969500 -- [-1114.633] (-1115.127) (-1123.549) (-1115.337) * (-1115.919) [-1114.348] (-1114.387) (-1115.361) -- 0:00:01
970000 -- (-1115.616) [-1113.985] (-1120.729) (-1114.177) * (-1115.198) (-1115.133) [-1117.590] (-1115.709) -- 0:00:01
Average standard deviation of split frequencies: 0.007999
970500 -- (-1117.036) (-1116.407) [-1115.041] (-1117.380) * (-1115.356) (-1118.653) [-1117.466] (-1117.201) -- 0:00:01
971000 -- [-1115.945] (-1118.763) (-1116.012) (-1117.513) * (-1115.530) (-1115.617) [-1116.832] (-1114.159) -- 0:00:01
971500 -- [-1116.755] (-1116.646) (-1116.144) (-1117.615) * (-1113.390) (-1114.421) [-1116.903] (-1113.581) -- 0:00:01
972000 -- (-1116.460) (-1114.654) (-1118.384) [-1117.429] * (-1113.448) (-1115.622) [-1115.465] (-1114.024) -- 0:00:01
972500 -- (-1115.153) (-1113.867) (-1122.115) [-1114.474] * (-1114.011) (-1114.241) (-1113.776) [-1114.199] -- 0:00:01
973000 -- (-1115.116) (-1113.537) [-1114.945] (-1115.368) * [-1113.598] (-1117.636) (-1114.083) (-1113.671) -- 0:00:01
973500 -- (-1114.151) (-1117.039) [-1114.598] (-1115.862) * (-1114.172) [-1116.241] (-1114.395) (-1113.460) -- 0:00:01
974000 -- (-1115.229) [-1116.435] (-1116.425) (-1114.863) * (-1119.161) (-1117.812) [-1116.557] (-1117.522) -- 0:00:01
974500 -- (-1114.900) (-1117.251) [-1114.501] (-1117.591) * (-1114.928) (-1116.480) (-1116.707) [-1115.371] -- 0:00:01
975000 -- [-1114.186] (-1117.281) (-1114.612) (-1115.850) * (-1122.391) (-1118.490) [-1115.448] (-1121.379) -- 0:00:01
Average standard deviation of split frequencies: 0.008239
975500 -- (-1116.593) (-1121.759) [-1117.401] (-1115.128) * (-1116.901) [-1120.714] (-1115.294) (-1114.148) -- 0:00:01
976000 -- (-1114.959) (-1114.589) (-1118.468) [-1115.103] * (-1113.896) (-1118.950) (-1114.593) [-1114.518] -- 0:00:01
976500 -- (-1114.303) [-1114.715] (-1115.172) (-1118.506) * (-1114.987) [-1114.407] (-1115.283) (-1116.593) -- 0:00:01
977000 -- (-1116.411) (-1116.325) (-1121.046) [-1116.181] * (-1121.798) (-1117.245) (-1113.769) [-1115.008] -- 0:00:01
977500 -- [-1117.747] (-1113.525) (-1116.345) (-1119.042) * (-1116.400) [-1113.641] (-1114.153) (-1114.615) -- 0:00:01
978000 -- (-1114.610) (-1114.660) (-1116.948) [-1115.697] * (-1115.862) (-1117.418) [-1114.087] (-1117.716) -- 0:00:01
978500 -- [-1117.060] (-1113.872) (-1119.349) (-1113.534) * (-1117.060) [-1117.997] (-1115.501) (-1113.753) -- 0:00:01
979000 -- (-1119.021) [-1116.488] (-1115.104) (-1114.711) * (-1116.327) [-1114.068] (-1114.711) (-1116.567) -- 0:00:01
979500 -- (-1116.829) (-1115.298) [-1114.901] (-1116.779) * (-1114.729) (-1114.026) [-1114.955] (-1117.621) -- 0:00:01
980000 -- (-1116.201) (-1114.539) [-1113.587] (-1116.785) * (-1116.376) [-1116.604] (-1115.063) (-1115.379) -- 0:00:01
Average standard deviation of split frequencies: 0.007719
980500 -- [-1115.927] (-1115.570) (-1113.706) (-1116.585) * (-1115.263) (-1114.804) [-1113.947] (-1115.211) -- 0:00:01
981000 -- (-1117.504) (-1116.062) (-1119.439) [-1117.665] * (-1113.880) [-1114.723] (-1114.935) (-1117.648) -- 0:00:01
981500 -- (-1115.131) (-1114.533) [-1113.637] (-1115.649) * [-1114.307] (-1118.455) (-1114.385) (-1114.429) -- 0:00:01
982000 -- (-1116.401) (-1114.758) (-1116.475) [-1117.264] * (-1117.749) [-1118.842] (-1116.841) (-1116.337) -- 0:00:01
982500 -- [-1115.530] (-1117.711) (-1116.193) (-1116.314) * (-1115.172) [-1114.437] (-1117.170) (-1115.235) -- 0:00:01
983000 -- (-1123.512) [-1116.647] (-1118.255) (-1115.339) * (-1118.818) (-1116.643) (-1117.163) [-1115.574] -- 0:00:01
983500 -- (-1115.574) (-1115.595) [-1116.960] (-1117.549) * (-1117.288) [-1119.742] (-1115.583) (-1117.628) -- 0:00:01
984000 -- (-1113.837) (-1115.244) (-1114.365) [-1120.914] * [-1114.040] (-1120.063) (-1114.390) (-1116.902) -- 0:00:00
984500 -- (-1114.688) [-1114.022] (-1118.922) (-1118.756) * [-1113.990] (-1114.055) (-1113.954) (-1118.064) -- 0:00:00
985000 -- [-1113.615] (-1113.632) (-1114.197) (-1115.973) * (-1116.308) (-1114.464) [-1113.720] (-1117.072) -- 0:00:00
Average standard deviation of split frequencies: 0.007678
985500 -- (-1113.399) (-1118.841) (-1114.129) [-1115.499] * (-1115.201) (-1116.046) [-1114.798] (-1118.636) -- 0:00:00
986000 -- [-1113.588] (-1114.471) (-1114.817) (-1117.913) * [-1117.018] (-1114.019) (-1114.064) (-1117.439) -- 0:00:00
986500 -- (-1114.458) (-1117.665) (-1117.439) [-1114.118] * (-1115.179) [-1114.017] (-1114.199) (-1117.255) -- 0:00:00
987000 -- [-1114.943] (-1117.107) (-1114.973) (-1113.632) * (-1115.178) (-1116.407) (-1115.769) [-1114.728] -- 0:00:00
987500 -- (-1115.129) [-1115.817] (-1114.742) (-1120.076) * [-1114.239] (-1122.069) (-1114.024) (-1115.073) -- 0:00:00
988000 -- (-1113.763) [-1115.712] (-1115.135) (-1116.795) * (-1113.383) (-1115.185) (-1114.072) [-1120.099] -- 0:00:00
988500 -- [-1115.169] (-1117.081) (-1120.050) (-1116.697) * (-1116.412) (-1114.687) [-1116.910] (-1115.688) -- 0:00:00
989000 -- [-1114.124] (-1118.533) (-1116.890) (-1119.303) * [-1114.535] (-1115.103) (-1119.140) (-1114.143) -- 0:00:00
989500 -- [-1115.478] (-1114.869) (-1114.552) (-1116.789) * (-1116.027) (-1114.430) [-1116.258] (-1113.646) -- 0:00:00
990000 -- [-1117.682] (-1119.411) (-1115.829) (-1115.048) * (-1119.335) (-1114.939) [-1115.005] (-1117.183) -- 0:00:00
Average standard deviation of split frequencies: 0.007530
990500 -- (-1115.759) [-1119.669] (-1114.786) (-1114.788) * [-1115.604] (-1113.988) (-1115.810) (-1113.667) -- 0:00:00
991000 -- (-1114.544) [-1117.992] (-1115.593) (-1122.218) * (-1114.563) (-1115.076) (-1119.176) [-1114.191] -- 0:00:00
991500 -- (-1128.174) (-1117.528) [-1114.332] (-1117.026) * (-1117.741) (-1120.359) (-1114.632) [-1116.138] -- 0:00:00
992000 -- (-1116.631) [-1115.788] (-1114.439) (-1116.101) * (-1114.850) (-1119.704) [-1113.918] (-1113.635) -- 0:00:00
992500 -- [-1116.861] (-1114.367) (-1115.240) (-1119.232) * [-1116.564] (-1116.115) (-1114.793) (-1119.014) -- 0:00:00
993000 -- (-1114.735) (-1115.965) [-1116.383] (-1116.550) * [-1115.291] (-1115.569) (-1115.799) (-1118.745) -- 0:00:00
993500 -- (-1117.652) [-1115.899] (-1115.941) (-1116.805) * [-1114.535] (-1116.195) (-1115.359) (-1114.561) -- 0:00:00
994000 -- (-1113.228) (-1115.225) [-1115.106] (-1117.022) * (-1119.174) (-1114.226) [-1115.761] (-1115.270) -- 0:00:00
994500 -- (-1113.206) (-1114.522) [-1116.045] (-1117.716) * [-1114.893] (-1115.491) (-1117.802) (-1113.694) -- 0:00:00
995000 -- (-1113.802) (-1117.136) [-1115.038] (-1115.596) * (-1116.450) [-1114.395] (-1118.476) (-1118.872) -- 0:00:00
Average standard deviation of split frequencies: 0.007851
995500 -- (-1116.621) (-1118.077) (-1116.027) [-1115.662] * (-1116.173) [-1113.773] (-1117.308) (-1118.013) -- 0:00:00
996000 -- (-1118.987) (-1117.293) [-1113.499] (-1114.197) * (-1114.049) (-1115.119) [-1115.794] (-1116.627) -- 0:00:00
996500 -- (-1114.576) [-1115.233] (-1114.817) (-1117.821) * (-1114.099) (-1115.027) [-1114.629] (-1123.519) -- 0:00:00
997000 -- (-1116.445) (-1114.793) [-1116.477] (-1119.011) * (-1116.862) (-1116.115) [-1116.928] (-1116.136) -- 0:00:00
997500 -- [-1114.129] (-1116.363) (-1114.453) (-1117.017) * (-1117.536) (-1117.687) [-1114.867] (-1115.142) -- 0:00:00
998000 -- [-1115.953] (-1123.919) (-1115.558) (-1115.382) * (-1115.645) [-1116.596] (-1116.913) (-1115.239) -- 0:00:00
998500 -- (-1117.133) [-1117.126] (-1116.673) (-1114.483) * (-1115.109) [-1114.052] (-1117.168) (-1114.361) -- 0:00:00
999000 -- (-1119.113) (-1117.021) [-1116.240] (-1114.835) * [-1115.339] (-1116.440) (-1114.006) (-1113.322) -- 0:00:00
999500 -- [-1117.295] (-1113.998) (-1115.862) (-1115.190) * (-1117.764) (-1113.938) [-1115.777] (-1115.603) -- 0:00:00
1000000 -- [-1114.783] (-1117.038) (-1114.894) (-1116.645) * (-1114.708) (-1118.367) [-1114.800] (-1114.747) -- 0:00:00
Average standard deviation of split frequencies: 0.007731
Analysis completed in 1 mins 2 seconds
Analysis used 60.92 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1113.13
Likelihood of best state for "cold" chain of run 2 was -1113.13
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 30 %) Dirichlet(Pi{all})
29.2 % ( 29 %) Slider(Pi{all})
79.4 % ( 55 %) Multiplier(Alpha{1,2})
77.4 % ( 50 %) Multiplier(Alpha{3})
20.4 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.3 % ( 25 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.7 % ( 22 %) Dirichlet(Pi{all})
28.8 % ( 25 %) Slider(Pi{all})
78.6 % ( 47 %) Multiplier(Alpha{1,2})
78.0 % ( 49 %) Multiplier(Alpha{3})
20.6 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.1 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167037 0.82 0.67
3 | 166017 166153 0.84
4 | 166941 167220 166632
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167153 0.82 0.67
3 | 165945 166847 0.84
4 | 166379 166980 166696
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1114.92
| 2 2 2 |
|2 1 1 |
| 2 1 2 2 |
|1 2 21 21 221 21 1 11 |
| 2 1 1 2 * 1 1 21 2 22|
| 1* 22 2 1 2 *2 21 2 2 2 2 2 21 |
| 2 21 1 1 1 * 21 1 1 *2 |
| 11 * 2 2 1 *1 1 2 1 |
| 2 1 22 2 2 2 2 1 1|
| 1 1 1 1 1 2 1 22 |
| 2 2 1 1 |
| 111 1 1 1 |
| 1 1 1 2 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1116.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1114.92 -1118.20
2 -1114.86 -1119.57
--------------------------------------
TOTAL -1114.89 -1119.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900240 0.091527 0.365152 1.492647 0.870972 1309.65 1321.32 1.000
r(A<->C){all} 0.168964 0.021313 0.000018 0.474191 0.127193 146.40 185.73 1.000
r(A<->G){all} 0.160407 0.018664 0.000043 0.427300 0.121669 140.72 154.26 1.001
r(A<->T){all} 0.159865 0.019159 0.000020 0.452262 0.123080 259.21 277.29 1.003
r(C<->G){all} 0.172492 0.020259 0.000001 0.452639 0.137947 174.66 224.34 1.000
r(C<->T){all} 0.164577 0.020161 0.000003 0.445366 0.127397 177.45 221.56 1.000
r(G<->T){all} 0.173695 0.020789 0.000012 0.452927 0.136624 189.30 276.87 1.001
pi(A){all} 0.214049 0.000217 0.185840 0.242756 0.213879 1116.27 1153.70 1.000
pi(C){all} 0.296688 0.000261 0.265815 0.328086 0.296901 1301.96 1320.36 1.000
pi(G){all} 0.279120 0.000250 0.246087 0.307724 0.278919 1318.43 1320.61 1.000
pi(T){all} 0.210142 0.000207 0.182902 0.238934 0.209869 1120.86 1203.87 1.000
alpha{1,2} 0.413638 0.221761 0.000194 1.376281 0.249124 989.17 1159.47 1.000
alpha{3} 0.450126 0.222412 0.000374 1.471322 0.282944 1106.97 1303.99 1.000
pinvar{all} 0.998165 0.000005 0.994071 0.999997 0.998878 1077.68 1103.73 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .**.**
9 -- ....**
10 -- ...*.*
11 -- .*..*.
12 -- .*.***
13 -- ...**.
14 -- .****.
15 -- ..*.*.
16 -- .***.*
17 -- .*...*
18 -- .*.*..
19 -- ..****
20 -- ..*..*
21 -- ..**..
22 -- .**.*.
23 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 490 0.163225 0.003769 0.160560 0.165889 2
8 450 0.149900 0.008480 0.143904 0.155896 2
9 447 0.148901 0.015546 0.137908 0.159893 2
10 446 0.148568 0.002827 0.146569 0.150566 2
11 438 0.145903 0.001884 0.144570 0.147235 2
12 435 0.144903 0.004240 0.141905 0.147901 2
13 434 0.144570 0.016017 0.133245 0.155896 2
14 432 0.143904 0.002827 0.141905 0.145903 2
15 428 0.142572 0.000942 0.141905 0.143238 2
16 413 0.137575 0.010835 0.129913 0.145237 2
17 411 0.136909 0.005182 0.133245 0.140573 2
18 409 0.136243 0.004240 0.133245 0.139241 2
19 404 0.134577 0.002827 0.132578 0.136576 2
20 402 0.133911 0.015075 0.123251 0.144570 2
21 400 0.133245 0.005653 0.129247 0.137242 2
22 295 0.098268 0.017430 0.085943 0.110593 2
23 273 0.090939 0.013662 0.081279 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101804 0.010658 0.000012 0.314928 0.069908 1.000 2
length{all}[2] 0.101087 0.010097 0.000072 0.296861 0.069899 1.000 2
length{all}[3] 0.101443 0.009755 0.000015 0.298367 0.071204 1.001 2
length{all}[4] 0.099957 0.009989 0.000053 0.299986 0.069824 1.000 2
length{all}[5] 0.099570 0.010300 0.000091 0.299737 0.067154 1.000 2
length{all}[6] 0.099271 0.009201 0.000002 0.285177 0.071669 1.000 2
length{all}[7] 0.099732 0.009618 0.000093 0.294282 0.069343 0.998 2
length{all}[8] 0.093860 0.010893 0.000162 0.310358 0.059262 1.000 2
length{all}[9] 0.103129 0.010201 0.000118 0.293260 0.071818 1.002 2
length{all}[10] 0.092266 0.008658 0.000516 0.258628 0.064290 0.999 2
length{all}[11] 0.097844 0.010043 0.000285 0.262046 0.069814 0.998 2
length{all}[12] 0.100130 0.008768 0.000098 0.301279 0.068585 0.998 2
length{all}[13] 0.106475 0.011733 0.000222 0.306605 0.074647 1.001 2
length{all}[14] 0.102456 0.010321 0.000058 0.292202 0.071768 0.999 2
length{all}[15] 0.100848 0.010208 0.000453 0.300976 0.069533 0.999 2
length{all}[16] 0.105591 0.012641 0.000010 0.323615 0.075076 0.998 2
length{all}[17] 0.098346 0.009566 0.000046 0.305482 0.069400 0.999 2
length{all}[18] 0.099134 0.009554 0.000756 0.284260 0.072211 1.000 2
length{all}[19] 0.094109 0.010476 0.000142 0.290717 0.061504 0.999 2
length{all}[20] 0.099746 0.009131 0.000105 0.292390 0.068481 1.000 2
length{all}[21] 0.096954 0.008759 0.000238 0.267670 0.076951 0.998 2
length{all}[22] 0.105266 0.012244 0.000115 0.335388 0.070279 0.998 2
length{all}[23] 0.085925 0.006729 0.000437 0.255695 0.061114 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007731
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 810
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 270 / 270 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 270 / 270 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107688 0.104618 0.098941 0.061709 0.075542 0.012967 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1201.531719
Iterating by ming2
Initial: fx= 1201.531719
x= 0.10769 0.10462 0.09894 0.06171 0.07554 0.01297 0.30000 1.30000
1 h-m-p 0.0000 0.0000 645.6395 ++ 1181.227890 m 0.0000 13 | 1/8
2 h-m-p 0.0004 0.0065 74.1298 ----------.. | 1/8
3 h-m-p 0.0000 0.0002 589.3858 +++ 1116.892765 m 0.0002 44 | 2/8
4 h-m-p 0.0017 0.0115 56.7896 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 530.8732 ++ 1102.087952 m 0.0001 76 | 3/8
6 h-m-p 0.0006 0.0308 43.2363 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 460.2725 ++ 1083.172716 m 0.0001 107 | 4/8
8 h-m-p 0.0010 0.0400 32.9633 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 377.1438 ++ 1080.092825 m 0.0000 138 | 5/8
10 h-m-p 0.0003 0.0585 22.8838 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 266.8673 ++ 1079.258842 m 0.0000 168 | 6/8
12 h-m-p 0.0219 8.0000 0.0000 Y 1079.258842 0 0.0219 179 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 N 1079.258842 0 0.2000 192
Out..
lnL = -1079.258842
193 lfun, 193 eigenQcodon, 1158 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048805 0.046756 0.094491 0.089617 0.091739 0.058857 0.299943 0.596200 0.181659
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.809000
np = 9
lnL0 = -1185.312136
Iterating by ming2
Initial: fx= 1185.312136
x= 0.04881 0.04676 0.09449 0.08962 0.09174 0.05886 0.29994 0.59620 0.18166
1 h-m-p 0.0000 0.0002 565.1456 +++ 1118.144020 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 371.0587 ++ 1115.498079 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 1107858.9396 ++ 1105.130291 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 23467.7348 ++ 1081.130792 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 855.2593 ++ 1079.988830 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3616.0674 ++ 1079.881573 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0023 30.8565 +++ 1079.258711 m 0.0023 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0009 ++ 1079.258709 m 8.0000 100 | 7/9
9 h-m-p 0.0274 2.9133 0.2631 ----------Y 1079.258709 0 0.0000 124 | 7/9
10 h-m-p 0.0160 8.0000 0.0032 +++++ 1079.258699 m 8.0000 141 | 7/9
11 h-m-p 0.0872 2.5893 0.2891 ------------Y 1079.258699 0 0.0000 167 | 7/9
12 h-m-p 0.0160 8.0000 0.0022 -------Y 1079.258699 0 0.0000 188 | 7/9
13 h-m-p 0.0160 8.0000 0.0003 +++++ 1079.258698 m 8.0000 205 | 7/9
14 h-m-p 0.0080 2.8228 0.2662 ----------C 1079.258698 0 0.0000 229 | 7/9
15 h-m-p 0.0160 8.0000 0.0002 --------C 1079.258698 0 0.0000 251 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1079.258698 m 8.0000 268 | 7/9
17 h-m-p 0.0043 2.1358 0.3628 ----------Y 1079.258698 0 0.0000 292 | 7/9
18 h-m-p 0.0160 8.0000 0.0001 +++++ 1079.258698 m 8.0000 309 | 7/9
19 h-m-p 0.0059 2.9546 0.2597 ------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0004 +++++ 1079.258696 m 8.0000 350 | 7/9
21 h-m-p 0.0132 3.0479 0.2607 ----------C 1079.258696 0 0.0000 374 | 7/9
22 h-m-p 0.0160 8.0000 0.0043 +++++ 1079.258681 m 8.0000 391 | 7/9
23 h-m-p 0.1267 2.8841 0.2735 ---------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0005 +++++ 1079.258679 m 8.0000 435 | 7/9
25 h-m-p 0.0164 3.4183 0.2438 -----------Y 1079.258679 0 0.0000 460 | 7/9
26 h-m-p 0.0160 8.0000 0.0019 +++++ 1079.258672 m 8.0000 477 | 7/9
27 h-m-p 0.0558 3.0950 0.2660 -----------C 1079.258672 0 0.0000 502 | 7/9
28 h-m-p 0.0160 8.0000 0.0002 -----Y 1079.258672 0 0.0000 521 | 7/9
29 h-m-p 0.0160 8.0000 0.0002 +++++ 1079.258671 m 8.0000 538 | 7/9
30 h-m-p 0.0065 3.2369 0.2547 ----------Y 1079.258671 0 0.0000 562 | 7/9
31 h-m-p 0.0160 8.0000 0.0004 +++++ 1079.258670 m 8.0000 579 | 7/9
32 h-m-p 0.0139 3.2909 0.2497 ------------Y 1079.258670 0 0.0000 605 | 7/9
33 h-m-p 0.0160 8.0000 0.0002 -------N 1079.258670 0 0.0000 626 | 7/9
34 h-m-p 0.0160 8.0000 0.0000 -----N 1079.258670 0 0.0000 645
Out..
lnL = -1079.258670
646 lfun, 1938 eigenQcodon, 7752 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025855 0.108025 0.101988 0.033755 0.030287 0.030925 0.257719 1.184928 0.397163 0.316936 1.547741
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.488528
np = 11
lnL0 = -1162.638798
Iterating by ming2
Initial: fx= 1162.638798
x= 0.02586 0.10803 0.10199 0.03375 0.03029 0.03092 0.25772 1.18493 0.39716 0.31694 1.54774
1 h-m-p 0.0000 0.0001 590.3122 ++ 1124.673461 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 226.7367 ++ 1118.795093 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 1443.3108 ++ 1118.185465 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 22157.0494 ++ 1116.177666 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0002 904.7975 ++ 1081.104166 m 0.0002 72 | 5/11
6 h-m-p 0.0000 0.0000 634.0888 ++ 1079.258781 m 0.0000 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 1079.258781 m 8.0000 100 | 6/11
8 h-m-p 0.0164 3.4059 0.0333 ++++ 1079.258767 m 3.4059 121 | 7/11
9 h-m-p 0.2366 8.0000 0.1908 -------------C 1079.258767 0 0.0000 153 | 7/11
10 h-m-p 0.0160 8.0000 0.0002 +++++ 1079.258767 m 8.0000 174 | 7/11
11 h-m-p 0.0160 8.0000 1.2438 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1079.258767 m 8.0000 220 | 7/11
13 h-m-p 0.0085 3.3986 0.0890 +++++ 1079.258732 m 3.3986 241 | 8/11
14 h-m-p 0.2899 8.0000 0.7739 ---------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 1079.258732 m 8.0000 292 | 8/11
16 h-m-p 0.0160 8.0000 1.6831 -----------Y 1079.258732 0 0.0000 320 | 8/11
17 h-m-p 0.0160 8.0000 0.0006 +++++ 1079.258732 m 8.0000 337 | 8/11
18 h-m-p 0.0160 8.0000 2.2576 -----------C 1079.258732 0 0.0000 365 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 1079.258732 m 8.0000 382 | 8/11
20 h-m-p 0.0160 8.0000 5.0675 ------------Y 1079.258732 0 0.0000 411 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 Y 1079.258732 0 0.0160 425 | 8/11
22 h-m-p 0.0255 8.0000 0.0000 -N 1079.258732 0 0.0016 443
Out..
lnL = -1079.258732
444 lfun, 1776 eigenQcodon, 7992 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1079.277814 S = -1079.255165 -0.008692
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:05
did 20 / 55 patterns 0:05
did 30 / 55 patterns 0:05
did 40 / 55 patterns 0:05
did 50 / 55 patterns 0:05
did 55 / 55 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080010 0.022768 0.012387 0.049102 0.024934 0.105348 0.000100 1.164308 1.787656
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.466089
np = 9
lnL0 = -1153.874364
Iterating by ming2
Initial: fx= 1153.874364
x= 0.08001 0.02277 0.01239 0.04910 0.02493 0.10535 0.00011 1.16431 1.78766
1 h-m-p 0.0000 0.0000 604.2213 ++ 1153.204461 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0120 59.2200 +++++ 1126.023145 m 0.0120 29 | 2/9
3 h-m-p 0.0000 0.0000 14616.5169 ++ 1116.034611 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0000 3660.9430 ++ 1113.222496 m 0.0000 53 | 4/9
5 h-m-p 0.0000 0.0000 143.6243 ++ 1112.128331 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0018 56.4941 +++ 1093.791493 m 0.0018 78 | 6/9
7 h-m-p 0.0005 0.0026 95.0719
QuantileBeta(0.15, 0.00500, 2.13823) = 1.237844e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
+ 1084.132652 m 0.0026 90
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203469e-160 2000 rounds
| 7/9
8 h-m-p 0.0235 0.2131 10.2873 -
QuantileBeta(0.15, 0.00500, 2.17135) = 1.214007e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18264) = 1.206087e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18547) = 1.204123e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18617) = 1.203633e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18635) = 1.203511e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18639) = 1.203480e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203472e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203471e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203469e-160 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0001 243.5599
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
+ 1079.258396 m 0.0001 125
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203469e-160 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
Y 1079.258396 0 1.6000 137
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18653) = 1.203386e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18629) = 1.203554e-160 2000 rounds
| 8/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
Y 1079.258396 0 0.1000 151
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
Out..
lnL = -1079.258396
152 lfun, 1672 eigenQcodon, 9120 P(t)
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18641) = 1.203470e-160 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068345 0.070075 0.027312 0.060062 0.047973 0.057550 0.000100 0.900000 0.779502 1.649723 1.299812
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.854272
np = 11
lnL0 = -1160.714903
Iterating by ming2
Initial: fx= 1160.714903
x= 0.06835 0.07007 0.02731 0.06006 0.04797 0.05755 0.00011 0.90000 0.77950 1.64972 1.29981
1 h-m-p 0.0000 0.0000 566.7764 ++ 1160.264888 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 179.9821 ++++ 1120.138451 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0000 3918.8781 ++ 1094.912476 m 0.0000 46 | 3/11
4 h-m-p 0.0008 0.0042 44.8798 ++ 1087.297426 m 0.0042 60 | 4/11
5 h-m-p 0.0000 0.0000 2711.5452 ++ 1085.473215 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 22236.7051 ++ 1080.142631 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 3459.5261 ++ 1079.258698 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 1079.258697 m 8.0000 116 | 7/11
9 h-m-p 0.0129 6.4700 0.1857 ------------C 1079.258697 0 0.0000 146 | 7/11
10 h-m-p 0.0024 1.1825 0.1528 +++++ 1079.258537 m 1.1825 167 | 8/11
11 h-m-p 0.7811 7.6201 0.1584 -------------Y 1079.258537 0 0.0000 198 | 8/11
12 h-m-p 0.0160 8.0000 0.0011 +++++ 1079.258533 m 8.0000 218 | 8/11
13 h-m-p 0.0299 8.0000 0.2823 ------------Y 1079.258533 0 0.0000 247 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 ------Y 1079.258533 0 0.0000 270 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1079.258533 m 8.0000 290 | 8/11
16 h-m-p 0.0046 2.3047 0.4261 ----------Y 1079.258533 0 0.0000 317 | 8/11
17 h-m-p 0.0160 8.0000 0.0029 ---------N 1079.258533 0 0.0000 343 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 -----------N 1079.258533 0 0.0000 371
Out..
lnL = -1079.258533
372 lfun, 4464 eigenQcodon, 24552 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1079.315360 S = -1079.257799 -0.025563
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:13
did 20 / 55 patterns 0:14
did 30 / 55 patterns 0:14
did 40 / 55 patterns 0:14
did 50 / 55 patterns 0:14
did 55 / 55 patterns 0:14
Time used: 0:14
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1644/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 270
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 6 6 6 6 6 6 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 5 5 5 5 5 5 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 5 5 5 5 5 5 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 10 10 10 10 10 10 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 5 5 5 5 5 5 | CCC 5 5 5 5 5 5 | CAC 4 4 4 4 4 4 | CGC 8 8 8 8 8 8
CTA 3 3 3 3 3 3 | CCA 6 6 6 6 6 6 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 7 7 7 7 7 7 | CCG 13 13 13 13 13 13 | CAG 13 13 13 13 13 13 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 11 11 11 11 11 11 | ACC 8 8 8 8 8 8 | AAC 7 7 7 7 7 7 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 4 4 4 4 4 4 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 8 8 8 8 8 8 | GCC 5 5 5 5 5 5 | GAC 8 8 8 8 8 8 | GGC 9 9 9 9 9 9
GTA 1 1 1 1 1 1 | GCA 6 6 6 6 6 6 | Glu GAA 7 7 7 7 7 7 | GGA 4 4 4 4 4 4
GTG 11 11 11 11 11 11 | GCG 5 5 5 5 5 5 | GAG 5 5 5 5 5 5 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908451_1_1743_MLBR_RS08260
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
#2: NC_002677_1_NP_302130_1_1002_ML1644
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
#3: NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
#4: NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
#5: NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
#6: NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 36 | Cys C TGT 6
TTC 24 | TCC 30 | TAC 24 | TGC 0
Leu L TTA 30 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 60 | TCG 36 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 12
CTC 30 | CCC 30 | CAC 24 | CGC 48
CTA 18 | CCA 36 | Gln Q CAA 12 | CGA 6
CTG 42 | CCG 78 | CAG 78 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 66 | ACC 48 | AAC 42 | AGC 0
ATA 6 | ACA 18 | Lys K AAA 36 | Arg R AGA 0
Met M ATG 30 | ACG 12 | AAG 18 | AGG 18
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 24 | Asp D GAT 30 | Gly G GGT 12
GTC 48 | GCC 30 | GAC 48 | GGC 54
GTA 6 | GCA 36 | Glu E GAA 42 | GGA 24
GTG 66 | GCG 30 | GAG 30 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19259 C:0.28519 A:0.19630 G:0.32593
position 2: T:0.30370 C:0.27037 A:0.26667 G:0.15926
position 3: T:0.13333 C:0.33704 A:0.17778 G:0.35185
Average T:0.20988 C:0.29753 A:0.21358 G:0.27901
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1079.258842 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299943 1.299812
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908451_1_1743_MLBR_RS08260: 0.000004, NC_002677_1_NP_302130_1_1002_ML1644: 0.000004, NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740: 0.000004, NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230: 0.000004, NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015: 0.000004, NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29994
omega (dN/dS) = 1.29981
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 629.2 180.8 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1079.258670 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.257719 0.812150 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908451_1_1743_MLBR_RS08260: 0.000004, NC_002677_1_NP_302130_1_1002_ML1644: 0.000004, NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740: 0.000004, NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230: 0.000004, NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015: 0.000004, NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.25772
MLEs of dN/dS (w) for site classes (K=2)
p: 0.81215 0.18785
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
7..2 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
7..3 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
7..4 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
7..5 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
7..6 0.000 630.5 179.5 0.1879 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1079.258732 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.640335 0.205794 0.000001 1.480962
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908451_1_1743_MLBR_RS08260: 0.000004, NC_002677_1_NP_302130_1_1002_ML1644: 0.000004, NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740: 0.000004, NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230: 0.000004, NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015: 0.000004, NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.64034 0.20579 0.15387
w: 0.00000 1.00000 1.48096
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
7..2 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
7..3 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
7..4 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
7..5 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
7..6 0.000 639.8 170.2 0.4337 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908451_1_1743_MLBR_RS08260)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908451_1_1743_MLBR_RS08260)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1079.258396 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.186409
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908451_1_1743_MLBR_RS08260: 0.000004, NC_002677_1_NP_302130_1_1002_ML1644: 0.000004, NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740: 0.000004, NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230: 0.000004, NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015: 0.000004, NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.18641
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 639.8 170.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1079.258533 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.190873 1.822873 1.678310
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908451_1_1743_MLBR_RS08260: 0.000004, NC_002677_1_NP_302130_1_1002_ML1644: 0.000004, NZ_LVXE01000023_1_WP_010908451_1_979_A3216_RS07740: 0.000004, NZ_LYPH01000027_1_WP_010908451_1_1093_A8144_RS05230: 0.000004, NZ_CP029543_1_WP_010908451_1_1772_DIJ64_RS09015: 0.000004, NZ_AP014567_1_WP_010908451_1_1816_JK2ML_RS09235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.19087 q = 1.82287
(p1 = 0.00001) w = 1.67831
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00002 0.00031 0.00184 0.00687 0.01985 0.04859 0.10716 0.22464 0.49273 1.67831
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
7..2 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
7..3 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
7..4 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
7..5 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
7..6 0.000 639.8 170.2 0.0902 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908451_1_1743_MLBR_RS08260)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.098 0.099 0.100 0.101 0.102 0.103 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:14