--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:12:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1644/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1114.92         -1118.20
2      -1114.86         -1119.57
--------------------------------------
TOTAL    -1114.89         -1119.10
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900240    0.091527    0.365152    1.492647    0.870972   1309.65   1321.32    1.000
r(A<->C){all}   0.168964    0.021313    0.000018    0.474191    0.127193    146.40    185.73    1.000
r(A<->G){all}   0.160407    0.018664    0.000043    0.427300    0.121669    140.72    154.26    1.001
r(A<->T){all}   0.159865    0.019159    0.000020    0.452262    0.123080    259.21    277.29    1.003
r(C<->G){all}   0.172492    0.020259    0.000001    0.452639    0.137947    174.66    224.34    1.000
r(C<->T){all}   0.164577    0.020161    0.000003    0.445366    0.127397    177.45    221.56    1.000
r(G<->T){all}   0.173695    0.020789    0.000012    0.452927    0.136624    189.30    276.87    1.001
pi(A){all}      0.214049    0.000217    0.185840    0.242756    0.213879   1116.27   1153.70    1.000
pi(C){all}      0.296688    0.000261    0.265815    0.328086    0.296901   1301.96   1320.36    1.000
pi(G){all}      0.279120    0.000250    0.246087    0.307724    0.278919   1318.43   1320.61    1.000
pi(T){all}      0.210142    0.000207    0.182902    0.238934    0.209869   1120.86   1203.87    1.000
alpha{1,2}      0.413638    0.221761    0.000194    1.376281    0.249124    989.17   1159.47    1.000
alpha{3}        0.450126    0.222412    0.000374    1.471322    0.282944   1106.97   1303.99    1.000
pinvar{all}     0.998165    0.000005    0.994071    0.999997    0.998878   1077.68   1103.73    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1079.25867
Model 2: PositiveSelection	-1079.258732
Model 0: one-ratio	-1079.258842
Model 7: beta	-1079.258396
Model 8: beta&w>1	-1079.258533


Model 0 vs 1	3.440000000409782E-4

Model 2 vs 1	1.2400000014167745E-4

Model 8 vs 7	2.7399999999033753E-4
>C1
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C2
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C3
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C4
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C5
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C6
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=270 

C1              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C2              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C3              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C4              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C5              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C6              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
                **************************************************

C1              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C2              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C3              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C4              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C5              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C6              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
                **************************************************

C1              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C2              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C3              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C4              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C5              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C6              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
                **************************************************

C1              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C2              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C3              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C4              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C5              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C6              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
                **************************************************

C1              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C2              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C3              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C4              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C5              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C6              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
                **************************************************

C1              PSQAPMAVEEKLADRYGHPR
C2              PSQAPMAVEEKLADRYGHPR
C3              PSQAPMAVEEKLADRYGHPR
C4              PSQAPMAVEEKLADRYGHPR
C5              PSQAPMAVEEKLADRYGHPR
C6              PSQAPMAVEEKLADRYGHPR
                ********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  270 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  270 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8100]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8100]--->[8100]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.826 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C2              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C3              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C4              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C5              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
C6              MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
                **************************************************

C1              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C2              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C3              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C4              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C5              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
C6              SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
                **************************************************

C1              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C2              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C3              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C4              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C5              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
C6              QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
                **************************************************

C1              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C2              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C3              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C4              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C5              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
C6              DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
                **************************************************

C1              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C2              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C3              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C4              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C5              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
C6              LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
                **************************************************

C1              PSQAPMAVEEKLADRYGHPR
C2              PSQAPMAVEEKLADRYGHPR
C3              PSQAPMAVEEKLADRYGHPR
C4              PSQAPMAVEEKLADRYGHPR
C5              PSQAPMAVEEKLADRYGHPR
C6              PSQAPMAVEEKLADRYGHPR
                ********************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C2              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C3              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C4              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C5              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
C6              ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
                **************************************************

C1              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C2              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C3              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C4              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C5              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
C6              AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
                **************************************************

C1              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C2              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C3              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C4              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C5              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
C6              AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
                **************************************************

C1              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C2              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C3              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C4              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C5              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
C6              TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
                **************************************************

C1              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C2              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C3              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C4              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C5              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
C6              TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
                **************************************************

C1              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C2              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C3              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C4              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C5              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
C6              ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
                **************************************************

C1              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C2              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C3              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C4              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C5              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
C6              CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
                **************************************************

C1              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C2              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C3              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C4              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C5              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
C6              CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
                **************************************************

C1              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C2              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C3              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C4              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C5              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
C6              CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
                **************************************************

C1              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C2              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C3              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C4              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C5              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
C6              GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
                **************************************************

C1              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C2              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C3              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C4              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C5              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
C6              CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
                **************************************************

C1              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C2              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C3              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C4              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C5              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
C6              TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
                **************************************************

C1              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C2              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C3              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C4              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C5              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
C6              CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
                **************************************************

C1              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C2              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C3              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C4              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C5              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
C6              TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
                **************************************************

C1              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C2              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C3              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C4              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C5              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
C6              ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
                **************************************************

C1              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C2              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C3              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C4              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C5              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
C6              CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
                **************************************************

C1              CCACCCACGG
C2              CCACCCACGG
C3              CCACCCACGG
C4              CCACCCACGG
C5              CCACCCACGG
C6              CCACCCACGG
                **********



>C1
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C2
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C3
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C4
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C5
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C6
ATGCGCCATTTGGCGTTATTATTGCGGCCAGGCTGGATCGCACTGACCTT
AGTGGTTACCGCGTTCACCTACTTGTGTTTTATGGTGCTCGCACCCTGGC
AGTTGGGCAAGAACACCAGGATGTCACGGGAAAACAACCAGATCGAATAT
TCCCTCAACACGCCGCCGGTGCCGGTGAAAACCTTACTATCGCACCAGGA
TTTGTCGACATCGAAATCTCAGTGGCGCCAGGTTACGGCGACCGGGCGCT
ATCTGCCGGACGTCCAGGTGCTGGCCCGGTTGCGAGTGGTTGATTCAGGC
CAGGCTTTCGAGGTGCTAGCACCATTCGTCGTTGACGATGGACCGACCGT
CCTGGTTGATCGCGGTTACGTGCGTCCCGAACCAGGATCGCACGTGCCGC
CAATCCCCCGCCCTCCCAACGAGGCCGTAAGTATCACAGCTCGGCTGCGC
GACTCCGAACCGGTCATGAAAGACAAAGAACCGTTCTCCAGGGACGGCGT
CCAGCAGGTGTATTCGATTAACATCGAACAGGTCGCAAGGTTGACAAAGA
TCCCGTTGGCCGGGTCCTATCTGCAGTTGGTCGATAACCAACCCGGCGGA
CTCGGTGTGATCGACATACCGCATCTCGACGCTGGGCCGTTTCTGTCCTA
TGGCATCCAATGGATCTCGTTTGGCATTATCGCGCCAATTGGATTGGGCT
ATTTAGCCTACGCAGAGATCCGCACCCACCGTCAGGAGAAGCTAGCGAAA
CCGTCACAGGCTCCGATGGCCGTCGAGGAAAAACTCGCAGACCGCTACGG
CCACCCACGG
>C1
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C2
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C3
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C4
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C5
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR
>C6
MRHLALLLRPGWIALTLVVTAFTYLCFMVLAPWQLGKNTRMSRENNQIEY
SLNTPPVPVKTLLSHQDLSTSKSQWRQVTATGRYLPDVQVLARLRVVDSG
QAFEVLAPFVVDDGPTVLVDRGYVRPEPGSHVPPIPRPPNEAVSITARLR
DSEPVMKDKEPFSRDGVQQVYSINIEQVARLTKIPLAGSYLQLVDNQPGG
LGVIDIPHLDAGPFLSYGIQWISFGIIAPIGLGYLAYAEIRTHRQEKLAK
PSQAPMAVEEKLADRYGHPR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 810 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857047
      Setting output file names to "/data/7res/ML1644/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2108245535
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5500454974
      Seed = 798874539
      Swapseed = 1579857047
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1812.818558 -- -24.965149
         Chain 2 -- -1812.818558 -- -24.965149
         Chain 3 -- -1812.818558 -- -24.965149
         Chain 4 -- -1812.818834 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1812.818730 -- -24.965149
         Chain 2 -- -1812.818834 -- -24.965149
         Chain 3 -- -1812.818730 -- -24.965149
         Chain 4 -- -1812.818834 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1812.819] (-1812.819) (-1812.819) (-1812.819) * [-1812.819] (-1812.819) (-1812.819) (-1812.819) 
        500 -- (-1128.216) [-1125.070] (-1128.772) (-1133.297) * [-1126.556] (-1136.773) (-1125.615) (-1132.084) -- 0:00:00
       1000 -- [-1118.450] (-1118.439) (-1126.127) (-1118.833) * (-1128.783) (-1132.463) [-1120.256] (-1127.880) -- 0:00:00
       1500 -- (-1125.788) [-1123.533] (-1126.669) (-1123.805) * [-1124.611] (-1125.312) (-1128.833) (-1128.204) -- 0:00:00
       2000 -- (-1127.307) [-1121.396] (-1123.105) (-1123.271) * [-1121.333] (-1125.445) (-1122.997) (-1125.873) -- 0:00:00
       2500 -- [-1128.816] (-1127.109) (-1126.946) (-1124.829) * (-1121.591) [-1128.799] (-1125.655) (-1125.710) -- 0:00:00
       3000 -- (-1126.092) [-1130.184] (-1123.750) (-1120.754) * (-1126.820) (-1124.397) (-1129.658) [-1123.484] -- 0:00:00
       3500 -- (-1119.983) (-1125.621) [-1122.791] (-1128.218) * (-1125.005) [-1126.437] (-1127.594) (-1125.439) -- 0:04:44
       4000 -- (-1124.289) (-1128.626) [-1124.075] (-1127.863) * (-1123.926) (-1123.828) (-1124.276) [-1121.706] -- 0:04:09
       4500 -- (-1126.487) (-1121.009) [-1120.708] (-1132.038) * [-1119.241] (-1123.331) (-1122.899) (-1119.616) -- 0:03:41
       5000 -- (-1128.039) (-1122.955) (-1127.860) [-1122.553] * (-1124.220) [-1122.661] (-1125.708) (-1126.655) -- 0:03:19

      Average standard deviation of split frequencies: 0.099995

       5500 -- (-1125.411) (-1121.360) [-1125.742] (-1122.347) * (-1122.324) [-1119.982] (-1123.992) (-1128.160) -- 0:03:00
       6000 -- (-1126.181) [-1127.151] (-1123.973) (-1122.358) * (-1121.299) (-1121.112) [-1125.993] (-1128.193) -- 0:02:45
       6500 -- (-1129.565) [-1120.211] (-1121.136) (-1123.720) * (-1120.427) (-1122.062) (-1127.492) [-1126.771] -- 0:02:32
       7000 -- (-1127.184) (-1129.603) (-1120.546) [-1124.953] * (-1124.072) (-1126.769) [-1125.978] (-1124.105) -- 0:02:21
       7500 -- (-1126.306) [-1123.911] (-1129.576) (-1125.805) * (-1129.349) [-1121.895] (-1125.214) (-1127.939) -- 0:02:12
       8000 -- (-1123.087) (-1124.735) (-1125.143) [-1124.230] * (-1128.031) (-1126.391) (-1122.914) [-1125.657] -- 0:02:04
       8500 -- (-1120.040) (-1120.206) (-1125.256) [-1125.053] * (-1122.866) (-1130.404) (-1119.168) [-1122.189] -- 0:01:56
       9000 -- (-1123.324) (-1125.633) [-1121.254] (-1123.996) * (-1132.276) (-1124.005) [-1120.885] (-1125.256) -- 0:01:50
       9500 -- [-1122.072] (-1127.482) (-1125.026) (-1118.421) * (-1133.668) [-1120.781] (-1126.119) (-1121.570) -- 0:01:44
      10000 -- [-1122.238] (-1125.810) (-1122.430) (-1120.997) * (-1140.556) (-1128.650) [-1128.341] (-1122.864) -- 0:01:39

      Average standard deviation of split frequencies: 0.079084

      10500 -- (-1128.335) [-1123.098] (-1122.753) (-1128.581) * [-1133.440] (-1122.931) (-1123.109) (-1124.102) -- 0:01:34
      11000 -- (-1125.463) [-1120.283] (-1123.280) (-1127.069) * (-1121.884) [-1122.366] (-1131.671) (-1123.369) -- 0:01:29
      11500 -- (-1128.203) (-1128.438) [-1124.532] (-1128.693) * (-1126.174) (-1120.618) [-1121.252] (-1124.684) -- 0:01:25
      12000 -- [-1116.919] (-1126.039) (-1123.421) (-1124.949) * (-1134.892) [-1118.634] (-1122.568) (-1128.323) -- 0:01:22
      12500 -- (-1125.366) (-1124.154) (-1129.917) [-1120.319] * [-1121.224] (-1128.356) (-1121.536) (-1127.220) -- 0:01:19
      13000 -- (-1129.192) [-1124.926] (-1121.880) (-1119.242) * (-1120.745) (-1125.182) [-1120.322] (-1127.898) -- 0:01:15
      13500 -- (-1125.893) (-1122.380) [-1124.156] (-1120.339) * (-1123.182) (-1127.706) (-1125.502) [-1122.989] -- 0:01:13
      14000 -- (-1131.545) [-1121.531] (-1123.403) (-1120.390) * (-1132.722) [-1132.046] (-1121.515) (-1124.999) -- 0:01:10
      14500 -- (-1130.333) (-1121.862) (-1121.050) [-1126.915] * [-1127.915] (-1125.697) (-1122.249) (-1128.845) -- 0:01:07
      15000 -- (-1133.724) [-1126.701] (-1129.306) (-1120.478) * (-1127.714) [-1119.759] (-1124.058) (-1129.961) -- 0:01:05

      Average standard deviation of split frequencies: 0.078076

      15500 -- (-1118.546) (-1123.769) (-1130.502) [-1120.934] * (-1120.566) (-1131.913) [-1120.137] (-1128.331) -- 0:01:03
      16000 -- [-1122.750] (-1132.127) (-1122.455) (-1122.835) * (-1122.942) [-1121.943] (-1123.388) (-1120.959) -- 0:01:01
      16500 -- (-1123.712) (-1128.340) [-1131.982] (-1120.968) * [-1123.313] (-1126.845) (-1124.789) (-1126.649) -- 0:00:59
      17000 -- [-1122.714] (-1120.457) (-1125.935) (-1121.318) * (-1129.001) (-1127.440) (-1120.234) [-1126.129] -- 0:00:57
      17500 -- (-1122.083) (-1126.444) [-1125.865] (-1123.665) * (-1132.420) [-1126.906] (-1127.002) (-1128.299) -- 0:00:56
      18000 -- (-1126.688) (-1125.468) (-1126.559) [-1125.513] * (-1132.205) (-1125.813) [-1136.120] (-1131.608) -- 0:00:54
      18500 -- (-1131.774) (-1124.987) (-1121.398) [-1126.268] * [-1120.665] (-1125.558) (-1126.534) (-1129.163) -- 0:00:53
      19000 -- (-1130.258) (-1125.295) [-1129.129] (-1131.199) * (-1122.711) [-1123.759] (-1126.261) (-1131.867) -- 0:00:51
      19500 -- (-1127.849) (-1128.913) (-1122.793) [-1122.529] * (-1130.158) (-1122.150) [-1121.778] (-1125.287) -- 0:01:40
      20000 -- (-1125.123) (-1121.437) [-1125.606] (-1126.053) * [-1120.888] (-1124.778) (-1129.163) (-1124.287) -- 0:01:38

      Average standard deviation of split frequencies: 0.068430

      20500 -- (-1123.975) (-1122.727) (-1126.781) [-1128.551] * (-1129.566) (-1124.179) [-1121.068] (-1123.796) -- 0:01:35
      21000 -- (-1124.116) (-1124.735) (-1124.874) [-1128.181] * (-1126.991) [-1122.886] (-1119.754) (-1124.439) -- 0:01:33
      21500 -- (-1122.783) [-1126.842] (-1123.533) (-1129.516) * (-1132.922) (-1122.978) [-1129.670] (-1128.696) -- 0:01:31
      22000 -- (-1119.879) (-1130.287) (-1126.085) [-1121.670] * [-1126.210] (-1121.883) (-1130.117) (-1127.620) -- 0:01:28
      22500 -- (-1125.247) [-1122.909] (-1125.443) (-1135.203) * (-1119.499) (-1122.633) [-1126.786] (-1122.575) -- 0:01:26
      23000 -- [-1126.780] (-1127.833) (-1130.679) (-1131.486) * (-1123.007) (-1124.110) (-1122.196) [-1123.795] -- 0:01:24
      23500 -- [-1126.034] (-1126.883) (-1127.260) (-1122.831) * [-1122.819] (-1129.122) (-1119.818) (-1119.040) -- 0:01:23
      24000 -- (-1132.589) (-1127.569) (-1129.041) [-1123.638] * (-1127.374) (-1124.724) (-1128.949) [-1128.919] -- 0:01:21
      24500 -- [-1124.883] (-1124.087) (-1125.149) (-1125.208) * (-1125.639) [-1131.534] (-1119.742) (-1133.075) -- 0:01:19
      25000 -- (-1124.307) (-1132.244) [-1129.736] (-1120.517) * (-1124.407) [-1122.661] (-1121.759) (-1122.067) -- 0:01:18

      Average standard deviation of split frequencies: 0.051096

      25500 -- (-1132.638) (-1129.709) (-1129.025) [-1122.061] * (-1122.314) [-1123.959] (-1131.776) (-1119.447) -- 0:01:16
      26000 -- (-1131.354) [-1123.152] (-1122.159) (-1129.915) * (-1126.445) (-1125.670) [-1124.921] (-1123.448) -- 0:01:14
      26500 -- (-1124.954) (-1127.303) (-1127.204) [-1137.778] * (-1124.830) (-1129.046) (-1126.004) [-1118.865] -- 0:01:13
      27000 -- (-1122.427) [-1120.321] (-1125.072) (-1117.272) * [-1123.806] (-1146.551) (-1130.559) (-1122.279) -- 0:01:12
      27500 -- [-1121.078] (-1124.207) (-1124.368) (-1115.695) * (-1131.368) (-1125.259) [-1120.970] (-1121.464) -- 0:01:10
      28000 -- (-1135.583) (-1124.176) [-1136.782] (-1115.268) * (-1125.570) [-1117.532] (-1125.888) (-1132.971) -- 0:01:09
      28500 -- [-1121.474] (-1125.499) (-1126.722) (-1114.627) * (-1124.118) (-1124.898) (-1123.437) [-1122.368] -- 0:01:08
      29000 -- (-1120.871) (-1119.822) (-1120.790) [-1114.794] * (-1119.721) [-1128.769] (-1126.803) (-1125.702) -- 0:01:06
      29500 -- (-1127.726) (-1127.393) [-1125.405] (-1118.399) * (-1126.169) (-1128.113) [-1125.186] (-1122.119) -- 0:01:05
      30000 -- (-1126.677) (-1125.520) (-1122.263) [-1116.076] * (-1131.601) (-1126.625) (-1123.646) [-1122.690] -- 0:01:04

      Average standard deviation of split frequencies: 0.051972

      30500 -- (-1121.281) (-1131.600) [-1122.253] (-1115.721) * (-1118.424) (-1128.949) [-1121.273] (-1122.030) -- 0:01:03
      31000 -- (-1126.002) (-1127.459) [-1120.372] (-1115.791) * (-1133.156) (-1127.748) [-1118.489] (-1124.486) -- 0:01:02
      31500 -- (-1126.323) (-1119.375) (-1125.771) [-1115.265] * (-1129.137) (-1138.492) (-1131.793) [-1119.690] -- 0:01:01
      32000 -- (-1126.504) (-1118.849) (-1129.030) [-1116.668] * [-1120.487] (-1116.282) (-1129.537) (-1123.214) -- 0:01:00
      32500 -- (-1129.279) (-1115.381) [-1123.516] (-1115.463) * (-1127.809) [-1114.064] (-1129.282) (-1125.862) -- 0:00:59
      33000 -- [-1119.540] (-1118.182) (-1132.026) (-1115.382) * (-1129.036) (-1115.157) [-1114.966] (-1118.477) -- 0:00:58
      33500 -- (-1134.784) (-1116.740) [-1118.626] (-1120.073) * (-1120.151) [-1116.098] (-1124.225) (-1119.070) -- 0:00:57
      34000 -- [-1124.081] (-1116.740) (-1124.232) (-1119.720) * [-1123.819] (-1116.703) (-1126.743) (-1125.626) -- 0:00:56
      34500 -- (-1126.704) (-1114.442) [-1124.871] (-1118.894) * [-1131.418] (-1116.178) (-1124.687) (-1129.013) -- 0:00:55
      35000 -- (-1124.905) (-1115.926) (-1127.598) [-1118.378] * [-1129.731] (-1118.076) (-1132.821) (-1129.791) -- 0:00:55

      Average standard deviation of split frequencies: 0.048450

      35500 -- [-1122.599] (-1115.930) (-1125.209) (-1116.786) * (-1126.412) (-1118.165) [-1126.455] (-1129.174) -- 0:01:21
      36000 -- (-1120.936) (-1116.830) [-1119.843] (-1117.147) * (-1127.850) (-1116.077) (-1117.906) [-1124.874] -- 0:01:20
      36500 -- (-1122.317) (-1119.024) (-1121.224) [-1114.149] * [-1127.225] (-1117.677) (-1133.979) (-1130.518) -- 0:01:19
      37000 -- (-1132.203) (-1118.360) [-1119.721] (-1117.532) * [-1123.861] (-1118.039) (-1127.584) (-1134.130) -- 0:01:18
      37500 -- [-1124.908] (-1115.605) (-1122.697) (-1115.457) * (-1121.692) [-1119.196] (-1121.807) (-1118.399) -- 0:01:17
      38000 -- (-1129.960) (-1115.103) [-1124.286] (-1116.714) * (-1121.242) (-1118.257) [-1123.142] (-1121.559) -- 0:01:15
      38500 -- (-1128.473) [-1115.790] (-1128.397) (-1115.189) * (-1125.946) (-1113.824) [-1121.425] (-1119.774) -- 0:01:14
      39000 -- [-1122.458] (-1115.095) (-1126.367) (-1114.652) * (-1131.061) [-1115.113] (-1128.304) (-1119.342) -- 0:01:13
      39500 -- (-1124.939) [-1117.301] (-1128.029) (-1122.649) * [-1122.760] (-1115.721) (-1116.034) (-1117.713) -- 0:01:12
      40000 -- (-1127.240) (-1115.597) (-1123.935) [-1118.062] * (-1126.496) (-1115.263) (-1115.359) [-1113.792] -- 0:01:12

      Average standard deviation of split frequencies: 0.041860

      40500 -- [-1126.993] (-1116.215) (-1121.692) (-1120.788) * (-1128.444) (-1115.252) [-1116.244] (-1113.981) -- 0:01:11
      41000 -- [-1128.627] (-1120.655) (-1125.424) (-1116.017) * (-1124.024) (-1115.041) [-1114.157] (-1115.623) -- 0:01:10
      41500 -- [-1126.491] (-1116.086) (-1124.256) (-1115.433) * (-1125.967) [-1114.850] (-1116.414) (-1114.125) -- 0:01:09
      42000 -- (-1129.165) (-1114.154) (-1123.540) [-1115.066] * (-1131.839) (-1115.700) (-1116.647) [-1113.773] -- 0:01:08
      42500 -- (-1127.347) (-1115.402) (-1128.701) [-1114.537] * (-1122.148) (-1116.041) (-1117.948) [-1113.510] -- 0:01:07
      43000 -- [-1115.770] (-1117.004) (-1125.833) (-1116.100) * (-1120.269) [-1114.286] (-1117.604) (-1115.960) -- 0:01:06
      43500 -- [-1116.094] (-1117.116) (-1128.199) (-1118.312) * (-1121.713) [-1115.092] (-1114.919) (-1116.109) -- 0:01:05
      44000 -- (-1113.899) (-1117.380) (-1129.119) [-1118.909] * (-1124.688) (-1114.795) (-1115.645) [-1114.056] -- 0:01:05
      44500 -- (-1113.581) (-1117.600) [-1125.830] (-1114.748) * (-1126.462) (-1115.479) (-1113.998) [-1114.028] -- 0:01:04
      45000 -- [-1115.170] (-1117.869) (-1125.971) (-1116.711) * (-1127.578) (-1118.018) (-1113.872) [-1114.580] -- 0:01:03

      Average standard deviation of split frequencies: 0.042944

      45500 -- (-1116.836) (-1119.833) [-1120.647] (-1114.737) * (-1121.717) [-1116.358] (-1116.812) (-1119.068) -- 0:01:02
      46000 -- (-1115.253) (-1119.056) [-1129.759] (-1116.562) * (-1131.196) (-1115.209) [-1118.039] (-1113.777) -- 0:01:02
      46500 -- (-1113.860) (-1116.824) (-1122.738) [-1115.990] * (-1126.282) (-1116.277) [-1114.589] (-1116.039) -- 0:01:01
      47000 -- (-1114.069) [-1117.966] (-1124.815) (-1117.109) * (-1125.456) [-1116.067] (-1115.517) (-1116.757) -- 0:01:00
      47500 -- (-1114.015) [-1116.964] (-1124.039) (-1116.035) * (-1129.642) (-1115.236) [-1119.275] (-1114.598) -- 0:01:00
      48000 -- (-1113.400) (-1114.819) (-1124.420) [-1114.748] * (-1127.527) (-1118.056) (-1114.875) [-1115.978] -- 0:00:59
      48500 -- (-1114.364) (-1113.432) (-1131.617) [-1114.568] * (-1140.244) [-1116.642] (-1116.579) (-1114.051) -- 0:00:58
      49000 -- (-1115.798) (-1114.001) (-1120.986) [-1114.513] * (-1115.875) [-1114.729] (-1117.442) (-1115.530) -- 0:00:58
      49500 -- (-1118.278) (-1114.153) [-1129.872] (-1114.804) * (-1116.495) (-1118.968) [-1114.903] (-1114.936) -- 0:00:57
      50000 -- [-1116.842] (-1114.153) (-1129.748) (-1113.830) * (-1116.405) (-1118.751) [-1114.954] (-1117.566) -- 0:00:57

      Average standard deviation of split frequencies: 0.037216

      50500 -- [-1115.413] (-1116.391) (-1125.507) (-1115.476) * (-1114.920) (-1121.460) (-1116.085) [-1113.741] -- 0:00:56
      51000 -- [-1118.248] (-1117.770) (-1127.865) (-1115.919) * [-1114.979] (-1122.006) (-1115.655) (-1114.315) -- 0:00:55
      51500 -- (-1116.092) [-1118.128] (-1124.993) (-1113.905) * (-1116.345) (-1115.603) [-1118.292] (-1116.717) -- 0:01:13
      52000 -- [-1117.545] (-1116.643) (-1126.140) (-1113.870) * (-1114.375) [-1115.893] (-1117.538) (-1114.248) -- 0:01:12
      52500 -- (-1116.173) (-1116.861) [-1132.220] (-1116.786) * (-1117.248) (-1116.415) [-1116.522] (-1114.347) -- 0:01:12
      53000 -- (-1117.128) (-1116.020) [-1120.452] (-1116.836) * [-1115.656] (-1115.822) (-1117.727) (-1114.347) -- 0:01:11
      53500 -- (-1114.274) [-1116.816] (-1133.177) (-1117.748) * (-1114.300) (-1115.129) (-1118.100) [-1115.158] -- 0:01:10
      54000 -- [-1115.119] (-1119.034) (-1119.428) (-1116.536) * (-1119.058) (-1118.457) (-1114.374) [-1113.944] -- 0:01:10
      54500 -- (-1114.600) (-1120.382) [-1119.083] (-1119.368) * (-1116.104) (-1117.480) [-1114.132] (-1114.155) -- 0:01:09
      55000 -- [-1114.134] (-1120.884) (-1121.810) (-1116.546) * (-1117.037) (-1117.099) [-1115.146] (-1113.710) -- 0:01:08

      Average standard deviation of split frequencies: 0.032830

      55500 -- [-1114.570] (-1118.909) (-1125.431) (-1114.604) * [-1117.064] (-1115.010) (-1114.638) (-1116.664) -- 0:01:08
      56000 -- [-1114.734] (-1123.094) (-1124.494) (-1113.881) * (-1115.632) [-1116.582] (-1114.479) (-1114.597) -- 0:01:07
      56500 -- (-1115.286) [-1115.842] (-1123.113) (-1113.597) * (-1114.381) (-1116.410) [-1113.427] (-1114.542) -- 0:01:06
      57000 -- (-1114.672) [-1113.840] (-1122.796) (-1114.457) * (-1117.397) (-1114.255) (-1117.871) [-1115.460] -- 0:01:06
      57500 -- (-1114.779) (-1114.507) [-1127.850] (-1115.786) * (-1118.981) [-1115.773] (-1115.998) (-1115.294) -- 0:01:05
      58000 -- (-1113.395) [-1114.408] (-1121.724) (-1116.277) * (-1118.909) (-1115.924) (-1115.600) [-1115.221] -- 0:01:04
      58500 -- [-1114.426] (-1116.645) (-1128.376) (-1116.159) * (-1119.133) (-1117.629) (-1116.388) [-1114.040] -- 0:01:04
      59000 -- (-1115.329) (-1119.746) (-1126.179) [-1113.660] * (-1114.616) (-1116.895) [-1115.549] (-1116.836) -- 0:01:03
      59500 -- (-1114.800) (-1117.615) (-1129.224) [-1113.665] * (-1114.404) [-1114.914] (-1114.437) (-1121.324) -- 0:01:03
      60000 -- (-1115.674) (-1118.528) [-1121.329] (-1114.911) * (-1114.316) (-1116.267) [-1117.398] (-1119.041) -- 0:01:02

      Average standard deviation of split frequencies: 0.028628

      60500 -- (-1114.649) [-1118.247] (-1118.966) (-1116.925) * (-1116.025) [-1114.317] (-1114.473) (-1116.844) -- 0:01:02
      61000 -- (-1114.108) (-1114.970) [-1118.822] (-1113.886) * (-1117.242) (-1115.738) (-1114.703) [-1116.855] -- 0:01:01
      61500 -- [-1113.657] (-1115.804) (-1125.471) (-1114.545) * (-1116.399) [-1116.027] (-1113.707) (-1117.324) -- 0:01:01
      62000 -- (-1117.358) (-1116.937) [-1121.857] (-1114.671) * [-1116.936] (-1115.857) (-1117.727) (-1116.021) -- 0:01:00
      62500 -- (-1114.119) (-1116.236) (-1130.770) [-1115.478] * (-1115.386) (-1115.549) [-1114.715] (-1116.399) -- 0:01:00
      63000 -- (-1116.608) (-1116.280) (-1126.129) [-1115.624] * [-1113.532] (-1116.972) (-1115.243) (-1114.239) -- 0:00:59
      63500 -- (-1114.491) (-1116.411) [-1124.026] (-1115.200) * [-1114.184] (-1115.805) (-1117.470) (-1115.548) -- 0:00:58
      64000 -- (-1115.193) (-1117.000) (-1122.634) [-1114.978] * (-1115.661) [-1115.911] (-1117.918) (-1116.548) -- 0:00:58
      64500 -- [-1115.652] (-1116.783) (-1122.527) (-1113.739) * (-1116.864) (-1115.910) [-1115.155] (-1118.641) -- 0:00:58
      65000 -- (-1117.758) [-1121.489] (-1123.943) (-1115.059) * (-1116.763) (-1115.455) (-1116.423) [-1116.861] -- 0:00:57

      Average standard deviation of split frequencies: 0.026690

      65500 -- (-1114.766) (-1118.678) (-1119.233) [-1114.973] * [-1114.684] (-1118.571) (-1119.362) (-1113.811) -- 0:00:57
      66000 -- (-1113.596) (-1118.634) [-1125.820] (-1117.400) * (-1113.654) (-1117.953) [-1116.542] (-1113.469) -- 0:00:56
      66500 -- (-1116.224) [-1116.312] (-1127.430) (-1115.122) * [-1113.654] (-1115.578) (-1118.944) (-1114.032) -- 0:00:56
      67000 -- [-1114.774] (-1114.544) (-1126.143) (-1114.251) * [-1116.238] (-1117.919) (-1117.520) (-1113.933) -- 0:00:55
      67500 -- (-1115.951) [-1113.610] (-1130.991) (-1114.338) * (-1114.802) [-1117.848] (-1118.401) (-1115.044) -- 0:01:09
      68000 -- (-1116.402) [-1113.375] (-1128.721) (-1114.385) * (-1115.556) [-1114.791] (-1116.733) (-1115.042) -- 0:01:08
      68500 -- (-1115.210) (-1113.821) [-1126.372] (-1114.953) * [-1113.447] (-1116.367) (-1116.423) (-1114.679) -- 0:01:07
      69000 -- (-1114.040) (-1117.088) [-1119.724] (-1122.784) * (-1115.737) (-1116.813) (-1116.669) [-1114.077] -- 0:01:07
      69500 -- (-1113.383) [-1117.088] (-1116.984) (-1122.465) * (-1115.544) [-1118.617] (-1115.694) (-1114.457) -- 0:01:06
      70000 -- [-1114.498] (-1114.396) (-1115.679) (-1115.510) * (-1116.052) (-1115.656) (-1114.735) [-1117.775] -- 0:01:06

      Average standard deviation of split frequencies: 0.023348

      70500 -- [-1115.660] (-1114.396) (-1117.961) (-1115.610) * (-1115.444) (-1116.072) (-1114.267) [-1117.273] -- 0:01:05
      71000 -- (-1113.957) [-1114.418] (-1115.563) (-1114.154) * (-1115.599) (-1114.177) (-1115.814) [-1119.044] -- 0:01:05
      71500 -- (-1118.469) (-1115.017) [-1114.788] (-1114.201) * [-1115.821] (-1114.701) (-1115.140) (-1119.138) -- 0:01:04
      72000 -- (-1118.714) (-1115.238) [-1118.528] (-1117.134) * (-1115.854) (-1115.141) [-1114.999] (-1117.193) -- 0:01:04
      72500 -- [-1115.541] (-1114.636) (-1114.797) (-1115.611) * (-1115.525) [-1115.933] (-1114.268) (-1115.422) -- 0:01:03
      73000 -- (-1115.590) (-1114.389) (-1116.114) [-1114.283] * (-1114.841) (-1118.461) [-1113.903] (-1117.749) -- 0:01:03
      73500 -- (-1116.094) [-1113.573] (-1118.835) (-1116.862) * (-1114.609) [-1114.943] (-1116.007) (-1116.365) -- 0:01:03
      74000 -- [-1114.274] (-1119.762) (-1115.770) (-1114.607) * (-1114.599) [-1115.432] (-1114.489) (-1116.444) -- 0:01:02
      74500 -- (-1114.559) (-1114.755) [-1114.097] (-1114.071) * (-1113.798) (-1116.346) [-1114.848] (-1117.347) -- 0:01:02
      75000 -- (-1114.270) [-1113.929] (-1114.097) (-1115.057) * (-1113.907) [-1115.016] (-1117.050) (-1122.667) -- 0:01:01

      Average standard deviation of split frequencies: 0.022950

      75500 -- (-1115.220) (-1115.244) [-1115.124] (-1114.792) * (-1114.417) [-1113.894] (-1116.848) (-1118.376) -- 0:01:01
      76000 -- (-1113.703) (-1114.115) (-1116.265) [-1114.425] * (-1116.493) (-1115.520) (-1116.263) [-1115.130] -- 0:01:00
      76500 -- (-1115.737) (-1117.117) (-1114.514) [-1113.675] * [-1113.901] (-1120.881) (-1117.227) (-1114.908) -- 0:01:00
      77000 -- (-1114.566) [-1118.161] (-1113.640) (-1113.702) * (-1113.910) [-1125.247] (-1119.276) (-1116.748) -- 0:00:59
      77500 -- (-1114.630) (-1118.148) [-1114.156] (-1114.638) * (-1114.029) (-1117.802) (-1115.220) [-1119.626] -- 0:00:59
      78000 -- (-1115.947) (-1119.103) [-1114.732] (-1114.840) * [-1113.890] (-1116.480) (-1116.357) (-1115.447) -- 0:00:59
      78500 -- [-1115.114] (-1117.845) (-1116.123) (-1114.921) * (-1113.686) (-1119.543) (-1115.259) [-1115.380] -- 0:00:58
      79000 -- (-1117.026) (-1119.362) [-1115.325] (-1114.560) * (-1114.124) (-1116.705) (-1115.404) [-1114.639] -- 0:00:58
      79500 -- (-1116.070) (-1114.377) (-1115.412) [-1117.290] * (-1113.623) (-1117.395) (-1115.951) [-1115.855] -- 0:00:57
      80000 -- (-1116.877) (-1113.879) [-1115.509] (-1118.851) * (-1114.359) [-1114.649] (-1114.897) (-1120.369) -- 0:00:57

      Average standard deviation of split frequencies: 0.029219

      80500 -- [-1115.924] (-1116.549) (-1115.738) (-1115.665) * (-1117.164) (-1113.514) (-1117.867) [-1117.767] -- 0:00:57
      81000 -- [-1114.664] (-1113.925) (-1114.825) (-1116.522) * (-1115.538) [-1114.760] (-1118.428) (-1115.159) -- 0:00:56
      81500 -- [-1114.841] (-1117.777) (-1119.022) (-1122.480) * (-1118.615) (-1114.813) (-1116.698) [-1115.012] -- 0:00:56
      82000 -- (-1114.218) (-1114.496) (-1114.793) [-1118.643] * (-1116.966) [-1116.011] (-1118.409) (-1117.394) -- 0:00:55
      82500 -- [-1114.297] (-1113.893) (-1115.734) (-1116.078) * [-1115.513] (-1116.103) (-1114.272) (-1116.756) -- 0:00:55
      83000 -- (-1114.825) (-1113.566) [-1116.804] (-1115.212) * (-1116.375) (-1115.386) (-1114.130) [-1118.516] -- 0:00:55
      83500 -- [-1114.563] (-1114.553) (-1115.160) (-1116.811) * [-1115.211] (-1113.957) (-1114.904) (-1115.777) -- 0:01:05
      84000 -- (-1114.672) (-1114.714) (-1114.651) [-1114.216] * (-1116.871) (-1114.481) [-1113.665] (-1115.155) -- 0:01:05
      84500 -- (-1114.535) [-1115.181] (-1114.639) (-1115.908) * [-1115.267] (-1114.278) (-1113.534) (-1119.596) -- 0:01:05
      85000 -- [-1116.276] (-1114.557) (-1114.566) (-1117.873) * (-1114.973) [-1114.743] (-1114.543) (-1116.861) -- 0:01:04

      Average standard deviation of split frequencies: 0.027929

      85500 -- [-1116.034] (-1116.152) (-1114.800) (-1119.450) * (-1114.471) (-1115.451) [-1113.958] (-1117.829) -- 0:01:04
      86000 -- (-1119.151) [-1116.428] (-1113.886) (-1118.268) * (-1114.440) (-1116.026) [-1114.330] (-1118.247) -- 0:01:03
      86500 -- (-1117.765) [-1116.127] (-1117.421) (-1114.761) * (-1117.082) (-1113.980) (-1114.385) [-1116.734] -- 0:01:03
      87000 -- [-1115.548] (-1116.853) (-1120.260) (-1116.710) * (-1117.259) (-1114.183) (-1113.627) [-1116.176] -- 0:01:02
      87500 -- (-1115.341) [-1113.888] (-1114.982) (-1115.609) * (-1114.424) [-1114.233] (-1115.645) (-1116.932) -- 0:01:02
      88000 -- (-1115.118) (-1113.823) [-1117.780] (-1119.126) * (-1114.868) (-1114.867) [-1116.046] (-1116.483) -- 0:01:02
      88500 -- [-1115.254] (-1114.017) (-1117.734) (-1116.536) * [-1114.627] (-1114.240) (-1116.231) (-1115.203) -- 0:01:01
      89000 -- (-1118.687) (-1113.766) (-1118.190) [-1114.801] * [-1117.597] (-1115.972) (-1119.089) (-1118.170) -- 0:01:01
      89500 -- (-1124.165) (-1119.594) [-1113.781] (-1115.578) * [-1116.187] (-1114.500) (-1115.291) (-1119.320) -- 0:01:01
      90000 -- (-1119.180) [-1118.348] (-1113.751) (-1116.678) * [-1115.929] (-1117.739) (-1113.857) (-1116.059) -- 0:01:00

      Average standard deviation of split frequencies: 0.026492

      90500 -- (-1116.093) (-1117.906) (-1115.120) [-1114.893] * (-1115.885) [-1116.620] (-1115.417) (-1113.954) -- 0:01:00
      91000 -- (-1120.508) [-1117.022] (-1115.313) (-1115.315) * (-1116.690) (-1114.101) (-1113.948) [-1115.722] -- 0:00:59
      91500 -- (-1116.236) (-1122.215) [-1115.585] (-1116.987) * (-1117.361) [-1114.114] (-1114.410) (-1115.798) -- 0:00:59
      92000 -- [-1114.565] (-1116.555) (-1115.028) (-1115.653) * [-1115.245] (-1115.347) (-1113.960) (-1115.688) -- 0:00:59
      92500 -- [-1117.770] (-1118.119) (-1119.323) (-1116.904) * [-1115.030] (-1115.728) (-1116.080) (-1114.930) -- 0:00:58
      93000 -- (-1114.113) (-1115.500) (-1115.442) [-1114.254] * (-1115.083) (-1115.381) [-1115.994] (-1117.956) -- 0:00:58
      93500 -- (-1114.846) (-1120.172) (-1114.611) [-1115.327] * (-1114.249) (-1115.043) (-1116.474) [-1117.453] -- 0:00:58
      94000 -- (-1117.023) (-1120.053) [-1115.970] (-1114.755) * (-1117.331) (-1115.218) (-1115.490) [-1115.234] -- 0:00:57
      94500 -- [-1118.209] (-1115.597) (-1116.297) (-1113.801) * (-1118.982) (-1117.026) [-1117.500] (-1114.664) -- 0:00:57
      95000 -- (-1114.733) (-1116.059) (-1122.481) [-1113.852] * [-1119.220] (-1116.286) (-1116.942) (-1117.454) -- 0:00:57

      Average standard deviation of split frequencies: 0.026025

      95500 -- (-1113.947) (-1115.651) [-1119.079] (-1114.520) * [-1116.284] (-1116.160) (-1116.703) (-1115.041) -- 0:00:56
      96000 -- (-1113.947) (-1117.735) [-1117.564] (-1118.246) * [-1114.654] (-1119.484) (-1117.923) (-1113.987) -- 0:00:56
      96500 -- (-1115.896) [-1114.880] (-1120.765) (-1116.796) * (-1117.524) (-1120.968) (-1118.620) [-1113.621] -- 0:00:56
      97000 -- [-1113.985] (-1116.046) (-1119.023) (-1114.335) * (-1115.879) [-1115.294] (-1121.543) (-1117.180) -- 0:00:55
      97500 -- (-1117.736) (-1116.385) (-1119.565) [-1114.470] * (-1118.124) [-1116.020] (-1115.456) (-1113.956) -- 0:00:55
      98000 -- (-1120.552) (-1114.565) (-1115.158) [-1115.591] * (-1119.042) [-1113.460] (-1114.322) (-1114.021) -- 0:00:55
      98500 -- (-1117.984) (-1117.394) [-1115.011] (-1115.701) * (-1115.391) (-1115.227) [-1114.144] (-1114.776) -- 0:00:54
      99000 -- [-1115.509] (-1114.931) (-1114.690) (-1116.912) * (-1119.176) (-1116.064) (-1113.466) [-1114.873] -- 0:00:54
      99500 -- (-1116.680) (-1116.395) [-1116.731] (-1119.259) * [-1114.419] (-1116.821) (-1113.830) (-1118.775) -- 0:01:03
      100000 -- (-1118.643) (-1115.320) [-1116.431] (-1116.459) * [-1116.637] (-1114.295) (-1114.852) (-1113.714) -- 0:01:02

      Average standard deviation of split frequencies: 0.028097

      100500 -- [-1116.031] (-1118.209) (-1116.069) (-1117.442) * [-1115.779] (-1113.778) (-1119.194) (-1114.001) -- 0:01:02
      101000 -- (-1114.654) (-1116.618) [-1115.361] (-1118.395) * (-1115.774) (-1118.345) [-1114.935] (-1113.501) -- 0:01:02
      101500 -- (-1120.110) (-1116.600) [-1114.233] (-1116.646) * (-1116.925) (-1118.394) [-1116.010] (-1114.266) -- 0:01:01
      102000 -- (-1115.481) (-1115.728) (-1114.827) [-1113.406] * (-1114.802) [-1113.606] (-1114.193) (-1114.638) -- 0:01:01
      102500 -- [-1116.346] (-1117.335) (-1114.129) (-1113.610) * (-1114.009) [-1113.463] (-1117.363) (-1114.784) -- 0:01:01
      103000 -- (-1115.170) (-1115.222) [-1113.949] (-1114.828) * (-1114.633) (-1113.640) (-1115.819) [-1113.940] -- 0:01:00
      103500 -- [-1115.193] (-1121.420) (-1115.151) (-1116.330) * (-1118.641) [-1113.682] (-1115.834) (-1116.301) -- 0:01:00
      104000 -- [-1114.841] (-1115.078) (-1117.423) (-1117.895) * (-1118.656) (-1115.572) (-1115.755) [-1115.817] -- 0:01:00
      104500 -- [-1115.643] (-1115.135) (-1116.601) (-1117.536) * (-1118.243) (-1116.907) (-1116.591) [-1115.266] -- 0:00:59
      105000 -- (-1114.541) (-1114.796) [-1115.464] (-1117.881) * [-1114.366] (-1117.673) (-1114.807) (-1118.145) -- 0:00:59

      Average standard deviation of split frequencies: 0.029311

      105500 -- (-1117.683) [-1114.883] (-1115.503) (-1117.040) * (-1114.917) [-1115.914] (-1117.522) (-1115.087) -- 0:00:59
      106000 -- (-1114.265) (-1117.449) (-1115.977) [-1115.731] * [-1115.222] (-1114.555) (-1117.180) (-1115.800) -- 0:00:59
      106500 -- (-1113.877) [-1116.361] (-1114.850) (-1116.563) * (-1118.210) (-1114.588) (-1119.384) [-1114.213] -- 0:00:58
      107000 -- (-1113.829) [-1114.540] (-1116.025) (-1115.004) * [-1115.966] (-1114.099) (-1115.802) (-1118.783) -- 0:00:58
      107500 -- (-1115.516) (-1114.997) (-1115.765) [-1119.156] * (-1118.372) (-1115.693) (-1117.729) [-1114.564] -- 0:00:58
      108000 -- (-1118.216) (-1114.301) (-1115.500) [-1119.324] * (-1114.423) [-1115.821] (-1116.371) (-1117.176) -- 0:00:57
      108500 -- (-1116.838) [-1114.195] (-1115.656) (-1115.414) * (-1121.557) [-1114.187] (-1114.645) (-1115.317) -- 0:00:57
      109000 -- (-1116.452) [-1113.992] (-1116.094) (-1114.176) * (-1117.242) (-1116.946) [-1114.371] (-1119.007) -- 0:00:57
      109500 -- [-1115.158] (-1114.495) (-1114.019) (-1117.969) * (-1115.766) [-1113.762] (-1114.668) (-1119.532) -- 0:00:56
      110000 -- (-1118.511) [-1114.177] (-1113.696) (-1114.456) * (-1120.014) (-1114.459) (-1114.668) [-1116.571] -- 0:00:56

      Average standard deviation of split frequencies: 0.028697

      110500 -- [-1115.038] (-1117.207) (-1113.644) (-1114.530) * (-1116.417) (-1115.561) (-1115.409) [-1114.653] -- 0:00:56
      111000 -- (-1114.915) [-1119.097] (-1115.791) (-1114.244) * (-1115.275) (-1114.138) (-1119.496) [-1118.120] -- 0:00:56
      111500 -- (-1114.957) [-1117.619] (-1114.845) (-1115.127) * [-1114.628] (-1114.109) (-1121.467) (-1115.717) -- 0:00:55
      112000 -- (-1116.879) (-1120.477) (-1116.403) [-1115.406] * (-1115.195) (-1118.780) (-1115.703) [-1116.605] -- 0:00:55
      112500 -- (-1124.074) [-1121.738] (-1116.751) (-1114.795) * (-1121.624) (-1115.706) [-1116.204] (-1115.402) -- 0:00:55
      113000 -- (-1123.754) (-1114.669) [-1118.135] (-1114.672) * (-1115.156) [-1116.431] (-1116.072) (-1116.565) -- 0:00:54
      113500 -- (-1115.058) (-1114.315) (-1115.481) [-1115.724] * (-1114.376) (-1116.170) [-1117.954] (-1116.362) -- 0:00:54
      114000 -- (-1114.985) (-1116.447) [-1116.332] (-1115.628) * (-1117.086) [-1116.525] (-1116.983) (-1114.892) -- 0:00:54
      114500 -- [-1114.985] (-1116.311) (-1116.999) (-1118.719) * (-1116.984) (-1113.301) (-1115.793) [-1115.867] -- 0:00:54
      115000 -- (-1114.903) [-1115.457] (-1115.712) (-1115.055) * (-1116.490) (-1115.042) (-1116.095) [-1114.037] -- 0:00:53

      Average standard deviation of split frequencies: 0.026705

      115500 -- (-1117.018) (-1114.786) (-1119.217) [-1113.570] * [-1114.339] (-1115.076) (-1116.096) (-1115.906) -- 0:01:01
      116000 -- (-1115.530) [-1115.330] (-1117.433) (-1113.571) * (-1114.832) [-1116.276] (-1114.087) (-1113.743) -- 0:01:00
      116500 -- (-1117.089) (-1115.782) [-1114.907] (-1114.175) * [-1114.012] (-1116.646) (-1113.608) (-1113.738) -- 0:01:00
      117000 -- (-1116.834) (-1113.988) [-1115.444] (-1114.564) * (-1113.979) (-1115.000) [-1114.236] (-1113.545) -- 0:01:00
      117500 -- (-1116.661) [-1115.777] (-1113.463) (-1115.195) * (-1115.956) (-1115.382) [-1114.108] (-1113.881) -- 0:01:00
      118000 -- (-1115.563) (-1114.630) [-1115.403] (-1119.952) * (-1114.805) (-1114.929) [-1114.738] (-1116.342) -- 0:00:59
      118500 -- (-1114.633) [-1114.039] (-1114.769) (-1115.219) * (-1116.700) [-1116.552] (-1116.212) (-1114.030) -- 0:00:59
      119000 -- [-1116.064] (-1117.130) (-1114.671) (-1116.126) * (-1115.207) (-1115.071) [-1114.519] (-1114.275) -- 0:00:59
      119500 -- (-1114.159) (-1116.850) (-1116.083) [-1120.539] * (-1118.561) (-1115.925) (-1115.123) [-1113.535] -- 0:00:58
      120000 -- [-1114.509] (-1120.059) (-1114.502) (-1116.598) * (-1118.214) [-1114.572] (-1115.439) (-1114.682) -- 0:00:58

      Average standard deviation of split frequencies: 0.024417

      120500 -- [-1114.441] (-1121.605) (-1114.502) (-1119.262) * [-1118.169] (-1113.620) (-1114.327) (-1116.431) -- 0:00:58
      121000 -- [-1115.370] (-1116.002) (-1115.887) (-1115.893) * (-1115.984) [-1113.586] (-1119.195) (-1114.309) -- 0:00:58
      121500 -- (-1114.603) (-1116.952) [-1114.775] (-1115.711) * (-1117.124) [-1116.797] (-1115.808) (-1115.051) -- 0:00:57
      122000 -- (-1117.208) [-1116.354] (-1115.551) (-1115.187) * (-1115.135) (-1114.621) [-1114.539] (-1116.506) -- 0:00:57
      122500 -- [-1116.849] (-1116.025) (-1115.352) (-1115.209) * (-1116.065) (-1114.837) (-1116.864) [-1116.311] -- 0:00:57
      123000 -- [-1122.402] (-1119.660) (-1114.664) (-1114.548) * (-1115.858) [-1114.232] (-1115.983) (-1116.725) -- 0:00:57
      123500 -- (-1115.273) [-1113.401] (-1119.967) (-1113.396) * (-1118.670) [-1113.563] (-1117.124) (-1116.642) -- 0:00:56
      124000 -- [-1115.618] (-1113.598) (-1116.454) (-1122.242) * (-1118.831) (-1117.244) [-1113.633] (-1115.501) -- 0:00:56
      124500 -- (-1115.818) [-1114.180] (-1117.312) (-1115.757) * (-1119.918) (-1115.642) [-1114.919] (-1116.255) -- 0:00:56
      125000 -- (-1116.535) [-1114.273] (-1114.683) (-1114.871) * (-1120.122) [-1115.956] (-1117.161) (-1115.800) -- 0:00:56

      Average standard deviation of split frequencies: 0.024229

      125500 -- (-1116.544) [-1116.510] (-1114.305) (-1114.284) * (-1115.503) (-1114.677) [-1114.742] (-1113.599) -- 0:00:55
      126000 -- (-1114.331) (-1114.441) (-1115.225) [-1113.504] * [-1113.767] (-1114.723) (-1120.773) (-1115.752) -- 0:00:55
      126500 -- (-1115.585) [-1116.272] (-1114.492) (-1115.115) * [-1114.064] (-1113.782) (-1118.979) (-1115.215) -- 0:00:55
      127000 -- (-1114.325) (-1118.073) [-1116.364] (-1114.881) * [-1114.154] (-1117.737) (-1121.315) (-1116.228) -- 0:00:54
      127500 -- (-1115.026) (-1117.593) (-1119.134) [-1114.910] * [-1114.042] (-1116.100) (-1121.595) (-1113.798) -- 0:00:54
      128000 -- (-1114.676) [-1115.579] (-1114.250) (-1115.191) * (-1117.145) (-1118.454) [-1115.656] (-1113.961) -- 0:00:54
      128500 -- (-1114.254) [-1116.122] (-1114.233) (-1117.644) * (-1115.605) [-1116.366] (-1116.657) (-1114.200) -- 0:00:54
      129000 -- (-1115.811) (-1115.189) (-1115.920) [-1116.179] * (-1117.559) [-1116.215] (-1114.963) (-1114.131) -- 0:00:54
      129500 -- (-1115.626) [-1117.828] (-1116.798) (-1114.070) * (-1115.499) [-1113.587] (-1114.951) (-1114.590) -- 0:00:53
      130000 -- [-1116.149] (-1115.942) (-1114.119) (-1115.879) * (-1114.752) (-1114.266) [-1114.051] (-1114.487) -- 0:00:53

      Average standard deviation of split frequencies: 0.022909

      130500 -- (-1114.818) (-1115.332) (-1114.533) [-1122.379] * [-1115.848] (-1113.428) (-1117.807) (-1114.911) -- 0:00:53
      131000 -- [-1113.945] (-1114.358) (-1115.103) (-1117.607) * (-1118.025) [-1116.592] (-1115.732) (-1119.230) -- 0:00:53
      131500 -- (-1115.644) [-1114.358] (-1117.204) (-1116.709) * (-1115.095) (-1119.956) (-1114.746) [-1115.993] -- 0:00:52
      132000 -- (-1114.794) [-1115.270] (-1114.437) (-1116.443) * (-1114.616) (-1117.013) (-1113.843) [-1115.404] -- 0:00:59
      132500 -- (-1115.321) (-1115.001) [-1114.264] (-1114.095) * (-1116.325) (-1118.179) [-1116.106] (-1114.826) -- 0:00:58
      133000 -- (-1117.041) (-1115.310) (-1117.751) [-1114.177] * (-1118.800) [-1116.154] (-1114.324) (-1115.599) -- 0:00:58
      133500 -- [-1115.569] (-1114.708) (-1120.914) (-1115.171) * (-1117.275) (-1119.554) (-1114.733) [-1117.922] -- 0:00:58
      134000 -- (-1114.851) (-1118.251) [-1116.276] (-1114.228) * [-1115.661] (-1114.074) (-1114.246) (-1115.452) -- 0:00:58
      134500 -- [-1114.170] (-1117.692) (-1118.859) (-1118.726) * (-1116.337) (-1115.221) (-1114.544) [-1114.309] -- 0:00:57
      135000 -- (-1114.164) [-1117.148] (-1115.229) (-1114.811) * (-1117.013) (-1116.995) [-1117.607] (-1119.725) -- 0:00:57

      Average standard deviation of split frequencies: 0.022184

      135500 -- (-1115.405) [-1115.516] (-1116.083) (-1114.078) * (-1116.618) (-1114.296) [-1116.775] (-1116.326) -- 0:00:57
      136000 -- (-1115.660) (-1115.549) (-1116.470) [-1114.159] * (-1116.996) [-1114.414] (-1116.355) (-1116.396) -- 0:00:57
      136500 -- (-1116.068) [-1117.789] (-1114.347) (-1121.127) * (-1118.352) (-1114.024) [-1113.705] (-1115.868) -- 0:00:56
      137000 -- [-1116.975] (-1113.998) (-1118.985) (-1117.251) * (-1116.384) (-1118.267) [-1113.587] (-1117.916) -- 0:00:56
      137500 -- (-1116.904) [-1117.472] (-1114.937) (-1114.480) * (-1115.116) (-1114.272) (-1117.632) [-1117.035] -- 0:00:56
      138000 -- (-1115.339) (-1118.154) [-1114.648] (-1116.834) * (-1116.076) (-1115.498) [-1114.345] (-1117.540) -- 0:00:56
      138500 -- (-1115.991) [-1115.054] (-1117.205) (-1116.275) * (-1114.398) (-1118.169) (-1115.927) [-1116.265] -- 0:00:55
      139000 -- (-1114.687) (-1115.700) (-1115.599) [-1114.366] * (-1114.200) (-1115.172) [-1116.404] (-1117.760) -- 0:00:55
      139500 -- (-1115.127) [-1115.704] (-1119.279) (-1114.174) * (-1115.305) (-1116.104) (-1118.814) [-1118.888] -- 0:00:55
      140000 -- (-1118.929) [-1115.833] (-1114.871) (-1113.594) * [-1117.224] (-1114.399) (-1115.832) (-1117.563) -- 0:00:55

      Average standard deviation of split frequencies: 0.022753

      140500 -- (-1116.203) [-1115.416] (-1116.574) (-1113.584) * (-1117.612) (-1115.199) [-1117.465] (-1115.406) -- 0:00:55
      141000 -- (-1117.708) (-1113.988) (-1114.084) [-1115.480] * (-1115.443) (-1115.171) (-1123.565) [-1114.357] -- 0:00:54
      141500 -- (-1116.772) (-1116.932) (-1114.194) [-1116.497] * (-1115.890) [-1114.166] (-1114.113) (-1113.905) -- 0:00:54
      142000 -- (-1118.380) (-1117.932) (-1115.331) [-1114.478] * (-1116.178) [-1114.436] (-1113.275) (-1114.746) -- 0:00:54
      142500 -- [-1118.448] (-1115.859) (-1115.281) (-1115.352) * (-1114.456) [-1114.450] (-1113.602) (-1116.686) -- 0:00:54
      143000 -- [-1115.363] (-1113.713) (-1115.081) (-1115.081) * (-1113.483) [-1113.963] (-1116.387) (-1113.568) -- 0:00:53
      143500 -- (-1117.467) [-1113.869] (-1116.180) (-1114.477) * [-1119.841] (-1113.850) (-1119.993) (-1115.446) -- 0:00:53
      144000 -- (-1115.253) [-1114.471] (-1114.530) (-1114.622) * (-1116.046) (-1113.428) [-1115.921] (-1118.320) -- 0:00:53
      144500 -- [-1114.798] (-1114.867) (-1116.296) (-1113.763) * (-1115.807) (-1113.429) (-1118.482) [-1118.707] -- 0:00:53
      145000 -- (-1116.159) [-1118.307] (-1115.339) (-1113.948) * [-1115.047] (-1116.880) (-1116.162) (-1115.650) -- 0:00:53

      Average standard deviation of split frequencies: 0.024139

      145500 -- [-1115.660] (-1118.433) (-1116.476) (-1113.324) * (-1114.831) [-1117.509] (-1116.385) (-1117.013) -- 0:00:52
      146000 -- (-1115.298) [-1113.992] (-1117.317) (-1115.165) * (-1116.812) (-1115.592) (-1114.371) [-1115.308] -- 0:00:52
      146500 -- (-1115.348) (-1114.101) [-1114.051] (-1118.991) * (-1114.650) [-1114.842] (-1118.941) (-1113.591) -- 0:00:52
      147000 -- (-1113.850) (-1114.737) [-1114.457] (-1113.327) * [-1114.377] (-1114.574) (-1115.537) (-1113.591) -- 0:00:52
      147500 -- (-1115.889) [-1114.838] (-1114.897) (-1114.116) * (-1114.435) (-1114.208) [-1114.016] (-1115.954) -- 0:00:52
      148000 -- (-1114.741) [-1114.162] (-1116.761) (-1113.444) * (-1113.817) (-1113.355) (-1114.832) [-1114.977] -- 0:00:51
      148500 -- (-1114.465) (-1116.680) (-1113.889) [-1113.426] * (-1114.438) [-1114.035] (-1114.051) (-1114.683) -- 0:00:57
      149000 -- (-1113.759) [-1115.100] (-1116.672) (-1114.850) * [-1115.648] (-1114.467) (-1115.799) (-1121.426) -- 0:00:57
      149500 -- (-1113.759) [-1113.823] (-1115.090) (-1114.499) * (-1114.308) (-1115.430) [-1115.076] (-1116.919) -- 0:00:56
      150000 -- (-1113.965) (-1116.824) (-1116.023) [-1118.886] * [-1115.538] (-1116.084) (-1116.600) (-1115.384) -- 0:00:56

      Average standard deviation of split frequencies: 0.023242

      150500 -- (-1119.744) (-1114.147) [-1114.177] (-1114.361) * (-1114.176) (-1115.209) [-1117.492] (-1116.409) -- 0:00:56
      151000 -- (-1116.917) [-1113.677] (-1113.874) (-1113.994) * (-1116.354) (-1113.752) (-1115.362) [-1114.142] -- 0:00:56
      151500 -- (-1119.784) (-1114.925) [-1113.685] (-1114.968) * (-1120.284) (-1113.796) (-1116.371) [-1115.893] -- 0:00:56
      152000 -- (-1115.273) [-1115.027] (-1115.171) (-1114.528) * [-1114.378] (-1115.180) (-1114.657) (-1117.950) -- 0:00:55
      152500 -- (-1114.100) [-1115.254] (-1114.113) (-1114.251) * [-1114.373] (-1114.539) (-1119.074) (-1117.112) -- 0:00:55
      153000 -- [-1114.100] (-1119.237) (-1114.808) (-1114.205) * (-1115.108) [-1114.218] (-1114.818) (-1116.286) -- 0:00:55
      153500 -- (-1114.372) (-1118.289) (-1113.885) [-1114.687] * (-1118.802) [-1114.287] (-1114.861) (-1116.725) -- 0:00:55
      154000 -- [-1114.761] (-1116.098) (-1114.656) (-1115.967) * [-1119.213] (-1114.523) (-1114.902) (-1116.650) -- 0:00:54
      154500 -- [-1117.038] (-1116.897) (-1114.510) (-1115.941) * (-1116.921) (-1114.932) [-1114.037] (-1113.939) -- 0:00:54
      155000 -- (-1116.326) [-1118.759] (-1115.132) (-1115.593) * (-1115.184) (-1114.413) (-1116.462) [-1116.916] -- 0:00:54

      Average standard deviation of split frequencies: 0.021153

      155500 -- (-1115.951) (-1116.157) (-1116.528) [-1114.188] * (-1114.194) (-1116.417) (-1114.319) [-1117.835] -- 0:00:54
      156000 -- (-1116.458) (-1114.460) [-1115.974] (-1114.142) * (-1114.282) (-1115.892) [-1114.911] (-1116.728) -- 0:00:54
      156500 -- (-1116.782) (-1115.039) [-1114.154] (-1115.537) * (-1115.256) [-1115.193] (-1114.642) (-1117.631) -- 0:00:53
      157000 -- [-1116.391] (-1117.411) (-1114.692) (-1115.676) * (-1117.808) [-1114.300] (-1119.528) (-1118.040) -- 0:00:53
      157500 -- [-1117.457] (-1116.345) (-1115.565) (-1114.756) * (-1116.850) (-1115.757) [-1117.553] (-1114.072) -- 0:00:53
      158000 -- [-1116.611] (-1115.306) (-1115.435) (-1117.979) * (-1114.628) (-1114.638) [-1116.438] (-1114.908) -- 0:00:53
      158500 -- (-1114.399) [-1119.258] (-1114.500) (-1114.256) * (-1114.097) (-1116.429) [-1117.247] (-1113.302) -- 0:00:53
      159000 -- (-1114.171) (-1114.573) [-1114.501] (-1116.582) * (-1117.593) (-1118.361) (-1114.571) [-1113.988] -- 0:00:52
      159500 -- (-1116.179) [-1119.408] (-1117.778) (-1116.069) * [-1113.782] (-1116.981) (-1115.038) (-1113.883) -- 0:00:52
      160000 -- (-1114.839) (-1119.137) [-1114.206] (-1123.742) * (-1116.778) (-1117.374) (-1117.521) [-1115.884] -- 0:00:52

      Average standard deviation of split frequencies: 0.020538

      160500 -- (-1116.155) [-1114.567] (-1115.664) (-1120.626) * (-1115.332) [-1115.617] (-1117.004) (-1119.576) -- 0:00:52
      161000 -- (-1118.470) (-1116.450) (-1116.473) [-1114.227] * (-1116.091) [-1114.438] (-1117.282) (-1119.046) -- 0:00:52
      161500 -- (-1116.250) (-1116.313) (-1114.027) [-1114.318] * (-1116.221) [-1114.425] (-1116.287) (-1115.798) -- 0:00:51
      162000 -- [-1121.550] (-1115.652) (-1114.552) (-1115.041) * (-1114.585) (-1115.080) (-1114.749) [-1116.723] -- 0:00:51
      162500 -- (-1115.138) [-1114.532] (-1114.723) (-1113.966) * [-1114.253] (-1114.940) (-1115.422) (-1114.543) -- 0:00:51
      163000 -- (-1114.401) (-1114.156) (-1114.386) [-1114.232] * [-1114.950] (-1115.150) (-1114.448) (-1117.632) -- 0:00:51
      163500 -- [-1115.871] (-1113.795) (-1114.383) (-1114.390) * (-1117.125) (-1116.355) (-1115.693) [-1115.283] -- 0:00:51
      164000 -- (-1114.612) (-1115.849) [-1114.596] (-1115.181) * (-1114.427) (-1115.786) [-1113.698] (-1115.071) -- 0:00:50
      164500 -- (-1115.709) (-1114.124) (-1118.855) [-1114.974] * (-1123.038) (-1113.873) (-1115.990) [-1114.811] -- 0:00:50
      165000 -- (-1114.462) (-1114.814) (-1115.556) [-1114.775] * (-1118.838) [-1113.966] (-1118.080) (-1115.710) -- 0:00:55

      Average standard deviation of split frequencies: 0.020020

      165500 -- [-1113.739] (-1118.424) (-1115.556) (-1113.967) * (-1114.176) (-1114.968) [-1117.885] (-1116.365) -- 0:00:55
      166000 -- (-1115.730) (-1121.923) [-1114.097] (-1115.401) * (-1115.137) (-1116.390) (-1115.456) [-1118.175] -- 0:00:55
      166500 -- (-1114.414) (-1118.929) (-1115.975) [-1116.180] * [-1114.004] (-1114.880) (-1116.656) (-1115.417) -- 0:00:55
      167000 -- (-1123.282) (-1120.547) [-1117.529] (-1117.315) * [-1114.568] (-1115.079) (-1121.112) (-1114.184) -- 0:00:54
      167500 -- [-1114.432] (-1117.953) (-1118.321) (-1116.136) * [-1114.201] (-1116.114) (-1118.358) (-1119.538) -- 0:00:54
      168000 -- (-1113.525) (-1116.495) [-1118.533] (-1115.914) * (-1113.783) [-1113.716] (-1115.675) (-1114.529) -- 0:00:54
      168500 -- (-1118.653) [-1115.660] (-1117.865) (-1113.725) * [-1113.626] (-1114.426) (-1115.477) (-1115.623) -- 0:00:54
      169000 -- (-1116.176) (-1114.546) (-1120.633) [-1114.158] * (-1115.100) (-1119.197) [-1114.633] (-1118.851) -- 0:00:54
      169500 -- (-1116.959) (-1116.831) [-1117.498] (-1113.766) * (-1117.491) (-1118.645) [-1114.793] (-1119.394) -- 0:00:53
      170000 -- (-1116.180) (-1120.204) (-1116.615) [-1115.401] * [-1113.800] (-1121.104) (-1114.355) (-1114.904) -- 0:00:53

      Average standard deviation of split frequencies: 0.018463

      170500 -- (-1117.666) [-1117.000] (-1117.688) (-1113.954) * (-1115.430) (-1116.435) [-1114.409] (-1115.129) -- 0:00:53
      171000 -- (-1116.135) [-1116.847] (-1116.822) (-1114.932) * (-1115.553) (-1116.646) [-1114.033] (-1115.815) -- 0:00:53
      171500 -- [-1116.444] (-1115.455) (-1118.898) (-1113.868) * (-1118.643) [-1116.480] (-1116.666) (-1114.753) -- 0:00:53
      172000 -- (-1116.876) (-1116.746) (-1118.686) [-1117.115] * [-1116.383] (-1114.663) (-1116.921) (-1115.250) -- 0:00:52
      172500 -- (-1115.983) (-1115.004) (-1119.185) [-1113.873] * [-1116.711] (-1113.881) (-1116.639) (-1117.695) -- 0:00:52
      173000 -- [-1114.783] (-1122.895) (-1117.797) (-1114.716) * (-1117.119) [-1115.949] (-1117.585) (-1117.026) -- 0:00:52
      173500 -- (-1114.976) (-1116.233) [-1116.282] (-1119.928) * [-1116.390] (-1118.026) (-1120.169) (-1117.336) -- 0:00:52
      174000 -- (-1114.370) (-1114.392) [-1113.894] (-1115.104) * [-1114.745] (-1115.046) (-1118.869) (-1118.512) -- 0:00:52
      174500 -- [-1115.593] (-1117.173) (-1118.210) (-1117.130) * [-1115.771] (-1114.972) (-1115.740) (-1116.179) -- 0:00:52
      175000 -- (-1114.621) (-1114.680) (-1114.522) [-1114.192] * (-1115.150) (-1114.963) (-1114.185) [-1116.805] -- 0:00:51

      Average standard deviation of split frequencies: 0.017057

      175500 -- (-1114.052) [-1114.873] (-1113.822) (-1114.940) * [-1116.357] (-1117.109) (-1113.487) (-1115.254) -- 0:00:51
      176000 -- [-1113.382] (-1114.417) (-1116.313) (-1115.519) * (-1117.729) [-1115.598] (-1114.127) (-1115.670) -- 0:00:51
      176500 -- (-1115.688) (-1114.296) [-1113.949] (-1114.168) * [-1114.777] (-1115.129) (-1115.145) (-1122.011) -- 0:00:51
      177000 -- (-1115.596) [-1115.239] (-1115.295) (-1114.841) * [-1115.683] (-1114.727) (-1116.428) (-1117.031) -- 0:00:51
      177500 -- [-1115.009] (-1115.555) (-1116.414) (-1116.223) * [-1115.401] (-1119.098) (-1115.626) (-1114.933) -- 0:00:50
      178000 -- (-1116.806) [-1115.146] (-1116.665) (-1115.469) * (-1114.990) [-1117.502] (-1114.673) (-1114.729) -- 0:00:50
      178500 -- [-1116.387] (-1116.578) (-1114.930) (-1115.509) * (-1116.697) (-1118.159) (-1114.856) [-1115.296] -- 0:00:50
      179000 -- (-1115.396) [-1115.566] (-1114.506) (-1115.747) * (-1118.491) (-1116.713) [-1115.764] (-1115.846) -- 0:00:50
      179500 -- (-1117.721) [-1115.603] (-1114.506) (-1115.713) * (-1118.456) [-1117.063] (-1114.853) (-1118.456) -- 0:00:50
      180000 -- (-1116.766) [-1113.863] (-1114.082) (-1116.344) * (-1118.518) [-1115.766] (-1115.204) (-1115.525) -- 0:00:50

      Average standard deviation of split frequencies: 0.018127

      180500 -- [-1115.772] (-1113.967) (-1115.236) (-1117.466) * (-1117.695) [-1116.017] (-1114.590) (-1119.016) -- 0:00:49
      181000 -- [-1114.478] (-1114.729) (-1117.548) (-1116.363) * (-1114.007) [-1114.348] (-1115.121) (-1114.743) -- 0:00:54
      181500 -- (-1113.681) (-1114.801) [-1116.726] (-1119.603) * (-1114.114) (-1114.570) [-1113.715] (-1114.261) -- 0:00:54
      182000 -- [-1113.980] (-1116.732) (-1114.763) (-1118.396) * (-1113.332) (-1113.512) (-1114.562) [-1113.974] -- 0:00:53
      182500 -- (-1120.493) (-1114.554) (-1115.573) [-1113.735] * (-1113.719) [-1113.578] (-1113.694) (-1115.791) -- 0:00:53
      183000 -- [-1116.369] (-1117.488) (-1116.812) (-1114.118) * [-1114.968] (-1114.736) (-1115.869) (-1115.014) -- 0:00:53
      183500 -- (-1115.815) [-1115.005] (-1119.664) (-1115.424) * (-1113.910) (-1114.448) [-1116.202] (-1116.242) -- 0:00:53
      184000 -- (-1116.627) [-1114.778] (-1115.113) (-1119.264) * (-1116.837) (-1115.427) (-1116.121) [-1113.883] -- 0:00:53
      184500 -- (-1117.006) (-1114.464) [-1113.943] (-1119.684) * (-1114.269) (-1115.144) [-1115.592] (-1114.704) -- 0:00:53
      185000 -- (-1120.344) (-1114.614) [-1114.777] (-1120.751) * (-1115.020) [-1115.361] (-1116.045) (-1114.577) -- 0:00:52

      Average standard deviation of split frequencies: 0.015587

      185500 -- (-1119.954) (-1115.478) (-1113.497) [-1117.573] * (-1114.481) (-1114.120) [-1114.769] (-1114.558) -- 0:00:52
      186000 -- [-1114.892] (-1117.011) (-1117.007) (-1116.222) * (-1116.321) (-1116.131) [-1114.400] (-1119.024) -- 0:00:52
      186500 -- [-1117.984] (-1117.280) (-1116.691) (-1117.258) * (-1115.263) (-1120.309) [-1115.514] (-1114.134) -- 0:00:52
      187000 -- (-1115.125) [-1117.407] (-1114.893) (-1116.186) * (-1114.763) [-1116.642] (-1115.655) (-1114.931) -- 0:00:52
      187500 -- [-1114.549] (-1115.660) (-1119.889) (-1117.046) * [-1114.756] (-1116.705) (-1116.047) (-1114.460) -- 0:00:52
      188000 -- (-1114.323) [-1114.966] (-1117.088) (-1113.616) * (-1117.648) [-1114.285] (-1115.128) (-1114.051) -- 0:00:51
      188500 -- (-1114.942) (-1115.256) (-1115.608) [-1115.444] * (-1113.558) (-1115.363) [-1115.247] (-1113.534) -- 0:00:51
      189000 -- (-1114.943) (-1117.769) (-1117.999) [-1114.223] * (-1124.408) [-1113.713] (-1115.192) (-1114.330) -- 0:00:51
      189500 -- [-1115.507] (-1114.023) (-1115.793) (-1114.679) * (-1114.456) [-1113.917] (-1116.486) (-1115.242) -- 0:00:51
      190000 -- (-1114.564) [-1115.064] (-1114.183) (-1116.562) * [-1115.310] (-1114.226) (-1114.972) (-1115.912) -- 0:00:51

      Average standard deviation of split frequencies: 0.015823

      190500 -- [-1117.931] (-1115.622) (-1115.200) (-1116.420) * [-1115.467] (-1118.482) (-1114.685) (-1118.958) -- 0:00:50
      191000 -- (-1113.872) [-1117.162] (-1114.699) (-1114.034) * (-1116.110) (-1115.483) (-1115.708) [-1117.328] -- 0:00:50
      191500 -- (-1114.347) (-1119.706) [-1114.519] (-1115.029) * (-1117.418) (-1116.056) (-1115.863) [-1115.036] -- 0:00:50
      192000 -- (-1115.628) (-1119.436) (-1114.663) [-1114.210] * (-1116.359) (-1124.358) [-1114.588] (-1119.227) -- 0:00:50
      192500 -- (-1116.789) (-1116.848) [-1116.821] (-1114.512) * (-1116.956) (-1116.326) [-1114.691] (-1113.950) -- 0:00:50
      193000 -- (-1115.291) (-1115.609) [-1116.189] (-1114.963) * (-1116.152) [-1116.463] (-1114.412) (-1115.847) -- 0:00:50
      193500 -- (-1114.135) (-1117.773) [-1114.878] (-1114.357) * (-1117.255) (-1114.973) (-1119.046) [-1116.831] -- 0:00:50
      194000 -- (-1116.773) (-1117.718) (-1116.087) [-1115.104] * (-1115.301) (-1115.574) (-1115.302) [-1113.579] -- 0:00:49
      194500 -- [-1115.242] (-1115.762) (-1118.203) (-1114.167) * (-1119.968) [-1116.134] (-1119.890) (-1113.340) -- 0:00:49
      195000 -- (-1119.357) (-1114.378) [-1113.640] (-1113.972) * (-1116.258) (-1115.482) [-1115.213] (-1115.252) -- 0:00:49

      Average standard deviation of split frequencies: 0.017409

      195500 -- (-1116.750) (-1115.571) [-1115.579] (-1114.391) * (-1116.934) [-1116.080] (-1116.105) (-1113.665) -- 0:00:49
      196000 -- (-1117.227) (-1118.852) (-1116.047) [-1114.956] * (-1116.142) (-1114.448) (-1113.738) [-1113.552] -- 0:00:49
      196500 -- [-1116.742] (-1115.414) (-1116.398) (-1116.227) * (-1117.638) (-1114.589) [-1114.726] (-1115.906) -- 0:00:49
      197000 -- [-1115.472] (-1115.682) (-1117.901) (-1114.062) * (-1120.476) [-1113.966] (-1114.051) (-1114.043) -- 0:00:48
      197500 -- (-1116.775) [-1115.638] (-1113.923) (-1113.562) * (-1118.696) [-1117.671] (-1118.524) (-1113.741) -- 0:00:48
      198000 -- (-1115.507) [-1116.150] (-1115.250) (-1114.395) * [-1116.058] (-1114.977) (-1116.588) (-1114.684) -- 0:00:52
      198500 -- (-1113.549) (-1116.263) (-1116.976) [-1114.617] * (-1116.667) (-1115.807) (-1114.916) [-1114.613] -- 0:00:52
      199000 -- (-1113.538) (-1116.616) [-1114.339] (-1114.291) * (-1113.872) [-1113.947] (-1113.841) (-1113.410) -- 0:00:52
      199500 -- [-1114.802] (-1116.120) (-1114.293) (-1114.464) * (-1116.381) (-1113.960) [-1119.495] (-1113.410) -- 0:00:52
      200000 -- [-1116.754] (-1116.222) (-1116.178) (-1120.326) * (-1115.895) [-1114.560] (-1120.648) (-1117.651) -- 0:00:51

      Average standard deviation of split frequencies: 0.018346

      200500 -- (-1119.720) (-1116.859) [-1114.565] (-1119.817) * [-1113.716] (-1113.619) (-1114.485) (-1121.534) -- 0:00:51
      201000 -- (-1119.088) (-1116.647) [-1114.009] (-1116.340) * (-1113.580) [-1115.697] (-1113.283) (-1117.619) -- 0:00:51
      201500 -- (-1115.603) (-1116.041) (-1115.261) [-1115.980] * (-1118.260) (-1113.899) (-1113.849) [-1114.027] -- 0:00:51
      202000 -- (-1119.381) (-1118.831) [-1116.530] (-1116.517) * [-1113.511] (-1118.440) (-1113.800) (-1115.903) -- 0:00:51
      202500 -- (-1117.995) (-1114.658) (-1118.515) [-1114.359] * (-1115.373) (-1115.203) [-1113.800] (-1114.581) -- 0:00:51
      203000 -- (-1116.466) (-1115.187) [-1114.853] (-1116.031) * (-1115.746) (-1113.885) [-1114.251] (-1114.452) -- 0:00:51
      203500 -- (-1114.886) (-1114.365) (-1116.432) [-1121.341] * (-1118.465) [-1115.266] (-1114.621) (-1114.840) -- 0:00:50
      204000 -- [-1116.024] (-1114.742) (-1115.013) (-1115.493) * (-1114.288) [-1115.031] (-1114.372) (-1116.143) -- 0:00:50
      204500 -- (-1115.085) (-1114.766) [-1115.665] (-1116.346) * (-1114.350) (-1114.323) [-1114.458] (-1117.425) -- 0:00:50
      205000 -- [-1114.985] (-1116.808) (-1118.636) (-1120.127) * (-1120.663) (-1119.026) (-1113.847) [-1117.075] -- 0:00:50

      Average standard deviation of split frequencies: 0.019833

      205500 -- (-1120.539) (-1114.735) [-1116.547] (-1117.485) * (-1113.989) (-1121.700) (-1115.439) [-1115.014] -- 0:00:50
      206000 -- (-1120.326) (-1115.546) (-1116.649) [-1116.729] * (-1116.613) (-1118.785) (-1113.771) [-1116.753] -- 0:00:50
      206500 -- (-1118.876) [-1116.097] (-1119.075) (-1115.246) * (-1116.748) [-1119.216] (-1113.843) (-1114.366) -- 0:00:49
      207000 -- (-1117.354) (-1113.903) (-1115.032) [-1114.616] * (-1118.319) (-1119.643) (-1114.816) [-1116.146] -- 0:00:49
      207500 -- (-1123.251) (-1117.380) [-1113.863] (-1121.025) * [-1115.208] (-1120.256) (-1113.260) (-1116.416) -- 0:00:49
      208000 -- (-1116.809) [-1114.780] (-1115.090) (-1116.973) * (-1118.348) (-1120.606) [-1113.632] (-1115.023) -- 0:00:49
      208500 -- (-1119.792) [-1115.702] (-1114.654) (-1115.273) * [-1115.321] (-1118.242) (-1116.663) (-1115.362) -- 0:00:49
      209000 -- (-1116.628) (-1113.298) (-1116.091) [-1115.803] * (-1114.262) [-1117.276] (-1120.998) (-1115.355) -- 0:00:49
      209500 -- (-1116.384) (-1115.041) [-1115.680] (-1116.075) * [-1118.517] (-1117.627) (-1117.986) (-1114.168) -- 0:00:49
      210000 -- (-1117.007) (-1115.441) (-1115.657) [-1119.737] * [-1115.787] (-1117.265) (-1114.726) (-1113.763) -- 0:00:48

      Average standard deviation of split frequencies: 0.017901

      210500 -- (-1114.798) (-1115.122) [-1113.575] (-1116.087) * (-1115.050) (-1114.423) (-1114.525) [-1115.365] -- 0:00:48
      211000 -- (-1115.757) (-1114.419) [-1113.934] (-1117.039) * [-1116.279] (-1115.017) (-1115.171) (-1114.460) -- 0:00:48
      211500 -- [-1115.687] (-1115.605) (-1113.960) (-1116.253) * [-1115.543] (-1116.681) (-1114.425) (-1116.446) -- 0:00:48
      212000 -- (-1113.989) (-1118.406) [-1115.878] (-1114.786) * [-1120.188] (-1114.072) (-1113.488) (-1116.139) -- 0:00:48
      212500 -- (-1115.044) (-1114.418) (-1118.386) [-1114.852] * (-1116.287) [-1115.367] (-1115.609) (-1122.268) -- 0:00:48
      213000 -- (-1116.160) (-1114.086) (-1116.077) [-1116.303] * (-1118.643) (-1114.114) (-1114.660) [-1119.903] -- 0:00:48
      213500 -- (-1115.449) (-1114.309) [-1115.206] (-1114.780) * (-1118.196) (-1114.226) [-1114.442] (-1114.770) -- 0:00:47
      214000 -- (-1115.413) (-1117.512) (-1115.506) [-1115.444] * (-1118.710) (-1114.514) [-1114.928] (-1118.319) -- 0:00:47
      214500 -- (-1114.446) [-1115.904] (-1118.190) (-1117.501) * (-1119.261) [-1115.945] (-1116.605) (-1119.016) -- 0:00:47
      215000 -- [-1116.792] (-1116.231) (-1117.008) (-1114.502) * (-1115.696) (-1117.986) (-1116.903) [-1113.576] -- 0:00:51

      Average standard deviation of split frequencies: 0.016732

      215500 -- (-1114.977) [-1115.032] (-1115.796) (-1113.857) * [-1116.165] (-1116.792) (-1116.947) (-1116.891) -- 0:00:50
      216000 -- [-1115.090] (-1116.266) (-1115.977) (-1114.467) * [-1118.654] (-1116.353) (-1119.243) (-1115.392) -- 0:00:50
      216500 -- [-1115.589] (-1115.331) (-1117.890) (-1114.575) * (-1117.690) (-1118.028) (-1120.470) [-1116.369] -- 0:00:50
      217000 -- (-1113.372) [-1114.071] (-1117.687) (-1113.915) * (-1119.128) (-1118.680) (-1118.996) [-1116.887] -- 0:00:50
      217500 -- (-1116.995) [-1115.895] (-1115.956) (-1119.718) * (-1116.975) (-1118.305) (-1118.937) [-1116.652] -- 0:00:50
      218000 -- (-1117.224) (-1121.892) (-1115.936) [-1114.704] * [-1114.722] (-1114.746) (-1117.684) (-1121.015) -- 0:00:50
      218500 -- (-1118.623) (-1113.859) [-1117.851] (-1118.643) * (-1115.261) [-1117.480] (-1119.124) (-1116.995) -- 0:00:50
      219000 -- (-1114.764) [-1113.834] (-1114.647) (-1114.760) * (-1119.613) [-1114.632] (-1117.024) (-1116.048) -- 0:00:49
      219500 -- [-1117.295] (-1113.882) (-1117.001) (-1114.143) * (-1115.778) [-1114.573] (-1115.345) (-1113.851) -- 0:00:49
      220000 -- (-1115.537) [-1116.172] (-1115.691) (-1114.222) * (-1114.699) [-1115.575] (-1117.688) (-1113.952) -- 0:00:49

      Average standard deviation of split frequencies: 0.014633

      220500 -- (-1114.098) [-1117.141] (-1117.235) (-1114.137) * [-1117.000] (-1114.248) (-1114.846) (-1116.452) -- 0:00:49
      221000 -- (-1115.366) [-1116.070] (-1115.363) (-1116.798) * (-1115.011) (-1114.947) [-1113.823] (-1113.740) -- 0:00:49
      221500 -- (-1114.404) (-1115.182) (-1114.807) [-1114.776] * [-1113.593] (-1120.369) (-1115.412) (-1114.539) -- 0:00:49
      222000 -- (-1116.422) (-1115.288) [-1113.490] (-1116.524) * (-1114.359) (-1114.696) (-1115.406) [-1114.977] -- 0:00:49
      222500 -- (-1115.120) (-1118.403) (-1117.167) [-1115.110] * (-1113.464) [-1114.202] (-1114.419) (-1113.761) -- 0:00:48
      223000 -- [-1116.176] (-1113.753) (-1116.315) (-1113.651) * (-1116.083) (-1115.795) (-1114.692) [-1115.234] -- 0:00:48
      223500 -- (-1115.811) (-1117.643) [-1113.378] (-1114.802) * [-1114.248] (-1115.171) (-1113.907) (-1117.150) -- 0:00:48
      224000 -- (-1114.987) (-1115.050) (-1114.596) [-1118.747] * (-1113.690) (-1115.565) [-1113.801] (-1115.571) -- 0:00:48
      224500 -- (-1114.597) (-1113.879) [-1115.473] (-1118.232) * [-1116.246] (-1117.552) (-1113.934) (-1116.662) -- 0:00:48
      225000 -- (-1116.272) (-1115.921) (-1117.059) [-1118.551] * [-1114.722] (-1116.929) (-1115.441) (-1119.320) -- 0:00:48

      Average standard deviation of split frequencies: 0.014601

      225500 -- [-1116.748] (-1119.077) (-1114.837) (-1114.816) * (-1114.384) (-1115.394) [-1116.333] (-1117.269) -- 0:00:48
      226000 -- (-1116.101) (-1117.767) [-1115.075] (-1114.671) * (-1114.818) (-1118.608) [-1115.434] (-1117.693) -- 0:00:47
      226500 -- (-1116.345) (-1120.727) [-1115.953] (-1114.175) * (-1123.236) (-1114.587) [-1115.827] (-1113.972) -- 0:00:47
      227000 -- (-1114.100) (-1115.444) (-1115.638) [-1115.421] * (-1115.688) (-1115.527) [-1116.568] (-1115.448) -- 0:00:47
      227500 -- (-1117.000) (-1115.200) (-1115.229) [-1115.191] * [-1115.111] (-1113.857) (-1116.635) (-1115.590) -- 0:00:47
      228000 -- (-1115.741) (-1121.631) (-1114.266) [-1115.882] * (-1114.791) [-1113.628] (-1115.426) (-1115.438) -- 0:00:47
      228500 -- (-1116.497) (-1117.651) (-1114.969) [-1116.541] * (-1114.555) (-1118.110) (-1114.269) [-1113.541] -- 0:00:47
      229000 -- [-1114.205] (-1114.529) (-1114.645) (-1118.345) * (-1116.236) (-1114.776) [-1114.556] (-1114.690) -- 0:00:47
      229500 -- (-1116.477) (-1115.016) [-1114.760] (-1116.789) * (-1114.643) (-1116.297) (-1113.772) [-1113.314] -- 0:00:47
      230000 -- [-1117.173] (-1113.524) (-1114.097) (-1115.037) * (-1115.037) (-1113.551) [-1115.576] (-1113.217) -- 0:00:46

      Average standard deviation of split frequencies: 0.016349

      230500 -- [-1117.284] (-1117.388) (-1114.185) (-1117.162) * (-1113.627) (-1114.354) [-1113.714] (-1113.217) -- 0:00:46
      231000 -- (-1115.113) (-1117.756) [-1113.648] (-1114.874) * (-1115.762) [-1114.561] (-1115.058) (-1115.560) -- 0:00:49
      231500 -- [-1114.996] (-1114.998) (-1114.860) (-1115.548) * (-1120.115) [-1116.134] (-1117.059) (-1115.449) -- 0:00:49
      232000 -- [-1114.572] (-1115.324) (-1114.762) (-1119.906) * (-1119.687) [-1115.713] (-1116.842) (-1113.819) -- 0:00:49
      232500 -- (-1114.834) (-1116.286) (-1115.036) [-1115.922] * (-1115.934) [-1115.309] (-1114.994) (-1114.525) -- 0:00:49
      233000 -- (-1113.366) (-1117.527) [-1116.465] (-1121.597) * [-1114.869] (-1116.829) (-1113.979) (-1116.665) -- 0:00:49
      233500 -- (-1117.963) [-1116.853] (-1115.019) (-1121.301) * (-1117.002) [-1113.762] (-1114.774) (-1118.836) -- 0:00:49
      234000 -- (-1116.603) [-1115.801] (-1114.161) (-1117.077) * (-1117.650) (-1115.349) [-1114.494] (-1119.330) -- 0:00:49
      234500 -- (-1115.534) [-1119.028] (-1116.515) (-1114.567) * (-1119.658) (-1117.385) (-1116.657) [-1115.476] -- 0:00:48
      235000 -- (-1117.198) [-1115.173] (-1116.854) (-1113.960) * (-1118.654) (-1116.666) [-1115.351] (-1116.376) -- 0:00:48

      Average standard deviation of split frequencies: 0.016080

      235500 -- [-1115.830] (-1114.657) (-1116.525) (-1114.088) * (-1117.299) (-1120.454) [-1118.357] (-1115.767) -- 0:00:48
      236000 -- [-1113.656] (-1114.875) (-1116.410) (-1113.521) * (-1115.730) [-1114.136] (-1114.665) (-1115.238) -- 0:00:48
      236500 -- (-1115.511) (-1115.310) (-1116.028) [-1114.835] * [-1113.827] (-1114.984) (-1113.693) (-1116.483) -- 0:00:48
      237000 -- (-1119.765) [-1117.462] (-1117.135) (-1117.181) * (-1114.793) [-1114.389] (-1115.395) (-1115.769) -- 0:00:48
      237500 -- (-1119.260) (-1117.398) [-1114.034] (-1117.011) * (-1115.725) [-1115.481] (-1123.980) (-1117.726) -- 0:00:48
      238000 -- (-1118.831) (-1117.758) [-1113.249] (-1114.817) * (-1114.928) [-1116.834] (-1115.547) (-1116.601) -- 0:00:48
      238500 -- (-1120.318) (-1117.236) [-1113.334] (-1115.552) * (-1114.394) [-1116.061] (-1120.197) (-1116.581) -- 0:00:47
      239000 -- (-1122.158) (-1115.545) (-1115.511) [-1115.327] * [-1116.013] (-1116.360) (-1120.721) (-1113.985) -- 0:00:47
      239500 -- (-1115.091) [-1115.246] (-1113.805) (-1114.458) * (-1120.269) [-1123.684] (-1117.655) (-1115.976) -- 0:00:47
      240000 -- [-1115.496] (-1115.186) (-1114.445) (-1115.101) * (-1117.398) (-1115.459) [-1116.189] (-1121.494) -- 0:00:47

      Average standard deviation of split frequencies: 0.015979

      240500 -- (-1116.769) [-1117.184] (-1115.171) (-1115.850) * (-1117.613) (-1116.903) (-1116.955) [-1119.219] -- 0:00:47
      241000 -- (-1113.567) [-1114.598] (-1114.364) (-1115.686) * (-1113.941) (-1114.058) [-1114.747] (-1115.448) -- 0:00:47
      241500 -- (-1113.567) (-1116.070) [-1116.160] (-1115.823) * (-1116.454) (-1114.983) (-1116.357) [-1115.293] -- 0:00:47
      242000 -- (-1113.467) (-1116.880) [-1115.976] (-1115.758) * [-1114.642] (-1114.445) (-1116.280) (-1115.850) -- 0:00:46
      242500 -- [-1116.537] (-1114.206) (-1119.247) (-1115.358) * (-1113.528) (-1114.041) [-1116.362] (-1113.976) -- 0:00:46
      243000 -- [-1114.527] (-1115.883) (-1114.675) (-1113.212) * (-1117.671) (-1113.371) [-1116.358] (-1114.346) -- 0:00:46
      243500 -- [-1114.019] (-1116.198) (-1116.509) (-1115.454) * [-1119.247] (-1115.186) (-1115.870) (-1120.813) -- 0:00:46
      244000 -- (-1115.645) (-1114.122) (-1115.609) [-1114.445] * (-1118.534) [-1114.997] (-1116.254) (-1115.074) -- 0:00:46
      244500 -- (-1122.749) (-1114.153) (-1122.035) [-1114.424] * (-1124.227) [-1117.049] (-1120.161) (-1113.831) -- 0:00:46
      245000 -- (-1115.546) [-1119.704] (-1120.023) (-1117.933) * (-1116.282) (-1116.534) (-1117.096) [-1114.270] -- 0:00:46

      Average standard deviation of split frequencies: 0.017151

      245500 -- (-1115.020) (-1121.126) (-1114.539) [-1116.488] * (-1116.855) (-1117.554) [-1114.276] (-1113.591) -- 0:00:46
      246000 -- (-1115.118) [-1116.861] (-1114.664) (-1120.090) * [-1115.168] (-1117.827) (-1116.110) (-1113.598) -- 0:00:45
      246500 -- (-1115.486) [-1115.545] (-1117.931) (-1115.578) * [-1115.154] (-1116.679) (-1115.571) (-1114.187) -- 0:00:45
      247000 -- (-1115.757) (-1120.903) (-1119.066) [-1119.098] * [-1117.992] (-1115.383) (-1116.057) (-1115.055) -- 0:00:48
      247500 -- (-1115.444) (-1115.716) [-1117.018] (-1119.696) * (-1117.958) (-1116.640) [-1114.773] (-1114.279) -- 0:00:48
      248000 -- (-1114.874) [-1117.378] (-1116.048) (-1117.521) * (-1114.502) [-1117.081] (-1115.184) (-1115.293) -- 0:00:48
      248500 -- [-1115.879] (-1118.586) (-1113.953) (-1117.321) * [-1113.789] (-1118.999) (-1113.922) (-1113.516) -- 0:00:48
      249000 -- [-1114.872] (-1116.966) (-1114.714) (-1115.513) * [-1113.554] (-1119.248) (-1115.652) (-1113.528) -- 0:00:48
      249500 -- [-1116.348] (-1115.346) (-1114.302) (-1114.971) * (-1116.217) (-1116.255) (-1114.660) [-1115.752] -- 0:00:48
      250000 -- (-1115.644) [-1117.056] (-1117.341) (-1118.322) * (-1119.317) [-1114.556] (-1116.581) (-1120.613) -- 0:00:48

      Average standard deviation of split frequencies: 0.016478

      250500 -- [-1115.740] (-1115.203) (-1115.905) (-1115.358) * (-1117.000) (-1114.599) [-1114.896] (-1117.043) -- 0:00:47
      251000 -- (-1118.268) [-1115.171] (-1115.702) (-1115.707) * (-1116.965) (-1118.074) (-1118.142) [-1116.207] -- 0:00:47
      251500 -- [-1115.069] (-1114.712) (-1116.198) (-1115.084) * (-1114.094) (-1117.732) (-1118.502) [-1114.106] -- 0:00:47
      252000 -- (-1115.322) (-1114.628) (-1115.687) [-1114.154] * (-1116.272) (-1115.526) [-1115.355] (-1114.471) -- 0:00:47
      252500 -- (-1117.642) (-1117.031) [-1115.706] (-1116.018) * (-1115.742) (-1122.657) [-1115.964] (-1117.025) -- 0:00:47
      253000 -- [-1115.392] (-1116.541) (-1117.503) (-1115.979) * (-1115.420) (-1116.296) [-1114.557] (-1117.697) -- 0:00:47
      253500 -- [-1115.667] (-1117.614) (-1116.937) (-1115.558) * (-1116.856) (-1117.610) [-1115.530] (-1116.762) -- 0:00:47
      254000 -- (-1114.986) (-1115.313) (-1114.853) [-1114.250] * (-1115.219) (-1115.039) (-1116.160) [-1115.398] -- 0:00:46
      254500 -- [-1115.984] (-1116.818) (-1117.261) (-1115.501) * (-1115.504) [-1113.678] (-1114.658) (-1114.156) -- 0:00:46
      255000 -- (-1114.627) (-1116.852) (-1114.005) [-1117.345] * (-1114.625) [-1113.709] (-1114.277) (-1117.715) -- 0:00:46

      Average standard deviation of split frequencies: 0.015192

      255500 -- [-1113.551] (-1117.444) (-1114.622) (-1119.789) * (-1115.761) (-1114.503) [-1114.507] (-1114.817) -- 0:00:46
      256000 -- [-1117.113] (-1116.801) (-1115.485) (-1115.542) * (-1116.857) [-1114.459] (-1116.380) (-1116.594) -- 0:00:46
      256500 -- [-1113.623] (-1115.687) (-1114.805) (-1115.956) * (-1115.985) (-1114.063) (-1114.840) [-1115.314] -- 0:00:46
      257000 -- (-1113.716) (-1116.652) (-1113.866) [-1117.009] * (-1116.591) (-1114.755) (-1117.050) [-1114.239] -- 0:00:46
      257500 -- (-1114.952) (-1116.276) [-1114.095] (-1114.949) * (-1118.005) (-1115.655) (-1118.344) [-1115.339] -- 0:00:46
      258000 -- (-1119.985) (-1122.715) [-1114.262] (-1113.823) * (-1115.523) (-1116.556) [-1115.337] (-1115.628) -- 0:00:46
      258500 -- (-1114.311) (-1119.844) (-1116.704) [-1114.346] * [-1117.065] (-1114.120) (-1115.231) (-1115.303) -- 0:00:45
      259000 -- (-1115.488) (-1120.185) (-1113.822) [-1114.277] * (-1116.269) (-1115.526) [-1114.044] (-1114.556) -- 0:00:45
      259500 -- (-1115.848) (-1119.602) (-1113.816) [-1114.118] * [-1114.291] (-1114.283) (-1115.536) (-1114.415) -- 0:00:45
      260000 -- (-1115.120) (-1118.667) (-1116.321) [-1115.082] * (-1116.705) (-1115.362) [-1115.199] (-1114.843) -- 0:00:45

      Average standard deviation of split frequencies: 0.014558

      260500 -- (-1119.104) (-1117.447) [-1115.514] (-1116.608) * (-1116.394) [-1114.746] (-1118.472) (-1115.082) -- 0:00:45
      261000 -- [-1115.698] (-1116.997) (-1116.729) (-1114.878) * (-1122.520) (-1114.063) [-1114.891] (-1120.004) -- 0:00:45
      261500 -- (-1118.375) (-1117.569) (-1116.612) [-1115.273] * (-1116.944) (-1114.540) [-1118.761] (-1118.770) -- 0:00:45
      262000 -- (-1117.110) (-1115.830) (-1119.023) [-1116.118] * (-1113.895) (-1114.623) [-1115.955] (-1117.650) -- 0:00:45
      262500 -- (-1117.707) (-1114.860) [-1115.693] (-1119.568) * (-1113.820) [-1114.326] (-1114.711) (-1114.008) -- 0:00:44
      263000 -- (-1118.534) (-1114.058) (-1116.011) [-1115.510] * [-1115.775] (-1114.705) (-1115.689) (-1115.268) -- 0:00:44
      263500 -- (-1115.448) [-1114.158] (-1113.975) (-1117.636) * [-1113.993] (-1114.250) (-1115.497) (-1115.297) -- 0:00:47
      264000 -- (-1113.862) (-1115.242) (-1114.415) [-1116.558] * [-1113.993] (-1116.102) (-1114.486) (-1115.619) -- 0:00:47
      264500 -- (-1113.751) (-1115.453) [-1116.975] (-1115.843) * (-1114.310) (-1114.033) (-1117.183) [-1114.170] -- 0:00:47
      265000 -- [-1113.869] (-1118.483) (-1114.377) (-1118.922) * (-1116.797) [-1117.462] (-1116.133) (-1114.334) -- 0:00:47

      Average standard deviation of split frequencies: 0.014355

      265500 -- [-1113.962] (-1119.283) (-1117.661) (-1119.429) * (-1116.931) (-1117.628) [-1117.754] (-1115.840) -- 0:00:47
      266000 -- (-1116.921) (-1116.956) [-1117.289] (-1116.545) * (-1114.065) [-1117.934] (-1116.361) (-1113.863) -- 0:00:46
      266500 -- (-1116.160) (-1119.323) (-1115.291) [-1116.071] * (-1114.095) [-1114.721] (-1115.255) (-1114.998) -- 0:00:46
      267000 -- (-1114.959) [-1116.918] (-1116.294) (-1116.435) * [-1117.714] (-1116.312) (-1116.802) (-1114.053) -- 0:00:46
      267500 -- [-1115.045] (-1119.068) (-1116.813) (-1114.246) * (-1120.550) (-1115.417) (-1118.719) [-1113.674] -- 0:00:46
      268000 -- (-1117.408) (-1118.036) [-1118.568] (-1114.638) * (-1118.055) [-1115.459] (-1118.059) (-1114.991) -- 0:00:46
      268500 -- (-1114.599) (-1116.248) [-1115.908] (-1117.323) * (-1115.504) [-1118.319] (-1113.800) (-1116.301) -- 0:00:46
      269000 -- [-1114.136] (-1115.358) (-1120.173) (-1116.586) * [-1115.835] (-1115.682) (-1115.567) (-1115.458) -- 0:00:46
      269500 -- (-1113.721) (-1116.131) [-1118.241] (-1115.587) * (-1114.362) (-1115.482) (-1116.104) [-1114.525] -- 0:00:46
      270000 -- [-1114.032] (-1113.405) (-1114.330) (-1117.759) * (-1114.602) (-1117.308) [-1114.331] (-1114.564) -- 0:00:45

      Average standard deviation of split frequencies: 0.013850

      270500 -- (-1115.116) [-1114.267] (-1113.846) (-1113.826) * (-1115.347) (-1114.085) [-1115.806] (-1117.832) -- 0:00:45
      271000 -- (-1114.972) (-1114.284) [-1113.919] (-1114.329) * [-1114.113] (-1115.400) (-1118.640) (-1114.114) -- 0:00:45
      271500 -- (-1115.413) (-1114.799) (-1114.284) [-1114.219] * (-1115.501) [-1117.951] (-1116.608) (-1113.682) -- 0:00:45
      272000 -- (-1118.410) (-1116.280) [-1113.606] (-1114.159) * (-1118.995) [-1114.294] (-1115.899) (-1114.065) -- 0:00:45
      272500 -- (-1117.643) (-1113.871) (-1115.743) [-1117.819] * [-1115.428] (-1115.072) (-1115.294) (-1114.359) -- 0:00:45
      273000 -- (-1114.971) (-1116.603) [-1115.743] (-1117.079) * [-1114.757] (-1115.782) (-1115.078) (-1114.371) -- 0:00:45
      273500 -- (-1116.240) [-1114.913] (-1117.287) (-1117.897) * [-1115.715] (-1116.990) (-1120.635) (-1117.309) -- 0:00:45
      274000 -- (-1115.559) [-1113.824] (-1116.846) (-1118.190) * (-1115.559) (-1115.522) (-1115.386) [-1113.839] -- 0:00:45
      274500 -- (-1115.017) (-1114.215) (-1115.329) [-1117.308] * (-1116.548) [-1115.098] (-1114.637) (-1116.621) -- 0:00:44
      275000 -- (-1113.961) [-1114.645] (-1113.497) (-1116.983) * [-1116.094] (-1117.387) (-1114.704) (-1120.885) -- 0:00:44

      Average standard deviation of split frequencies: 0.014396

      275500 -- (-1113.595) (-1117.535) [-1113.468] (-1116.492) * (-1115.311) [-1115.392] (-1114.076) (-1118.966) -- 0:00:44
      276000 -- (-1113.963) (-1115.596) [-1114.399] (-1118.629) * [-1116.323] (-1114.249) (-1114.134) (-1121.742) -- 0:00:44
      276500 -- (-1117.167) (-1114.254) (-1114.044) [-1117.054] * (-1116.801) (-1115.138) (-1114.216) [-1117.124] -- 0:00:44
      277000 -- (-1116.375) (-1115.431) [-1119.229] (-1117.907) * (-1116.550) (-1117.693) (-1114.145) [-1115.320] -- 0:00:44
      277500 -- (-1117.160) (-1116.735) [-1116.131] (-1114.617) * (-1116.200) (-1114.030) (-1113.948) [-1116.410] -- 0:00:44
      278000 -- (-1118.658) (-1114.058) (-1114.891) [-1117.735] * [-1115.433] (-1114.384) (-1114.927) (-1116.567) -- 0:00:44
      278500 -- [-1115.011] (-1114.596) (-1118.735) (-1115.523) * (-1115.505) (-1116.041) (-1115.754) [-1114.984] -- 0:00:44
      279000 -- (-1116.199) (-1114.303) (-1120.507) [-1116.158] * (-1114.863) (-1116.392) (-1116.989) [-1117.530] -- 0:00:43
      279500 -- (-1114.959) (-1114.186) (-1116.285) [-1115.798] * (-1114.176) (-1114.251) (-1116.547) [-1117.828] -- 0:00:46
      280000 -- (-1115.674) (-1116.445) (-1114.822) [-1115.185] * (-1120.451) [-1114.181] (-1115.467) (-1114.599) -- 0:00:46

      Average standard deviation of split frequencies: 0.014811

      280500 -- (-1114.991) (-1119.212) (-1114.788) [-1115.652] * (-1117.644) [-1113.376] (-1116.473) (-1113.669) -- 0:00:46
      281000 -- (-1114.445) (-1118.030) (-1116.025) [-1115.867] * (-1116.822) (-1114.794) (-1114.245) [-1115.081] -- 0:00:46
      281500 -- (-1116.834) [-1115.389] (-1114.618) (-1117.524) * (-1119.993) (-1113.733) (-1114.186) [-1115.979] -- 0:00:45
      282000 -- (-1114.345) (-1118.723) [-1114.358] (-1115.679) * (-1114.149) [-1114.031] (-1114.531) (-1117.068) -- 0:00:45
      282500 -- (-1114.232) [-1115.436] (-1114.367) (-1117.427) * [-1115.372] (-1118.223) (-1115.151) (-1118.870) -- 0:00:45
      283000 -- [-1115.043] (-1115.354) (-1114.833) (-1116.209) * (-1116.942) (-1116.288) [-1114.447] (-1118.910) -- 0:00:45
      283500 -- [-1115.732] (-1115.675) (-1116.408) (-1115.907) * (-1116.328) (-1116.159) [-1113.844] (-1115.854) -- 0:00:45
      284000 -- (-1114.068) (-1119.065) [-1114.830] (-1116.792) * (-1116.596) (-1119.963) [-1117.088] (-1114.312) -- 0:00:45
      284500 -- [-1113.906] (-1113.783) (-1116.332) (-1115.257) * (-1115.177) [-1116.778] (-1119.317) (-1114.215) -- 0:00:45
      285000 -- (-1115.167) (-1113.592) (-1118.241) [-1114.611] * (-1116.085) [-1115.831] (-1119.560) (-1114.812) -- 0:00:45

      Average standard deviation of split frequencies: 0.014759

      285500 -- (-1116.082) (-1113.942) (-1115.436) [-1116.235] * (-1117.225) (-1118.592) (-1113.827) [-1114.929] -- 0:00:45
      286000 -- (-1122.963) (-1114.573) [-1113.937] (-1115.552) * [-1113.937] (-1120.330) (-1118.320) (-1115.581) -- 0:00:44
      286500 -- (-1118.126) (-1114.104) [-1116.023] (-1121.389) * (-1114.532) (-1114.005) [-1116.719] (-1116.793) -- 0:00:44
      287000 -- (-1117.258) (-1118.413) [-1116.791] (-1117.687) * [-1114.487] (-1114.029) (-1115.927) (-1115.948) -- 0:00:44
      287500 -- (-1117.409) (-1113.887) [-1114.515] (-1117.305) * [-1114.056] (-1116.112) (-1117.797) (-1115.801) -- 0:00:44
      288000 -- (-1114.357) (-1118.060) [-1115.159] (-1115.265) * (-1113.797) (-1114.928) [-1121.138] (-1120.501) -- 0:00:44
      288500 -- [-1115.103] (-1121.140) (-1117.323) (-1116.490) * [-1114.479] (-1114.866) (-1118.234) (-1119.504) -- 0:00:44
      289000 -- (-1115.472) (-1116.852) [-1116.551] (-1115.010) * (-1114.479) [-1114.698] (-1119.544) (-1119.187) -- 0:00:44
      289500 -- [-1113.467] (-1114.815) (-1113.713) (-1116.314) * (-1115.271) (-1116.447) (-1116.599) [-1115.386] -- 0:00:44
      290000 -- (-1114.330) (-1117.453) [-1113.270] (-1114.447) * [-1114.285] (-1115.939) (-1117.042) (-1121.141) -- 0:00:44

      Average standard deviation of split frequencies: 0.014817

      290500 -- (-1115.401) (-1116.271) [-1114.581] (-1116.347) * [-1115.274] (-1115.943) (-1116.822) (-1118.943) -- 0:00:43
      291000 -- (-1118.338) (-1115.769) [-1113.821] (-1116.557) * (-1114.794) [-1114.363] (-1119.546) (-1118.764) -- 0:00:43
      291500 -- (-1119.057) (-1113.310) [-1114.143] (-1114.414) * (-1113.907) [-1114.296] (-1118.598) (-1118.020) -- 0:00:43
      292000 -- (-1115.203) [-1114.038] (-1114.960) (-1115.866) * (-1114.588) (-1117.246) [-1116.799] (-1113.794) -- 0:00:43
      292500 -- (-1116.296) [-1114.113] (-1116.760) (-1114.679) * [-1114.208] (-1119.825) (-1113.822) (-1113.537) -- 0:00:43
      293000 -- (-1114.786) (-1115.068) [-1115.993] (-1114.414) * (-1115.666) (-1116.834) (-1114.812) [-1116.851] -- 0:00:43
      293500 -- (-1114.862) [-1114.603] (-1117.771) (-1114.391) * (-1115.483) (-1117.368) [-1115.152] (-1114.137) -- 0:00:43
      294000 -- [-1115.067] (-1115.288) (-1114.852) (-1114.653) * (-1115.976) (-1118.506) [-1116.782] (-1114.102) -- 0:00:43
      294500 -- (-1114.904) (-1118.478) [-1118.505] (-1116.451) * (-1118.686) [-1114.254] (-1119.406) (-1113.986) -- 0:00:43
      295000 -- (-1117.833) (-1113.336) [-1114.635] (-1118.426) * (-1115.314) (-1114.277) [-1117.778] (-1113.843) -- 0:00:43

      Average standard deviation of split frequencies: 0.014094

      295500 -- (-1116.685) (-1114.191) [-1114.406] (-1117.891) * (-1115.080) (-1114.565) [-1114.537] (-1118.070) -- 0:00:42
      296000 -- (-1115.813) (-1115.682) (-1116.044) [-1116.453] * (-1115.153) (-1114.724) (-1118.282) [-1114.705] -- 0:00:45
      296500 -- [-1116.049] (-1114.653) (-1119.149) (-1113.629) * (-1116.583) (-1115.111) (-1116.068) [-1115.924] -- 0:00:45
      297000 -- (-1118.738) (-1115.580) (-1115.652) [-1114.230] * (-1115.868) [-1114.695] (-1115.895) (-1116.227) -- 0:00:44
      297500 -- [-1114.581] (-1115.550) (-1116.107) (-1115.530) * (-1115.976) [-1117.756] (-1116.904) (-1115.483) -- 0:00:44
      298000 -- (-1117.141) (-1116.054) (-1115.499) [-1114.949] * (-1115.820) [-1114.081] (-1114.674) (-1117.997) -- 0:00:44
      298500 -- [-1117.567] (-1114.904) (-1117.476) (-1116.206) * (-1119.019) [-1116.721] (-1119.420) (-1115.477) -- 0:00:44
      299000 -- (-1118.512) (-1114.987) [-1115.935] (-1119.226) * (-1115.675) [-1116.983] (-1119.211) (-1121.014) -- 0:00:44
      299500 -- (-1118.482) (-1114.809) [-1116.327] (-1116.061) * (-1114.997) (-1119.494) [-1116.689] (-1118.298) -- 0:00:44
      300000 -- (-1115.636) [-1115.063] (-1119.928) (-1115.122) * (-1117.175) (-1115.595) [-1121.973] (-1118.533) -- 0:00:44

      Average standard deviation of split frequencies: 0.014346

      300500 -- (-1114.214) (-1117.348) [-1114.391] (-1118.247) * (-1116.601) [-1115.912] (-1115.740) (-1118.315) -- 0:00:44
      301000 -- (-1114.712) (-1118.243) [-1115.506] (-1117.810) * [-1115.841] (-1116.924) (-1114.369) (-1121.210) -- 0:00:44
      301500 -- (-1117.380) (-1115.566) (-1113.825) [-1117.301] * (-1117.677) (-1114.979) (-1114.923) [-1115.208] -- 0:00:44
      302000 -- (-1117.644) (-1117.460) (-1118.728) [-1114.867] * (-1117.727) [-1118.211] (-1114.690) (-1115.691) -- 0:00:43
      302500 -- [-1116.299] (-1114.206) (-1116.559) (-1114.670) * (-1116.261) (-1117.707) [-1116.890] (-1114.733) -- 0:00:43
      303000 -- (-1119.527) (-1119.408) [-1114.433] (-1114.696) * [-1114.963] (-1114.655) (-1114.981) (-1116.717) -- 0:00:43
      303500 -- (-1117.120) (-1116.815) [-1113.821] (-1121.733) * (-1115.565) (-1114.053) (-1114.514) [-1116.220] -- 0:00:43
      304000 -- [-1114.269] (-1116.705) (-1113.777) (-1117.001) * (-1113.715) (-1114.467) [-1114.514] (-1115.511) -- 0:00:43
      304500 -- (-1115.732) [-1114.896] (-1113.777) (-1119.654) * [-1114.587] (-1117.671) (-1115.250) (-1113.753) -- 0:00:43
      305000 -- (-1114.798) [-1115.418] (-1114.801) (-1118.335) * (-1113.690) (-1119.053) [-1115.253] (-1114.306) -- 0:00:43

      Average standard deviation of split frequencies: 0.014915

      305500 -- [-1114.631] (-1116.929) (-1114.425) (-1120.049) * (-1114.833) (-1117.196) [-1116.246] (-1115.804) -- 0:00:43
      306000 -- (-1117.161) (-1118.024) (-1115.882) [-1117.800] * [-1114.577] (-1116.006) (-1115.756) (-1115.041) -- 0:00:43
      306500 -- (-1116.703) [-1117.275] (-1118.076) (-1115.054) * (-1115.659) (-1115.435) [-1116.580] (-1116.671) -- 0:00:42
      307000 -- (-1116.132) (-1119.037) [-1118.205] (-1119.630) * (-1115.061) (-1117.270) (-1114.980) [-1116.302] -- 0:00:42
      307500 -- (-1116.456) (-1118.447) [-1117.280] (-1117.655) * (-1113.632) [-1116.759] (-1115.385) (-1115.022) -- 0:00:42
      308000 -- (-1117.775) (-1116.848) [-1114.240] (-1116.136) * (-1115.208) (-1115.423) (-1113.985) [-1124.580] -- 0:00:42
      308500 -- (-1113.556) [-1113.997] (-1115.426) (-1113.378) * (-1116.123) (-1114.411) [-1113.507] (-1121.853) -- 0:00:42
      309000 -- (-1113.303) [-1114.561] (-1117.637) (-1114.314) * [-1113.394] (-1114.614) (-1119.049) (-1114.204) -- 0:00:42
      309500 -- (-1113.599) [-1115.218] (-1116.312) (-1116.367) * (-1116.337) (-1114.886) (-1122.422) [-1114.652] -- 0:00:42
      310000 -- (-1114.069) (-1114.066) [-1116.181] (-1115.587) * (-1119.090) (-1115.312) (-1114.809) [-1116.320] -- 0:00:42

      Average standard deviation of split frequencies: 0.014484

      310500 -- (-1114.072) (-1115.125) [-1115.026] (-1115.865) * (-1116.095) [-1117.558] (-1119.225) (-1118.715) -- 0:00:42
      311000 -- (-1114.253) (-1117.918) (-1120.077) [-1117.072] * (-1115.562) [-1119.869] (-1116.384) (-1120.103) -- 0:00:42
      311500 -- [-1113.915] (-1115.787) (-1116.141) (-1116.622) * (-1115.322) [-1118.408] (-1117.140) (-1116.198) -- 0:00:41
      312000 -- [-1113.840] (-1113.555) (-1115.610) (-1114.135) * [-1115.515] (-1117.262) (-1113.890) (-1115.375) -- 0:00:44
      312500 -- (-1115.116) [-1113.993] (-1119.144) (-1113.625) * (-1116.885) (-1116.860) [-1114.477] (-1113.365) -- 0:00:44
      313000 -- [-1115.220] (-1115.318) (-1116.097) (-1116.435) * (-1114.590) (-1118.748) [-1114.146] (-1113.550) -- 0:00:43
      313500 -- (-1115.195) (-1116.036) (-1117.380) [-1116.778] * (-1115.944) (-1118.047) (-1116.012) [-1115.560] -- 0:00:43
      314000 -- (-1114.056) (-1115.017) [-1116.135] (-1113.413) * (-1117.432) (-1116.766) (-1117.284) [-1115.172] -- 0:00:43
      314500 -- (-1113.939) (-1114.789) (-1118.434) [-1114.229] * (-1117.687) (-1115.092) [-1116.153] (-1114.851) -- 0:00:43
      315000 -- [-1116.565] (-1113.713) (-1117.138) (-1118.141) * (-1116.420) [-1114.774] (-1120.155) (-1115.939) -- 0:00:43

      Average standard deviation of split frequencies: 0.014714

      315500 -- (-1119.007) (-1118.583) [-1115.255] (-1115.940) * [-1116.916] (-1114.754) (-1116.397) (-1115.941) -- 0:00:43
      316000 -- (-1116.952) (-1116.759) (-1113.956) [-1115.188] * (-1115.666) (-1114.786) [-1113.824] (-1116.987) -- 0:00:43
      316500 -- (-1113.794) (-1117.883) (-1114.068) [-1114.896] * (-1117.778) [-1116.088] (-1116.033) (-1114.727) -- 0:00:43
      317000 -- [-1113.752] (-1119.158) (-1115.065) (-1115.176) * (-1115.104) (-1116.678) [-1115.878] (-1115.051) -- 0:00:43
      317500 -- (-1117.654) [-1116.412] (-1114.671) (-1121.149) * [-1114.597] (-1118.547) (-1115.065) (-1114.461) -- 0:00:42
      318000 -- [-1118.361] (-1113.705) (-1114.740) (-1116.917) * (-1115.992) (-1117.965) [-1115.991] (-1115.227) -- 0:00:42
      318500 -- (-1116.873) (-1118.219) (-1116.914) [-1118.159] * (-1115.588) [-1115.281] (-1117.384) (-1115.224) -- 0:00:42
      319000 -- (-1116.060) [-1115.353] (-1117.270) (-1115.854) * (-1116.857) (-1115.832) [-1114.238] (-1116.272) -- 0:00:42
      319500 -- [-1116.237] (-1114.669) (-1113.826) (-1116.542) * (-1115.472) (-1115.440) (-1116.079) [-1114.904] -- 0:00:42
      320000 -- [-1118.042] (-1115.497) (-1114.957) (-1116.000) * [-1115.774] (-1118.362) (-1115.915) (-1116.608) -- 0:00:42

      Average standard deviation of split frequencies: 0.014701

      320500 -- [-1116.905] (-1114.250) (-1118.274) (-1121.409) * (-1115.990) (-1116.085) (-1115.726) [-1116.608] -- 0:00:42
      321000 -- [-1115.923] (-1115.381) (-1115.698) (-1114.998) * [-1115.232] (-1114.682) (-1113.773) (-1114.804) -- 0:00:42
      321500 -- (-1117.173) (-1114.441) (-1117.041) [-1116.238] * (-1115.078) (-1114.903) [-1114.534] (-1113.570) -- 0:00:42
      322000 -- (-1120.183) (-1114.427) (-1117.669) [-1114.740] * (-1114.440) (-1114.792) [-1116.234] (-1117.300) -- 0:00:42
      322500 -- (-1113.611) [-1114.263] (-1117.158) (-1115.796) * (-1119.396) (-1117.179) (-1116.276) [-1115.915] -- 0:00:42
      323000 -- (-1113.910) [-1116.032] (-1115.370) (-1115.622) * [-1114.227] (-1116.689) (-1116.081) (-1115.171) -- 0:00:41
      323500 -- [-1115.373] (-1117.825) (-1117.611) (-1118.966) * (-1115.092) [-1117.666] (-1113.196) (-1114.605) -- 0:00:41
      324000 -- (-1117.289) (-1117.783) [-1114.340] (-1115.887) * [-1113.404] (-1114.479) (-1114.134) (-1114.915) -- 0:00:41
      324500 -- [-1114.656] (-1114.855) (-1115.507) (-1117.381) * (-1119.307) (-1115.358) [-1116.026] (-1117.454) -- 0:00:41
      325000 -- (-1117.524) (-1114.855) (-1116.134) [-1115.533] * (-1121.762) (-1119.688) (-1115.802) [-1115.148] -- 0:00:41

      Average standard deviation of split frequencies: 0.014712

      325500 -- [-1115.905] (-1113.792) (-1114.293) (-1117.671) * (-1115.562) (-1116.450) (-1118.059) [-1114.472] -- 0:00:41
      326000 -- (-1114.796) [-1115.932] (-1114.585) (-1120.311) * (-1114.807) (-1115.070) (-1113.565) [-1115.754] -- 0:00:41
      326500 -- (-1115.322) [-1116.929] (-1116.819) (-1121.071) * [-1114.774] (-1114.693) (-1114.042) (-1114.495) -- 0:00:41
      327000 -- [-1116.332] (-1117.862) (-1114.279) (-1115.029) * (-1116.414) (-1114.971) [-1114.151] (-1114.411) -- 0:00:41
      327500 -- (-1118.886) [-1117.751] (-1113.587) (-1114.925) * (-1118.343) (-1115.094) (-1114.782) [-1120.180] -- 0:00:41
      328000 -- (-1117.578) (-1119.135) [-1114.041] (-1114.391) * [-1120.869] (-1113.928) (-1113.225) (-1118.170) -- 0:00:40
      328500 -- (-1117.678) [-1116.297] (-1114.082) (-1115.055) * (-1118.942) (-1115.989) [-1113.552] (-1115.331) -- 0:00:42
      329000 -- (-1117.648) [-1113.908] (-1114.909) (-1115.114) * [-1115.351] (-1120.734) (-1116.260) (-1114.524) -- 0:00:42
      329500 -- (-1114.639) (-1114.013) (-1115.797) [-1119.622] * [-1116.431] (-1120.612) (-1114.492) (-1114.531) -- 0:00:42
      330000 -- (-1118.070) [-1115.251] (-1115.394) (-1114.566) * (-1113.720) (-1115.489) (-1114.680) [-1115.131] -- 0:00:42

      Average standard deviation of split frequencies: 0.013985

      330500 -- (-1115.629) (-1114.810) [-1114.221] (-1114.377) * (-1113.662) (-1116.301) (-1116.797) [-1118.234] -- 0:00:42
      331000 -- [-1115.970] (-1119.036) (-1115.287) (-1114.282) * [-1114.345] (-1114.479) (-1118.506) (-1120.800) -- 0:00:42
      331500 -- (-1115.497) (-1116.141) [-1116.166] (-1118.164) * (-1116.831) [-1114.991] (-1119.498) (-1115.857) -- 0:00:42
      332000 -- (-1118.419) (-1119.035) [-1116.529] (-1116.039) * (-1114.846) (-1113.790) [-1114.705] (-1116.179) -- 0:00:42
      332500 -- [-1115.274] (-1117.295) (-1117.035) (-1121.350) * (-1114.107) [-1114.469] (-1116.896) (-1115.900) -- 0:00:42
      333000 -- (-1116.357) (-1118.164) (-1117.863) [-1116.052] * (-1113.996) [-1115.574] (-1117.995) (-1121.296) -- 0:00:42
      333500 -- (-1114.927) (-1115.073) (-1123.414) [-1115.846] * (-1114.668) [-1115.422] (-1113.582) (-1115.500) -- 0:00:41
      334000 -- (-1115.164) [-1116.737] (-1117.453) (-1117.122) * (-1119.550) [-1113.379] (-1115.597) (-1114.988) -- 0:00:41
      334500 -- (-1113.730) [-1115.476] (-1120.310) (-1114.662) * [-1116.846] (-1113.327) (-1115.859) (-1115.973) -- 0:00:41
      335000 -- (-1113.840) (-1114.631) [-1115.023] (-1116.311) * [-1114.617] (-1119.654) (-1114.451) (-1114.877) -- 0:00:41

      Average standard deviation of split frequencies: 0.013399

      335500 -- (-1113.849) (-1115.511) (-1115.412) [-1117.062] * (-1114.881) (-1120.134) (-1114.330) [-1115.430] -- 0:00:41
      336000 -- (-1119.898) (-1116.462) (-1114.927) [-1113.733] * [-1113.724] (-1117.234) (-1115.330) (-1114.717) -- 0:00:41
      336500 -- (-1115.161) (-1116.821) [-1113.240] (-1117.831) * (-1115.182) (-1116.425) (-1113.682) [-1114.873] -- 0:00:41
      337000 -- [-1114.153] (-1117.968) (-1113.653) (-1115.576) * (-1117.751) (-1117.791) (-1117.396) [-1118.086] -- 0:00:41
      337500 -- (-1115.705) [-1116.621] (-1114.180) (-1114.288) * (-1113.977) (-1118.100) [-1115.215] (-1114.987) -- 0:00:41
      338000 -- [-1115.303] (-1120.138) (-1113.435) (-1114.743) * [-1114.677] (-1117.589) (-1116.714) (-1117.837) -- 0:00:41
      338500 -- (-1118.830) [-1116.871] (-1113.412) (-1120.309) * (-1115.303) (-1116.241) [-1114.281] (-1114.811) -- 0:00:41
      339000 -- (-1115.315) (-1116.211) [-1114.400] (-1115.105) * (-1114.026) (-1114.059) [-1115.157] (-1114.924) -- 0:00:40
      339500 -- (-1117.997) [-1120.823] (-1114.085) (-1116.797) * (-1114.713) (-1114.434) (-1115.263) [-1118.466] -- 0:00:40
      340000 -- [-1115.766] (-1118.915) (-1114.326) (-1117.015) * [-1116.996] (-1114.423) (-1115.227) (-1119.523) -- 0:00:40

      Average standard deviation of split frequencies: 0.013255

      340500 -- (-1115.136) (-1119.170) [-1114.744] (-1116.472) * (-1114.747) [-1115.508] (-1116.858) (-1116.828) -- 0:00:40
      341000 -- (-1116.672) [-1117.963] (-1113.860) (-1118.588) * (-1115.682) [-1119.194] (-1118.551) (-1118.318) -- 0:00:40
      341500 -- (-1117.078) (-1115.846) (-1114.355) [-1115.030] * (-1114.424) [-1116.499] (-1115.819) (-1116.948) -- 0:00:40
      342000 -- (-1118.120) (-1116.683) [-1113.939] (-1117.140) * (-1115.188) (-1115.783) [-1116.317] (-1114.926) -- 0:00:40
      342500 -- (-1117.352) (-1116.609) (-1116.326) [-1117.145] * [-1117.020] (-1114.817) (-1115.735) (-1115.618) -- 0:00:40
      343000 -- [-1116.921] (-1116.179) (-1115.869) (-1118.111) * (-1117.991) [-1115.424] (-1115.987) (-1116.531) -- 0:00:40
      343500 -- [-1113.461] (-1117.418) (-1116.264) (-1116.263) * (-1116.447) (-1114.717) (-1116.968) [-1116.082] -- 0:00:40
      344000 -- (-1115.094) (-1117.614) (-1116.024) [-1117.474] * [-1119.276] (-1113.661) (-1116.042) (-1117.656) -- 0:00:40
      344500 -- (-1115.857) [-1114.997] (-1114.272) (-1116.322) * (-1113.901) (-1118.245) [-1114.772] (-1115.366) -- 0:00:39
      345000 -- (-1115.069) (-1117.173) (-1115.703) [-1116.261] * (-1114.566) [-1115.001] (-1114.246) (-1116.635) -- 0:00:41

      Average standard deviation of split frequencies: 0.013352

      345500 -- (-1116.045) (-1115.283) [-1114.664] (-1115.107) * (-1116.060) [-1115.126] (-1114.246) (-1118.075) -- 0:00:41
      346000 -- [-1114.926] (-1115.694) (-1120.018) (-1114.186) * [-1117.937] (-1115.090) (-1114.712) (-1119.718) -- 0:00:41
      346500 -- [-1114.957] (-1119.419) (-1114.767) (-1117.011) * (-1117.937) (-1116.006) (-1115.558) [-1114.784] -- 0:00:41
      347000 -- [-1115.318] (-1119.113) (-1116.135) (-1115.508) * (-1116.606) [-1114.502] (-1119.872) (-1114.440) -- 0:00:41
      347500 -- (-1117.434) (-1116.794) [-1114.170] (-1113.996) * (-1115.330) (-1115.190) (-1115.781) [-1114.269] -- 0:00:41
      348000 -- (-1115.122) (-1117.782) (-1114.865) [-1115.026] * (-1114.061) [-1114.976] (-1115.700) (-1114.830) -- 0:00:41
      348500 -- (-1118.450) [-1114.277] (-1115.832) (-1117.817) * (-1114.017) (-1118.004) (-1113.872) [-1117.297] -- 0:00:41
      349000 -- (-1114.486) (-1116.592) (-1116.762) [-1116.895] * (-1115.627) (-1116.571) (-1113.478) [-1119.423] -- 0:00:41
      349500 -- [-1114.347] (-1114.676) (-1117.385) (-1115.911) * (-1117.149) (-1115.874) (-1115.883) [-1113.989] -- 0:00:40
      350000 -- (-1117.105) (-1114.655) (-1115.431) [-1116.295] * (-1117.988) (-1113.674) [-1116.383] (-1114.630) -- 0:00:40

      Average standard deviation of split frequencies: 0.013107

      350500 -- (-1116.883) (-1114.141) [-1114.406] (-1119.945) * [-1113.662] (-1113.463) (-1116.216) (-1114.432) -- 0:00:40
      351000 -- (-1116.379) (-1114.662) [-1117.884] (-1121.289) * (-1115.056) (-1113.703) (-1116.602) [-1118.189] -- 0:00:40
      351500 -- (-1115.670) (-1119.751) (-1120.518) [-1117.090] * (-1116.642) (-1113.523) [-1118.900] (-1117.717) -- 0:00:40
      352000 -- (-1116.540) (-1115.601) [-1116.260] (-1114.838) * (-1115.249) [-1114.710] (-1118.517) (-1117.600) -- 0:00:40
      352500 -- (-1117.845) (-1117.149) [-1117.031] (-1115.792) * (-1117.125) (-1115.559) [-1116.934] (-1118.635) -- 0:00:40
      353000 -- (-1116.396) [-1113.227] (-1114.155) (-1117.779) * (-1114.857) [-1115.820] (-1115.202) (-1115.472) -- 0:00:40
      353500 -- (-1115.599) [-1114.783] (-1114.129) (-1118.462) * [-1116.342] (-1117.079) (-1114.365) (-1115.664) -- 0:00:40
      354000 -- (-1115.291) (-1115.347) [-1113.997] (-1115.924) * (-1114.584) (-1115.832) (-1114.433) [-1113.938] -- 0:00:40
      354500 -- (-1115.742) (-1118.387) (-1115.442) [-1116.863] * (-1114.131) [-1117.467] (-1115.896) (-1114.068) -- 0:00:40
      355000 -- (-1118.286) [-1117.695] (-1115.379) (-1117.389) * (-1114.405) (-1115.791) (-1121.242) [-1114.550] -- 0:00:39

      Average standard deviation of split frequencies: 0.012712

      355500 -- [-1115.424] (-1116.667) (-1115.320) (-1118.614) * (-1113.727) [-1113.788] (-1120.096) (-1115.101) -- 0:00:39
      356000 -- (-1117.644) [-1115.781] (-1116.132) (-1116.273) * [-1114.054] (-1114.291) (-1114.935) (-1117.185) -- 0:00:39
      356500 -- (-1116.082) (-1119.085) [-1117.608] (-1116.504) * [-1114.124] (-1114.387) (-1115.209) (-1118.528) -- 0:00:39
      357000 -- (-1115.161) (-1114.269) (-1117.851) [-1116.753] * (-1114.751) (-1113.702) (-1116.718) [-1114.394] -- 0:00:39
      357500 -- (-1116.369) (-1114.111) (-1117.349) [-1116.453] * (-1114.637) (-1113.413) (-1113.638) [-1115.025] -- 0:00:39
      358000 -- [-1117.522] (-1114.889) (-1114.152) (-1116.179) * [-1115.337] (-1114.282) (-1114.490) (-1114.583) -- 0:00:39
      358500 -- (-1116.221) (-1116.060) [-1114.654] (-1118.492) * [-1115.016] (-1115.685) (-1115.039) (-1115.540) -- 0:00:39
      359000 -- [-1115.288] (-1116.917) (-1113.584) (-1116.832) * (-1117.482) (-1116.356) (-1115.760) [-1113.377] -- 0:00:39
      359500 -- (-1115.840) (-1116.353) (-1115.456) [-1116.918] * [-1116.208] (-1114.277) (-1116.408) (-1113.824) -- 0:00:39
      360000 -- (-1117.510) [-1114.111] (-1114.052) (-1116.407) * (-1114.950) (-1113.864) [-1114.131] (-1116.828) -- 0:00:39

      Average standard deviation of split frequencies: 0.012245

      360500 -- (-1115.599) [-1118.956] (-1118.334) (-1113.992) * [-1116.841] (-1118.139) (-1116.821) (-1117.465) -- 0:00:39
      361000 -- (-1121.598) (-1119.188) [-1118.790] (-1114.230) * [-1116.580] (-1116.049) (-1114.984) (-1117.456) -- 0:00:38
      361500 -- [-1115.598] (-1118.596) (-1117.037) (-1114.978) * [-1118.500] (-1116.288) (-1116.806) (-1116.554) -- 0:00:40
      362000 -- (-1115.934) (-1114.446) [-1115.683] (-1115.550) * (-1120.094) [-1113.329] (-1118.836) (-1122.446) -- 0:00:40
      362500 -- (-1118.468) (-1114.988) [-1118.081] (-1115.339) * (-1117.968) (-1115.644) [-1115.374] (-1118.620) -- 0:00:40
      363000 -- [-1119.966] (-1115.067) (-1119.602) (-1114.367) * (-1115.158) (-1114.477) (-1116.919) [-1118.553] -- 0:00:40
      363500 -- (-1114.987) (-1116.510) [-1118.244] (-1115.870) * (-1113.551) (-1114.244) (-1114.955) [-1114.103] -- 0:00:40
      364000 -- (-1117.417) (-1119.298) [-1116.102] (-1115.700) * (-1116.638) [-1113.803] (-1116.861) (-1113.875) -- 0:00:40
      364500 -- [-1114.652] (-1113.895) (-1116.411) (-1116.403) * (-1113.685) [-1117.192] (-1114.985) (-1113.974) -- 0:00:40
      365000 -- (-1114.336) (-1114.923) [-1116.480] (-1116.603) * (-1120.794) [-1117.134] (-1116.332) (-1114.002) -- 0:00:40

      Average standard deviation of split frequencies: 0.013371

      365500 -- (-1113.336) (-1115.109) (-1116.633) [-1114.805] * [-1115.865] (-1114.246) (-1116.531) (-1116.912) -- 0:00:39
      366000 -- (-1115.779) [-1113.797] (-1116.992) (-1115.051) * (-1117.551) [-1114.315] (-1114.642) (-1114.943) -- 0:00:39
      366500 -- (-1117.125) (-1114.123) (-1115.841) [-1115.366] * (-1114.837) [-1117.282] (-1118.177) (-1115.550) -- 0:00:39
      367000 -- (-1118.432) [-1119.538] (-1115.453) (-1116.563) * (-1114.662) (-1115.277) [-1116.345] (-1115.146) -- 0:00:39
      367500 -- (-1116.351) (-1115.652) (-1116.896) [-1113.907] * [-1114.238] (-1116.686) (-1114.386) (-1115.304) -- 0:00:39
      368000 -- [-1114.564] (-1115.848) (-1116.621) (-1115.522) * (-1115.639) (-1114.885) (-1114.571) [-1116.371] -- 0:00:39
      368500 -- [-1115.431] (-1115.573) (-1117.497) (-1114.606) * (-1118.105) [-1115.650] (-1120.064) (-1116.371) -- 0:00:39
      369000 -- (-1119.196) (-1115.883) (-1116.809) [-1113.443] * [-1115.774] (-1117.976) (-1118.679) (-1114.940) -- 0:00:39
      369500 -- (-1117.833) (-1118.824) (-1116.040) [-1115.767] * (-1117.614) (-1115.213) (-1120.390) [-1113.677] -- 0:00:39
      370000 -- (-1116.486) (-1115.298) (-1117.417) [-1117.206] * (-1114.242) (-1115.035) (-1119.299) [-1114.245] -- 0:00:39

      Average standard deviation of split frequencies: 0.011587

      370500 -- (-1116.153) [-1114.089] (-1115.315) (-1119.178) * (-1114.386) (-1117.024) [-1116.977] (-1115.777) -- 0:00:39
      371000 -- (-1114.182) (-1117.138) (-1120.666) [-1119.140] * (-1114.674) (-1114.855) (-1114.687) [-1113.669] -- 0:00:38
      371500 -- (-1114.781) (-1118.726) [-1117.247] (-1113.880) * (-1119.166) (-1116.197) [-1114.730] (-1118.932) -- 0:00:38
      372000 -- [-1115.632] (-1116.906) (-1118.768) (-1114.042) * (-1117.309) (-1116.383) (-1114.216) [-1115.242] -- 0:00:38
      372500 -- (-1114.647) (-1114.222) (-1116.424) [-1116.137] * (-1114.769) (-1117.605) (-1115.117) [-1115.543] -- 0:00:38
      373000 -- (-1115.707) [-1113.698] (-1115.141) (-1115.411) * (-1114.995) (-1117.679) [-1115.370] (-1114.310) -- 0:00:38
      373500 -- (-1116.599) (-1118.709) (-1113.521) [-1116.056] * (-1117.563) (-1117.306) [-1116.271] (-1116.319) -- 0:00:38
      374000 -- (-1115.824) [-1120.234] (-1115.101) (-1115.350) * (-1116.462) (-1114.471) (-1114.353) [-1113.512] -- 0:00:38
      374500 -- [-1115.789] (-1118.405) (-1114.603) (-1115.146) * (-1113.894) (-1114.489) (-1115.277) [-1116.257] -- 0:00:38
      375000 -- (-1114.626) [-1114.037] (-1115.291) (-1115.043) * (-1113.677) (-1115.386) [-1114.951] (-1119.149) -- 0:00:38

      Average standard deviation of split frequencies: 0.012259

      375500 -- (-1115.999) (-1114.816) (-1115.084) [-1122.009] * (-1115.660) (-1115.629) [-1114.179] (-1115.563) -- 0:00:38
      376000 -- (-1116.782) [-1115.518] (-1117.967) (-1115.111) * [-1113.239] (-1115.441) (-1114.434) (-1114.710) -- 0:00:38
      376500 -- (-1115.470) (-1118.009) (-1121.357) [-1115.450] * (-1114.034) [-1117.991] (-1115.630) (-1117.022) -- 0:00:39
      377000 -- (-1114.277) (-1117.161) [-1114.780] (-1118.278) * (-1115.178) (-1115.868) (-1115.663) [-1114.380] -- 0:00:39
      377500 -- (-1114.181) (-1117.079) (-1117.938) [-1115.617] * (-1114.090) (-1114.469) (-1119.071) [-1118.333] -- 0:00:39
      378000 -- [-1120.686] (-1114.914) (-1113.705) (-1117.754) * [-1113.809] (-1114.825) (-1114.348) (-1117.011) -- 0:00:39
      378500 -- (-1114.762) [-1115.287] (-1113.388) (-1118.656) * (-1115.705) [-1114.428] (-1118.019) (-1115.307) -- 0:00:39
      379000 -- (-1114.537) (-1115.613) (-1115.861) [-1114.919] * [-1115.178] (-1114.932) (-1116.614) (-1114.869) -- 0:00:39
      379500 -- (-1114.675) (-1115.029) (-1114.615) [-1114.970] * [-1114.213] (-1120.011) (-1115.520) (-1116.439) -- 0:00:39
      380000 -- (-1115.686) (-1114.762) [-1115.423] (-1115.667) * [-1115.197] (-1118.160) (-1116.160) (-1115.486) -- 0:00:39

      Average standard deviation of split frequencies: 0.011489

      380500 -- (-1117.830) (-1115.384) [-1113.434] (-1113.871) * (-1114.164) (-1116.957) [-1115.595] (-1115.896) -- 0:00:39
      381000 -- (-1115.948) [-1116.223] (-1116.465) (-1115.821) * (-1115.484) (-1116.958) [-1116.406] (-1117.352) -- 0:00:38
      381500 -- [-1116.351] (-1114.717) (-1116.070) (-1115.200) * (-1114.130) (-1116.066) [-1116.119] (-1113.617) -- 0:00:38
      382000 -- (-1116.353) (-1114.139) (-1115.838) [-1114.700] * [-1116.018] (-1116.268) (-1114.695) (-1117.165) -- 0:00:38
      382500 -- (-1121.004) (-1118.878) (-1116.628) [-1114.431] * (-1113.863) (-1117.397) [-1117.156] (-1114.878) -- 0:00:38
      383000 -- (-1117.368) [-1122.928] (-1113.712) (-1114.471) * (-1116.899) (-1113.703) [-1113.695] (-1114.119) -- 0:00:38
      383500 -- (-1117.989) (-1115.790) (-1115.554) [-1116.533] * (-1117.110) [-1115.131] (-1114.659) (-1113.271) -- 0:00:38
      384000 -- (-1115.470) (-1116.309) (-1113.589) [-1116.482] * (-1113.936) (-1115.354) (-1115.654) [-1115.299] -- 0:00:38
      384500 -- (-1119.864) [-1116.513] (-1114.316) (-1114.894) * (-1114.425) [-1113.939] (-1118.638) (-1117.052) -- 0:00:38
      385000 -- (-1115.851) (-1119.316) [-1114.853] (-1115.837) * [-1113.630] (-1114.368) (-1118.242) (-1114.438) -- 0:00:38

      Average standard deviation of split frequencies: 0.010381

      385500 -- (-1116.457) (-1116.885) [-1114.599] (-1114.111) * (-1113.601) [-1115.912] (-1118.380) (-1114.931) -- 0:00:38
      386000 -- (-1115.607) [-1116.021] (-1115.296) (-1114.021) * (-1114.778) [-1113.932] (-1115.282) (-1117.386) -- 0:00:38
      386500 -- (-1117.758) [-1117.568] (-1113.470) (-1114.503) * (-1115.192) (-1114.489) (-1118.337) [-1115.583] -- 0:00:38
      387000 -- [-1115.086] (-1116.431) (-1113.697) (-1115.702) * (-1117.941) (-1114.489) (-1115.651) [-1116.398] -- 0:00:38
      387500 -- (-1114.881) [-1114.445] (-1117.177) (-1115.740) * [-1114.201] (-1114.192) (-1114.762) (-1113.411) -- 0:00:37
      388000 -- (-1114.903) (-1114.847) (-1114.092) [-1117.103] * (-1116.000) [-1116.932] (-1117.126) (-1114.427) -- 0:00:37
      388500 -- [-1115.741] (-1119.641) (-1116.213) (-1115.784) * (-1113.566) [-1114.645] (-1114.741) (-1113.773) -- 0:00:37
      389000 -- [-1113.471] (-1115.439) (-1118.250) (-1114.047) * (-1114.039) (-1113.932) [-1116.316] (-1115.005) -- 0:00:37
      389500 -- (-1115.394) (-1116.334) (-1119.193) [-1113.967] * (-1113.834) (-1115.994) [-1114.374] (-1115.532) -- 0:00:37
      390000 -- [-1115.144] (-1114.005) (-1119.386) (-1116.138) * (-1116.170) (-1115.926) [-1113.741] (-1115.256) -- 0:00:37

      Average standard deviation of split frequencies: 0.009854

      390500 -- [-1118.938] (-1121.386) (-1118.249) (-1115.599) * [-1114.712] (-1116.058) (-1114.250) (-1117.264) -- 0:00:37
      391000 -- [-1114.223] (-1116.862) (-1118.049) (-1115.124) * (-1116.679) [-1114.402] (-1116.104) (-1115.072) -- 0:00:37
      391500 -- (-1115.786) [-1116.995] (-1116.301) (-1117.108) * [-1115.178] (-1114.390) (-1114.303) (-1115.844) -- 0:00:37
      392000 -- (-1117.162) (-1115.823) (-1120.265) [-1118.795] * (-1113.892) [-1113.785] (-1116.247) (-1118.540) -- 0:00:37
      392500 -- (-1114.687) (-1116.375) (-1115.378) [-1114.775] * (-1115.119) [-1113.698] (-1115.610) (-1114.121) -- 0:00:37
      393000 -- [-1114.190] (-1116.769) (-1115.023) (-1116.918) * (-1114.128) (-1114.085) (-1115.452) [-1115.059] -- 0:00:38
      393500 -- [-1113.596] (-1116.590) (-1115.219) (-1116.200) * (-1117.800) [-1115.503] (-1114.977) (-1115.570) -- 0:00:38
      394000 -- [-1113.755] (-1114.575) (-1115.776) (-1113.411) * [-1113.537] (-1119.050) (-1120.000) (-1114.095) -- 0:00:38
      394500 -- (-1116.444) [-1117.229] (-1115.030) (-1113.858) * [-1114.605] (-1116.862) (-1116.226) (-1116.110) -- 0:00:38
      395000 -- (-1116.472) (-1115.554) [-1117.514] (-1113.848) * (-1117.105) [-1114.810] (-1114.501) (-1115.019) -- 0:00:38

      Average standard deviation of split frequencies: 0.009259

      395500 -- (-1116.876) [-1113.698] (-1116.885) (-1114.126) * (-1114.400) (-1116.374) (-1114.450) [-1115.061] -- 0:00:38
      396000 -- (-1116.648) (-1116.149) [-1118.129] (-1114.117) * (-1113.647) [-1117.484] (-1117.007) (-1116.738) -- 0:00:38
      396500 -- (-1115.581) (-1118.232) (-1118.938) [-1115.202] * (-1113.606) [-1114.731] (-1123.750) (-1115.433) -- 0:00:38
      397000 -- [-1116.482] (-1118.565) (-1118.641) (-1114.704) * [-1113.785] (-1115.247) (-1117.039) (-1116.889) -- 0:00:37
      397500 -- (-1116.637) (-1114.505) (-1116.710) [-1117.809] * (-1114.396) [-1115.206] (-1118.500) (-1114.864) -- 0:00:37
      398000 -- (-1117.452) (-1115.087) (-1115.313) [-1115.295] * [-1114.037] (-1117.024) (-1115.305) (-1119.257) -- 0:00:37
      398500 -- (-1114.546) (-1115.060) [-1115.683] (-1117.752) * (-1116.089) [-1115.901] (-1114.926) (-1117.352) -- 0:00:37
      399000 -- (-1118.644) [-1114.253] (-1118.533) (-1114.921) * (-1113.326) [-1117.477] (-1118.917) (-1119.189) -- 0:00:37
      399500 -- (-1114.305) [-1115.422] (-1115.669) (-1114.463) * [-1116.317] (-1118.479) (-1116.433) (-1113.323) -- 0:00:37
      400000 -- (-1115.426) [-1113.735] (-1115.981) (-1114.704) * [-1115.527] (-1119.017) (-1116.191) (-1115.738) -- 0:00:37

      Average standard deviation of split frequencies: 0.009739

      400500 -- (-1119.212) [-1113.520] (-1115.414) (-1114.552) * (-1115.861) (-1114.005) (-1114.407) [-1117.456] -- 0:00:37
      401000 -- (-1117.226) (-1115.802) [-1116.600] (-1115.249) * (-1115.607) (-1117.572) [-1115.033] (-1118.769) -- 0:00:37
      401500 -- [-1114.587] (-1115.412) (-1115.251) (-1120.892) * (-1115.600) (-1115.596) (-1118.216) [-1117.939] -- 0:00:37
      402000 -- (-1113.840) (-1115.395) (-1115.783) [-1121.568] * [-1115.399] (-1113.543) (-1120.233) (-1116.029) -- 0:00:37
      402500 -- (-1117.709) [-1115.164] (-1115.904) (-1116.356) * (-1116.958) [-1114.394] (-1113.859) (-1117.919) -- 0:00:37
      403000 -- (-1118.072) (-1119.485) [-1117.067] (-1117.172) * (-1114.442) [-1120.135] (-1116.182) (-1114.596) -- 0:00:37
      403500 -- (-1123.110) (-1116.092) [-1116.687] (-1114.998) * (-1117.375) [-1114.616] (-1114.233) (-1117.334) -- 0:00:36
      404000 -- (-1114.205) (-1116.801) (-1114.651) [-1117.958] * [-1117.052] (-1116.452) (-1113.868) (-1117.641) -- 0:00:36
      404500 -- (-1117.702) (-1117.170) (-1115.616) [-1118.774] * [-1117.169] (-1117.112) (-1115.439) (-1114.977) -- 0:00:36
      405000 -- (-1120.561) [-1116.083] (-1117.153) (-1114.457) * (-1117.672) (-1116.376) [-1115.331] (-1114.764) -- 0:00:36

      Average standard deviation of split frequencies: 0.010192

      405500 -- (-1116.954) (-1115.218) (-1116.645) [-1117.663] * (-1113.617) (-1115.756) (-1118.693) [-1113.958] -- 0:00:36
      406000 -- (-1115.134) (-1115.895) (-1120.597) [-1117.007] * (-1116.048) (-1116.089) (-1114.592) [-1115.346] -- 0:00:36
      406500 -- (-1114.323) (-1116.128) (-1118.561) [-1114.415] * [-1114.150] (-1117.728) (-1114.144) (-1115.026) -- 0:00:36
      407000 -- (-1117.041) (-1114.412) [-1116.670] (-1114.757) * (-1115.005) [-1117.110] (-1114.453) (-1114.204) -- 0:00:36
      407500 -- (-1116.562) (-1115.590) [-1117.525] (-1114.366) * (-1116.714) (-1119.421) [-1113.516] (-1117.481) -- 0:00:36
      408000 -- (-1116.375) [-1119.366] (-1119.633) (-1114.980) * (-1116.260) (-1114.522) (-1116.965) [-1115.731] -- 0:00:36
      408500 -- (-1119.415) (-1116.158) (-1116.123) [-1115.539] * (-1117.837) (-1116.094) (-1116.629) [-1115.884] -- 0:00:36
      409000 -- [-1115.358] (-1118.054) (-1114.962) (-1115.393) * (-1115.417) (-1116.854) (-1118.697) [-1114.394] -- 0:00:37
      409500 -- (-1114.847) (-1117.762) (-1115.131) [-1114.196] * (-1114.962) (-1115.763) [-1116.434] (-1116.625) -- 0:00:37
      410000 -- (-1118.181) (-1116.736) (-1114.919) [-1114.227] * [-1114.721] (-1116.435) (-1114.907) (-1115.620) -- 0:00:37

      Average standard deviation of split frequencies: 0.009630

      410500 -- [-1115.655] (-1117.599) (-1117.234) (-1116.266) * [-1113.873] (-1117.067) (-1121.204) (-1115.793) -- 0:00:37
      411000 -- (-1114.716) (-1115.033) [-1115.187] (-1113.941) * (-1117.582) (-1115.473) [-1119.016] (-1116.195) -- 0:00:37
      411500 -- (-1115.336) (-1118.816) (-1115.019) [-1115.268] * (-1115.584) (-1119.670) [-1114.356] (-1115.287) -- 0:00:37
      412000 -- [-1115.314] (-1118.742) (-1114.045) (-1116.344) * (-1118.658) [-1118.829] (-1116.481) (-1115.049) -- 0:00:37
      412500 -- (-1113.691) (-1114.918) [-1115.604] (-1120.470) * (-1113.826) [-1117.864] (-1119.655) (-1118.033) -- 0:00:37
      413000 -- (-1115.653) [-1113.761] (-1115.764) (-1115.486) * (-1113.266) (-1117.649) (-1116.890) [-1116.385] -- 0:00:36
      413500 -- (-1115.746) [-1115.637] (-1114.969) (-1117.331) * [-1118.632] (-1122.126) (-1117.679) (-1117.128) -- 0:00:36
      414000 -- [-1115.829] (-1117.440) (-1113.887) (-1116.310) * [-1114.693] (-1115.257) (-1118.195) (-1115.024) -- 0:00:36
      414500 -- [-1118.886] (-1116.744) (-1113.888) (-1115.486) * (-1115.284) [-1115.492] (-1115.320) (-1114.705) -- 0:00:36
      415000 -- (-1115.202) [-1115.629] (-1114.760) (-1115.551) * (-1114.630) (-1121.924) (-1117.032) [-1113.515] -- 0:00:36

      Average standard deviation of split frequencies: 0.009569

      415500 -- (-1114.434) (-1116.483) [-1113.726] (-1116.123) * (-1115.461) [-1117.037] (-1116.709) (-1113.926) -- 0:00:36
      416000 -- [-1114.870] (-1117.796) (-1114.828) (-1116.842) * (-1113.492) (-1120.834) (-1117.449) [-1113.813] -- 0:00:36
      416500 -- (-1115.925) (-1117.764) (-1114.842) [-1121.216] * (-1113.974) [-1119.477] (-1115.462) (-1116.132) -- 0:00:36
      417000 -- [-1114.829] (-1116.043) (-1114.354) (-1115.081) * [-1113.815] (-1114.717) (-1116.849) (-1114.893) -- 0:00:36
      417500 -- (-1115.709) (-1114.178) (-1114.275) [-1116.992] * (-1117.060) [-1115.247] (-1122.301) (-1115.873) -- 0:00:36
      418000 -- [-1118.378] (-1118.521) (-1114.128) (-1115.602) * (-1117.607) (-1115.353) (-1114.290) [-1118.962] -- 0:00:36
      418500 -- [-1114.324] (-1114.374) (-1116.489) (-1116.225) * (-1116.070) (-1115.033) (-1114.393) [-1114.974] -- 0:00:36
      419000 -- (-1114.363) (-1113.749) (-1114.550) [-1114.216] * (-1114.953) (-1116.526) (-1113.847) [-1115.375] -- 0:00:36
      419500 -- (-1116.615) [-1113.518] (-1116.874) (-1113.311) * [-1116.009] (-1115.617) (-1118.104) (-1115.426) -- 0:00:35
      420000 -- [-1115.499] (-1113.504) (-1115.473) (-1115.276) * [-1113.501] (-1117.224) (-1120.745) (-1114.960) -- 0:00:35

      Average standard deviation of split frequencies: 0.010027

      420500 -- (-1115.512) (-1116.666) [-1117.223] (-1114.262) * (-1115.943) [-1115.473] (-1114.956) (-1116.160) -- 0:00:35
      421000 -- (-1114.578) (-1118.552) [-1116.539] (-1117.602) * (-1114.361) [-1115.641] (-1115.035) (-1115.906) -- 0:00:35
      421500 -- [-1116.070] (-1121.491) (-1114.151) (-1119.269) * (-1115.073) (-1113.723) (-1118.456) [-1114.748] -- 0:00:35
      422000 -- (-1115.391) (-1118.181) [-1117.451] (-1118.912) * (-1114.111) [-1115.362] (-1114.192) (-1114.445) -- 0:00:35
      422500 -- (-1114.755) (-1117.420) [-1116.232] (-1117.554) * (-1115.722) (-1115.742) [-1113.996] (-1114.437) -- 0:00:35
      423000 -- (-1114.723) (-1115.290) [-1116.341] (-1115.058) * (-1113.994) [-1116.985] (-1114.254) (-1114.442) -- 0:00:35
      423500 -- (-1114.655) (-1118.658) [-1114.169] (-1114.167) * [-1115.215] (-1116.651) (-1118.742) (-1115.807) -- 0:00:35
      424000 -- (-1115.344) [-1114.372] (-1114.941) (-1114.766) * (-1114.421) (-1114.289) [-1116.670] (-1115.259) -- 0:00:35
      424500 -- (-1116.757) (-1117.789) (-1115.591) [-1114.206] * (-1116.103) [-1114.643] (-1114.810) (-1116.514) -- 0:00:35
      425000 -- (-1114.595) (-1117.809) (-1115.546) [-1117.028] * (-1116.510) (-1115.183) (-1114.799) [-1114.736] -- 0:00:35

      Average standard deviation of split frequencies: 0.009610

      425500 -- (-1115.343) [-1115.461] (-1117.902) (-1115.626) * (-1115.553) (-1114.430) [-1114.007] (-1119.162) -- 0:00:36
      426000 -- (-1116.340) (-1118.093) [-1115.009] (-1115.345) * (-1115.628) [-1116.654] (-1114.243) (-1116.750) -- 0:00:36
      426500 -- [-1116.079] (-1116.497) (-1114.164) (-1115.266) * (-1115.309) [-1114.485] (-1113.644) (-1115.147) -- 0:00:36
      427000 -- (-1118.953) (-1116.181) [-1113.757] (-1118.367) * [-1115.062] (-1114.749) (-1118.575) (-1113.575) -- 0:00:36
      427500 -- (-1113.669) (-1114.537) (-1114.629) [-1117.430] * (-1114.349) (-1114.597) (-1114.941) [-1113.583] -- 0:00:36
      428000 -- (-1119.335) [-1115.291] (-1116.442) (-1122.887) * (-1119.897) (-1114.448) [-1115.730] (-1119.002) -- 0:00:36
      428500 -- (-1115.133) [-1114.605] (-1113.620) (-1117.948) * [-1116.456] (-1115.688) (-1114.936) (-1114.310) -- 0:00:36
      429000 -- [-1116.554] (-1115.717) (-1114.827) (-1117.795) * (-1114.514) [-1114.911] (-1117.068) (-1120.457) -- 0:00:35
      429500 -- (-1114.854) [-1116.004] (-1114.416) (-1115.542) * [-1114.624] (-1118.340) (-1117.639) (-1115.998) -- 0:00:35
      430000 -- (-1115.821) (-1115.300) [-1113.634] (-1113.855) * (-1114.624) (-1118.994) [-1117.617] (-1115.488) -- 0:00:35

      Average standard deviation of split frequencies: 0.009608

      430500 -- (-1119.100) (-1116.922) [-1113.642] (-1116.364) * (-1117.126) [-1115.018] (-1117.534) (-1119.332) -- 0:00:35
      431000 -- (-1116.191) [-1115.523] (-1114.720) (-1115.255) * (-1114.888) (-1116.381) (-1115.023) [-1115.058] -- 0:00:35
      431500 -- (-1115.251) (-1113.717) [-1115.420] (-1113.888) * [-1115.611] (-1118.605) (-1114.189) (-1113.817) -- 0:00:35
      432000 -- (-1116.822) [-1114.899] (-1118.304) (-1113.979) * (-1115.019) [-1114.910] (-1119.363) (-1115.448) -- 0:00:35
      432500 -- (-1116.410) (-1121.434) (-1114.659) [-1114.390] * (-1118.048) (-1117.177) (-1114.114) [-1115.278] -- 0:00:35
      433000 -- (-1113.833) [-1114.678] (-1118.739) (-1114.493) * (-1115.456) (-1118.970) (-1113.274) [-1115.632] -- 0:00:35
      433500 -- (-1115.745) (-1114.773) (-1115.452) [-1114.582] * (-1119.213) (-1117.178) [-1113.274] (-1116.492) -- 0:00:35
      434000 -- (-1114.915) (-1115.600) (-1114.979) [-1115.019] * (-1117.740) (-1117.386) (-1113.915) [-1115.985] -- 0:00:35
      434500 -- [-1114.737] (-1119.168) (-1114.143) (-1118.707) * (-1116.485) (-1117.608) (-1116.832) [-1115.516] -- 0:00:35
      435000 -- [-1119.036] (-1115.901) (-1116.372) (-1114.928) * (-1117.296) (-1117.380) [-1115.362] (-1114.846) -- 0:00:35

      Average standard deviation of split frequencies: 0.009310

      435500 -- (-1119.927) (-1115.407) [-1114.107] (-1119.622) * (-1116.635) (-1120.024) [-1116.466] (-1116.062) -- 0:00:34
      436000 -- (-1114.293) (-1115.773) [-1116.042] (-1117.458) * (-1115.655) [-1116.349] (-1116.182) (-1114.210) -- 0:00:34
      436500 -- (-1113.922) [-1117.251] (-1118.013) (-1118.924) * (-1117.360) [-1114.780] (-1116.177) (-1114.471) -- 0:00:34
      437000 -- (-1116.884) [-1115.361] (-1122.071) (-1114.220) * (-1119.519) (-1113.939) [-1115.244] (-1114.877) -- 0:00:34
      437500 -- [-1114.512] (-1116.974) (-1119.715) (-1114.222) * [-1119.083] (-1118.591) (-1114.430) (-1114.169) -- 0:00:34
      438000 -- (-1117.847) (-1116.489) [-1118.174] (-1114.691) * [-1116.299] (-1119.907) (-1116.273) (-1114.124) -- 0:00:34
      438500 -- (-1117.195) [-1114.806] (-1113.341) (-1115.360) * (-1113.709) [-1115.605] (-1115.417) (-1114.072) -- 0:00:34
      439000 -- (-1114.869) [-1115.090] (-1114.042) (-1113.831) * (-1114.457) [-1114.779] (-1119.070) (-1114.478) -- 0:00:34
      439500 -- (-1115.683) (-1116.742) [-1113.479] (-1115.021) * (-1115.398) (-1115.031) (-1113.710) [-1114.271] -- 0:00:34
      440000 -- (-1114.146) (-1119.459) (-1113.997) [-1116.387] * (-1116.235) (-1115.300) (-1113.838) [-1114.241] -- 0:00:34

      Average standard deviation of split frequencies: 0.009390

      440500 -- (-1118.045) [-1118.450] (-1119.756) (-1113.823) * (-1114.125) [-1116.120] (-1115.790) (-1117.784) -- 0:00:34
      441000 -- (-1120.268) (-1119.052) (-1117.225) [-1116.190] * (-1114.764) (-1117.576) (-1119.058) [-1114.651] -- 0:00:34
      441500 -- (-1119.696) (-1113.779) (-1114.728) [-1116.170] * (-1113.794) [-1115.930] (-1118.258) (-1114.967) -- 0:00:35
      442000 -- (-1117.129) [-1114.358] (-1116.233) (-1114.059) * [-1113.690] (-1119.692) (-1115.195) (-1114.617) -- 0:00:35
      442500 -- (-1113.823) [-1114.328] (-1115.119) (-1115.853) * (-1114.554) [-1118.446] (-1117.191) (-1114.849) -- 0:00:35
      443000 -- (-1115.145) (-1114.554) (-1116.443) [-1114.189] * [-1114.738] (-1117.163) (-1113.898) (-1114.021) -- 0:00:35
      443500 -- (-1113.852) (-1113.549) (-1121.036) [-1114.082] * (-1114.924) (-1121.281) [-1113.951] (-1114.049) -- 0:00:35
      444000 -- (-1116.282) [-1114.545] (-1115.715) (-1117.706) * [-1115.048] (-1114.578) (-1114.604) (-1114.314) -- 0:00:35
      444500 -- (-1114.147) (-1115.678) [-1115.715] (-1114.996) * (-1116.980) [-1113.856] (-1114.841) (-1120.396) -- 0:00:34
      445000 -- (-1117.871) (-1113.371) [-1115.754] (-1115.267) * [-1115.992] (-1117.991) (-1115.604) (-1114.578) -- 0:00:34

      Average standard deviation of split frequencies: 0.010159

      445500 -- (-1115.366) (-1114.277) (-1114.016) [-1115.849] * (-1115.686) (-1116.661) (-1114.505) [-1114.647] -- 0:00:34
      446000 -- (-1116.747) [-1114.561] (-1114.887) (-1114.451) * [-1116.464] (-1116.686) (-1114.557) (-1115.577) -- 0:00:34
      446500 -- (-1114.665) (-1114.650) [-1113.489] (-1115.591) * (-1115.551) (-1115.601) [-1114.518] (-1114.282) -- 0:00:34
      447000 -- (-1115.138) [-1114.748] (-1117.365) (-1115.111) * [-1114.356] (-1117.803) (-1114.907) (-1116.269) -- 0:00:34
      447500 -- (-1116.366) (-1114.602) [-1113.935] (-1114.487) * (-1114.186) (-1117.623) [-1116.478] (-1118.754) -- 0:00:34
      448000 -- (-1117.456) (-1117.270) [-1113.693] (-1116.718) * (-1113.192) [-1115.803] (-1113.993) (-1114.527) -- 0:00:34
      448500 -- (-1114.375) (-1118.340) (-1114.512) [-1118.613] * (-1114.254) (-1115.000) [-1117.508] (-1115.715) -- 0:00:34
      449000 -- [-1114.897] (-1120.045) (-1113.870) (-1115.474) * [-1116.697] (-1116.169) (-1115.629) (-1115.780) -- 0:00:34
      449500 -- (-1118.367) [-1116.398] (-1116.853) (-1115.390) * (-1116.929) [-1115.829] (-1124.073) (-1113.638) -- 0:00:34
      450000 -- (-1118.108) (-1114.415) (-1116.732) [-1115.697] * [-1115.188] (-1116.389) (-1118.585) (-1114.964) -- 0:00:34

      Average standard deviation of split frequencies: 0.009476

      450500 -- (-1116.014) (-1114.918) [-1117.382] (-1115.867) * (-1116.598) (-1120.287) [-1116.886] (-1114.256) -- 0:00:34
      451000 -- (-1119.691) (-1114.763) [-1119.216] (-1117.369) * (-1116.855) [-1114.762] (-1114.824) (-1113.993) -- 0:00:34
      451500 -- (-1129.520) (-1115.830) (-1116.720) [-1116.288] * (-1117.085) (-1114.430) [-1115.034] (-1113.934) -- 0:00:34
      452000 -- (-1119.065) [-1116.756] (-1116.040) (-1115.583) * (-1117.051) (-1114.687) [-1115.922] (-1113.977) -- 0:00:33
      452500 -- [-1116.107] (-1115.138) (-1118.690) (-1122.029) * [-1117.146] (-1114.187) (-1113.773) (-1115.889) -- 0:00:33
      453000 -- (-1117.126) [-1117.568] (-1113.879) (-1119.214) * (-1116.453) (-1115.001) [-1114.350] (-1115.532) -- 0:00:33
      453500 -- (-1116.730) [-1118.479] (-1115.387) (-1119.004) * (-1115.783) [-1114.693] (-1116.077) (-1117.427) -- 0:00:33
      454000 -- (-1113.377) (-1116.003) [-1113.769] (-1118.223) * (-1113.703) [-1114.804] (-1115.023) (-1116.265) -- 0:00:33
      454500 -- (-1115.016) (-1113.697) (-1114.618) [-1114.287] * (-1115.817) (-1114.912) [-1115.110] (-1114.331) -- 0:00:33
      455000 -- (-1114.282) (-1113.696) [-1114.256] (-1117.681) * (-1113.890) (-1115.014) [-1116.145] (-1114.332) -- 0:00:33

      Average standard deviation of split frequencies: 0.009243

      455500 -- [-1115.658] (-1113.552) (-1116.928) (-1115.364) * (-1113.844) (-1114.616) [-1114.536] (-1115.088) -- 0:00:33
      456000 -- (-1116.712) (-1118.647) (-1118.574) [-1119.656] * (-1115.056) (-1114.623) (-1114.450) [-1114.721] -- 0:00:33
      456500 -- (-1115.328) [-1117.272] (-1114.811) (-1115.392) * (-1115.136) [-1115.598] (-1114.683) (-1121.761) -- 0:00:33
      457000 -- (-1116.123) (-1114.282) [-1113.698] (-1115.121) * (-1118.391) (-1114.608) [-1113.648] (-1114.744) -- 0:00:33
      457500 -- (-1116.584) (-1118.431) (-1115.681) [-1114.476] * (-1118.170) (-1118.301) [-1115.391] (-1119.192) -- 0:00:33
      458000 -- [-1115.759] (-1116.643) (-1118.286) (-1116.991) * (-1115.754) (-1116.638) (-1116.004) [-1115.182] -- 0:00:34
      458500 -- [-1114.901] (-1121.414) (-1118.670) (-1114.749) * [-1115.489] (-1115.026) (-1119.178) (-1118.246) -- 0:00:34
      459000 -- [-1115.277] (-1114.306) (-1114.727) (-1114.891) * (-1114.375) [-1114.480] (-1117.554) (-1114.531) -- 0:00:34
      459500 -- (-1115.178) (-1118.808) [-1114.171] (-1114.775) * (-1116.782) (-1114.903) (-1123.032) [-1116.621] -- 0:00:34
      460000 -- (-1116.266) (-1114.714) [-1114.419] (-1115.667) * (-1114.346) (-1115.776) (-1121.092) [-1117.700] -- 0:00:34

      Average standard deviation of split frequencies: 0.009330

      460500 -- (-1116.707) (-1115.673) [-1114.644] (-1114.285) * [-1116.098] (-1117.828) (-1116.569) (-1115.823) -- 0:00:33
      461000 -- (-1114.298) (-1114.932) (-1115.489) [-1114.815] * (-1116.444) (-1119.668) (-1116.566) [-1114.952] -- 0:00:33
      461500 -- (-1115.197) (-1116.988) [-1117.627] (-1116.707) * (-1116.453) (-1117.442) (-1120.708) [-1117.041] -- 0:00:33
      462000 -- (-1116.791) (-1116.061) (-1116.341) [-1116.138] * (-1113.635) (-1114.297) (-1117.838) [-1114.745] -- 0:00:33
      462500 -- [-1118.954] (-1115.267) (-1116.325) (-1115.838) * (-1116.030) (-1115.485) (-1117.738) [-1114.299] -- 0:00:33
      463000 -- (-1116.861) (-1122.544) [-1115.920] (-1114.318) * (-1120.344) (-1114.809) (-1117.432) [-1119.411] -- 0:00:33
      463500 -- (-1119.020) [-1114.912] (-1118.130) (-1116.236) * (-1116.256) (-1115.307) (-1114.954) [-1114.681] -- 0:00:33
      464000 -- (-1116.512) (-1114.098) [-1114.567] (-1117.953) * (-1116.597) (-1114.422) [-1114.933] (-1118.394) -- 0:00:33
      464500 -- (-1114.551) (-1115.574) [-1114.737] (-1114.643) * (-1116.527) (-1117.824) (-1121.580) [-1117.494] -- 0:00:33
      465000 -- (-1116.763) (-1117.305) (-1114.337) [-1115.507] * (-1114.381) (-1115.716) (-1115.179) [-1117.737] -- 0:00:33

      Average standard deviation of split frequencies: 0.009759

      465500 -- (-1117.965) (-1117.596) (-1113.983) [-1114.740] * (-1116.740) (-1113.752) [-1115.303] (-1116.554) -- 0:00:33
      466000 -- [-1115.903] (-1114.917) (-1117.584) (-1122.139) * (-1114.183) [-1116.148] (-1115.195) (-1116.621) -- 0:00:33
      466500 -- [-1119.336] (-1115.396) (-1114.423) (-1118.871) * (-1115.796) (-1116.854) (-1115.670) [-1116.088] -- 0:00:33
      467000 -- [-1116.223] (-1114.777) (-1114.236) (-1121.598) * (-1115.203) (-1118.604) (-1115.598) [-1116.089] -- 0:00:33
      467500 -- (-1114.678) [-1116.693] (-1114.889) (-1116.222) * (-1117.783) (-1118.032) [-1114.589] (-1115.617) -- 0:00:33
      468000 -- [-1115.579] (-1113.922) (-1117.137) (-1116.153) * (-1116.416) (-1115.542) [-1113.820] (-1116.195) -- 0:00:32
      468500 -- (-1118.905) (-1113.575) (-1114.546) [-1115.489] * (-1114.583) [-1114.613] (-1113.393) (-1114.992) -- 0:00:32
      469000 -- [-1114.066] (-1115.029) (-1114.692) (-1120.977) * (-1118.508) (-1116.142) [-1115.519] (-1119.844) -- 0:00:32
      469500 -- (-1115.313) [-1116.058] (-1116.581) (-1116.483) * (-1118.156) (-1114.333) (-1115.344) [-1116.983] -- 0:00:32
      470000 -- (-1115.300) (-1115.475) [-1116.241] (-1117.104) * (-1117.505) [-1115.186] (-1116.321) (-1117.630) -- 0:00:32

      Average standard deviation of split frequencies: 0.010955

      470500 -- (-1113.922) [-1116.684] (-1115.234) (-1113.479) * (-1115.054) (-1114.920) (-1118.906) [-1118.847] -- 0:00:32
      471000 -- (-1115.278) (-1117.866) [-1117.284] (-1118.906) * (-1114.800) [-1119.756] (-1114.979) (-1116.479) -- 0:00:32
      471500 -- (-1115.245) (-1119.214) [-1115.585] (-1119.646) * (-1120.489) (-1116.092) (-1115.445) [-1114.892] -- 0:00:32
      472000 -- (-1115.475) (-1114.734) [-1116.856] (-1114.797) * (-1119.088) (-1115.176) [-1116.121] (-1113.874) -- 0:00:32
      472500 -- (-1115.224) (-1114.898) [-1116.892] (-1118.080) * (-1114.653) (-1114.470) [-1116.858] (-1117.266) -- 0:00:32
      473000 -- (-1115.229) [-1115.282] (-1115.899) (-1114.764) * (-1117.800) (-1114.316) (-1115.717) [-1114.999] -- 0:00:32
      473500 -- (-1116.641) [-1115.690] (-1114.881) (-1115.027) * [-1115.358] (-1114.214) (-1115.928) (-1116.323) -- 0:00:32
      474000 -- (-1116.372) [-1115.261] (-1114.056) (-1116.141) * (-1116.712) (-1116.946) (-1114.773) [-1115.270] -- 0:00:32
      474500 -- (-1114.890) [-1115.305] (-1116.602) (-1117.090) * [-1118.802] (-1114.345) (-1115.458) (-1116.647) -- 0:00:33
      475000 -- [-1113.967] (-1114.867) (-1115.270) (-1119.035) * (-1116.232) (-1114.510) [-1114.451] (-1114.451) -- 0:00:33

      Average standard deviation of split frequencies: 0.010956

      475500 -- [-1113.630] (-1114.867) (-1113.936) (-1115.961) * (-1118.140) (-1115.512) (-1120.322) [-1114.053] -- 0:00:33
      476000 -- (-1115.779) (-1116.725) (-1114.911) [-1115.823] * [-1116.276] (-1116.078) (-1115.341) (-1113.353) -- 0:00:33
      476500 -- (-1116.560) (-1113.747) [-1117.211] (-1116.571) * (-1115.222) (-1114.448) [-1115.117] (-1116.032) -- 0:00:32
      477000 -- (-1113.548) [-1114.406] (-1115.167) (-1115.434) * [-1114.717] (-1115.975) (-1118.728) (-1114.771) -- 0:00:32
      477500 -- (-1115.249) (-1115.380) [-1114.142] (-1114.112) * (-1113.524) [-1115.469] (-1116.640) (-1115.181) -- 0:00:32
      478000 -- (-1113.243) (-1114.246) (-1117.269) [-1113.726] * [-1115.550] (-1117.441) (-1117.088) (-1113.823) -- 0:00:32
      478500 -- (-1113.943) (-1119.853) [-1113.498] (-1114.043) * (-1115.270) [-1114.929] (-1116.117) (-1113.757) -- 0:00:32
      479000 -- (-1117.028) (-1119.307) [-1113.528] (-1114.177) * (-1114.642) (-1113.915) (-1116.534) [-1115.538] -- 0:00:32
      479500 -- (-1119.672) (-1113.959) [-1114.725] (-1115.154) * (-1114.611) (-1115.054) (-1114.617) [-1117.190] -- 0:00:32
      480000 -- (-1115.713) (-1116.487) (-1114.693) [-1114.007] * (-1118.853) [-1118.719] (-1113.867) (-1115.330) -- 0:00:32

      Average standard deviation of split frequencies: 0.010727

      480500 -- [-1115.675] (-1117.301) (-1115.655) (-1117.855) * (-1117.286) [-1113.840] (-1119.210) (-1114.592) -- 0:00:32
      481000 -- (-1115.621) (-1119.745) [-1114.233] (-1115.348) * (-1117.104) (-1114.077) (-1116.362) [-1115.766] -- 0:00:32
      481500 -- [-1114.720] (-1113.875) (-1116.251) (-1115.904) * (-1113.886) [-1113.398] (-1116.847) (-1115.772) -- 0:00:32
      482000 -- [-1119.296] (-1115.598) (-1120.199) (-1115.904) * (-1116.656) [-1114.250] (-1118.138) (-1114.939) -- 0:00:32
      482500 -- (-1115.738) (-1113.177) [-1116.272] (-1117.296) * (-1113.577) (-1114.454) [-1114.630] (-1118.662) -- 0:00:32
      483000 -- (-1115.227) (-1117.911) [-1120.060] (-1116.474) * [-1114.962] (-1114.458) (-1116.287) (-1113.779) -- 0:00:32
      483500 -- (-1115.323) (-1117.484) [-1116.794] (-1114.768) * (-1114.045) (-1116.885) [-1116.782] (-1113.779) -- 0:00:32
      484000 -- (-1117.212) [-1115.066] (-1114.491) (-1116.718) * [-1114.486] (-1118.444) (-1115.638) (-1114.036) -- 0:00:31
      484500 -- (-1121.533) (-1116.814) [-1115.583] (-1118.417) * (-1114.553) (-1116.500) (-1115.301) [-1115.022] -- 0:00:31
      485000 -- (-1123.311) (-1115.675) [-1115.515] (-1115.193) * (-1115.897) [-1114.095] (-1114.316) (-1116.348) -- 0:00:31

      Average standard deviation of split frequencies: 0.010327

      485500 -- (-1118.668) (-1116.909) (-1119.475) [-1115.432] * (-1117.037) [-1113.944] (-1117.974) (-1115.987) -- 0:00:31
      486000 -- (-1117.808) (-1116.572) [-1118.048] (-1115.372) * [-1118.736] (-1118.559) (-1116.610) (-1116.935) -- 0:00:31
      486500 -- (-1116.472) (-1114.988) (-1118.048) [-1114.318] * (-1117.304) (-1114.474) [-1118.188] (-1114.227) -- 0:00:31
      487000 -- (-1119.199) [-1115.563] (-1114.858) (-1114.636) * [-1115.800] (-1116.564) (-1114.386) (-1114.255) -- 0:00:31
      487500 -- [-1117.102] (-1118.628) (-1115.450) (-1114.058) * (-1118.111) (-1114.190) [-1114.380] (-1115.821) -- 0:00:31
      488000 -- (-1118.719) (-1114.131) (-1116.897) [-1115.259] * [-1118.252] (-1114.001) (-1116.107) (-1114.554) -- 0:00:31
      488500 -- (-1115.431) (-1114.910) (-1116.467) [-1115.618] * [-1114.017] (-1115.488) (-1115.826) (-1116.690) -- 0:00:31
      489000 -- (-1113.804) (-1115.290) (-1116.813) [-1114.947] * (-1114.399) (-1117.039) [-1118.200] (-1116.698) -- 0:00:31
      489500 -- (-1114.363) (-1121.212) (-1114.592) [-1116.148] * (-1114.398) [-1117.787] (-1114.598) (-1115.828) -- 0:00:31
      490000 -- [-1113.189] (-1116.911) (-1114.235) (-1115.232) * (-1114.858) (-1117.425) [-1114.838] (-1115.535) -- 0:00:31

      Average standard deviation of split frequencies: 0.011416

      490500 -- (-1116.531) (-1114.380) (-1115.649) [-1116.220] * [-1114.626] (-1122.268) (-1115.830) (-1115.203) -- 0:00:32
      491000 -- [-1116.120] (-1116.386) (-1115.029) (-1115.913) * [-1114.235] (-1118.447) (-1114.415) (-1115.840) -- 0:00:32
      491500 -- (-1119.204) [-1115.464] (-1115.753) (-1114.588) * [-1114.745] (-1117.892) (-1115.360) (-1114.487) -- 0:00:32
      492000 -- [-1115.266] (-1115.484) (-1114.361) (-1114.905) * (-1114.199) [-1116.226] (-1113.667) (-1116.912) -- 0:00:32
      492500 -- (-1117.348) (-1114.171) [-1114.541] (-1115.422) * (-1114.293) (-1116.116) (-1114.813) [-1114.255] -- 0:00:31
      493000 -- [-1117.742] (-1116.514) (-1114.165) (-1117.697) * (-1115.966) [-1116.507] (-1115.810) (-1116.871) -- 0:00:31
      493500 -- (-1118.995) (-1114.772) (-1115.037) [-1114.262] * (-1116.045) (-1113.742) (-1114.353) [-1117.930] -- 0:00:31
      494000 -- (-1117.702) (-1119.500) (-1117.572) [-1114.057] * (-1115.659) (-1114.320) [-1114.038] (-1114.319) -- 0:00:31
      494500 -- (-1117.645) [-1115.762] (-1114.323) (-1114.407) * (-1116.737) (-1117.092) [-1114.422] (-1115.664) -- 0:00:31
      495000 -- [-1113.498] (-1115.965) (-1114.865) (-1115.590) * (-1115.993) (-1114.670) (-1114.455) [-1115.133] -- 0:00:31

      Average standard deviation of split frequencies: 0.011573

      495500 -- [-1113.623] (-1114.617) (-1115.465) (-1114.678) * [-1114.042] (-1115.308) (-1114.682) (-1114.216) -- 0:00:31
      496000 -- (-1115.571) (-1116.911) [-1114.734] (-1113.785) * (-1114.499) (-1115.355) [-1114.590] (-1115.385) -- 0:00:31
      496500 -- (-1115.718) [-1114.953] (-1114.276) (-1114.459) * (-1113.999) [-1115.400] (-1116.236) (-1114.039) -- 0:00:31
      497000 -- (-1116.839) (-1113.649) [-1115.390] (-1116.012) * (-1114.570) (-1119.826) [-1115.709] (-1114.340) -- 0:00:31
      497500 -- (-1120.345) (-1117.022) [-1116.223] (-1114.490) * [-1115.537] (-1122.266) (-1115.675) (-1116.058) -- 0:00:31
      498000 -- (-1118.646) (-1115.507) [-1121.115] (-1114.042) * (-1117.632) (-1116.326) (-1113.796) [-1114.665] -- 0:00:31
      498500 -- (-1114.882) (-1115.001) [-1118.057] (-1114.879) * (-1117.661) (-1116.889) [-1113.690] (-1115.034) -- 0:00:31
      499000 -- [-1115.823] (-1117.814) (-1116.939) (-1118.158) * (-1117.873) [-1113.465] (-1115.224) (-1115.356) -- 0:00:31
      499500 -- [-1116.725] (-1116.685) (-1118.865) (-1114.478) * (-1118.237) [-1116.223] (-1114.830) (-1117.651) -- 0:00:31
      500000 -- (-1116.975) (-1116.586) (-1115.646) [-1117.225] * (-1116.113) (-1118.519) (-1114.251) [-1114.935] -- 0:00:31

      Average standard deviation of split frequencies: 0.010769

      500500 -- [-1117.252] (-1118.615) (-1114.411) (-1117.358) * [-1115.430] (-1118.819) (-1116.794) (-1117.181) -- 0:00:30
      501000 -- (-1115.323) (-1118.262) [-1117.296] (-1115.262) * (-1117.481) (-1118.298) (-1113.864) [-1116.058] -- 0:00:30
      501500 -- (-1114.296) [-1118.389] (-1115.439) (-1119.247) * (-1115.261) (-1119.269) [-1114.531] (-1118.905) -- 0:00:30
      502000 -- [-1114.329] (-1117.819) (-1115.470) (-1116.209) * (-1117.873) (-1115.778) [-1118.411] (-1117.774) -- 0:00:30
      502500 -- [-1114.302] (-1118.449) (-1116.346) (-1114.698) * (-1115.858) (-1115.517) [-1115.857] (-1116.239) -- 0:00:30
      503000 -- (-1116.779) (-1115.171) (-1116.023) [-1115.158] * (-1115.875) [-1115.307] (-1115.429) (-1115.867) -- 0:00:30
      503500 -- [-1116.771] (-1114.463) (-1116.369) (-1118.988) * (-1114.943) (-1116.216) [-1114.602] (-1117.836) -- 0:00:30
      504000 -- (-1113.622) [-1114.762] (-1118.534) (-1116.092) * (-1115.306) (-1116.922) [-1116.046] (-1114.970) -- 0:00:30
      504500 -- (-1116.727) (-1118.301) (-1119.423) [-1114.688] * (-1115.642) (-1115.009) [-1114.920] (-1116.291) -- 0:00:30
      505000 -- [-1114.705] (-1115.041) (-1121.413) (-1116.818) * (-1115.357) (-1115.484) [-1115.551] (-1115.032) -- 0:00:30

      Average standard deviation of split frequencies: 0.010577

      505500 -- [-1115.718] (-1116.973) (-1117.507) (-1116.511) * (-1114.406) [-1117.300] (-1115.459) (-1114.547) -- 0:00:30
      506000 -- (-1116.566) (-1116.246) [-1113.759] (-1115.611) * (-1114.918) (-1115.284) (-1116.722) [-1114.975] -- 0:00:30
      506500 -- (-1114.481) (-1115.886) (-1114.316) [-1115.966] * (-1115.045) [-1120.067] (-1120.430) (-1114.758) -- 0:00:30
      507000 -- [-1115.461] (-1116.238) (-1115.264) (-1115.952) * [-1115.461] (-1117.750) (-1120.131) (-1114.785) -- 0:00:31
      507500 -- [-1114.723] (-1115.571) (-1116.154) (-1113.592) * (-1117.129) [-1116.852] (-1120.199) (-1114.158) -- 0:00:31
      508000 -- (-1120.670) (-1117.464) [-1114.287] (-1114.312) * [-1115.267] (-1119.499) (-1117.844) (-1116.421) -- 0:00:30
      508500 -- [-1113.544] (-1120.661) (-1115.827) (-1113.909) * [-1115.480] (-1114.427) (-1118.443) (-1122.248) -- 0:00:30
      509000 -- (-1114.834) (-1116.965) [-1116.555] (-1113.872) * [-1116.899] (-1118.079) (-1118.204) (-1115.229) -- 0:00:30
      509500 -- [-1114.060] (-1118.381) (-1115.129) (-1115.773) * (-1114.642) (-1118.674) [-1114.085] (-1117.807) -- 0:00:30
      510000 -- (-1114.799) (-1117.236) (-1117.779) [-1114.508] * [-1114.920] (-1115.247) (-1116.528) (-1118.140) -- 0:00:30

      Average standard deviation of split frequencies: 0.010270

      510500 -- [-1115.003] (-1117.288) (-1115.286) (-1116.965) * [-1115.243] (-1116.279) (-1118.550) (-1115.947) -- 0:00:30
      511000 -- (-1115.484) (-1114.871) (-1118.286) [-1115.199] * (-1117.764) [-1117.177] (-1115.193) (-1116.533) -- 0:00:30
      511500 -- (-1116.875) (-1116.021) [-1114.792] (-1115.351) * (-1120.012) (-1117.165) (-1115.115) [-1116.053] -- 0:00:30
      512000 -- (-1118.628) (-1115.022) (-1114.130) [-1115.487] * [-1115.087] (-1115.157) (-1114.878) (-1117.068) -- 0:00:30
      512500 -- (-1117.547) [-1114.383] (-1114.058) (-1115.547) * (-1117.460) (-1116.858) [-1116.479] (-1119.200) -- 0:00:30
      513000 -- [-1117.468] (-1114.244) (-1115.732) (-1121.510) * (-1114.213) (-1117.616) (-1119.255) [-1114.190] -- 0:00:30
      513500 -- [-1118.768] (-1116.321) (-1117.077) (-1121.019) * (-1114.084) (-1117.219) [-1117.582] (-1123.786) -- 0:00:30
      514000 -- (-1115.658) (-1118.752) (-1116.958) [-1117.573] * (-1114.337) [-1116.633] (-1115.704) (-1114.771) -- 0:00:30
      514500 -- (-1115.114) (-1114.703) (-1114.488) [-1114.156] * (-1117.701) (-1115.557) [-1115.895] (-1116.694) -- 0:00:30
      515000 -- [-1114.225] (-1116.442) (-1115.565) (-1115.366) * (-1115.000) [-1116.529] (-1114.644) (-1113.940) -- 0:00:30

      Average standard deviation of split frequencies: 0.008622

      515500 -- (-1114.142) (-1114.077) [-1115.512] (-1116.417) * (-1114.700) (-1115.791) (-1114.461) [-1116.139] -- 0:00:30
      516000 -- (-1117.850) (-1119.658) (-1114.026) [-1114.595] * (-1114.202) (-1124.554) (-1115.710) [-1115.319] -- 0:00:30
      516500 -- (-1117.849) (-1116.624) (-1116.095) [-1115.130] * (-1115.752) (-1119.746) (-1119.392) [-1115.365] -- 0:00:29
      517000 -- [-1116.543] (-1114.981) (-1119.496) (-1116.136) * (-1118.038) [-1115.227] (-1120.408) (-1116.025) -- 0:00:29
      517500 -- (-1115.090) (-1116.299) (-1118.291) [-1115.561] * (-1119.830) (-1117.209) (-1118.201) [-1113.775] -- 0:00:29
      518000 -- (-1116.626) (-1118.408) (-1115.185) [-1116.095] * [-1118.478] (-1114.699) (-1116.617) (-1116.763) -- 0:00:29
      518500 -- [-1118.748] (-1117.349) (-1114.706) (-1115.875) * (-1117.594) [-1114.313] (-1117.765) (-1115.010) -- 0:00:29
      519000 -- (-1116.123) (-1118.998) [-1115.261] (-1116.085) * (-1115.939) [-1114.157] (-1115.920) (-1114.883) -- 0:00:29
      519500 -- (-1115.453) (-1117.231) [-1114.242] (-1115.249) * (-1113.980) (-1113.948) [-1115.903] (-1115.102) -- 0:00:29
      520000 -- (-1115.420) (-1115.072) [-1114.235] (-1117.480) * (-1117.169) (-1114.342) [-1116.069] (-1118.618) -- 0:00:29

      Average standard deviation of split frequencies: 0.009676

      520500 -- (-1121.556) (-1114.714) [-1115.299] (-1117.739) * (-1115.607) (-1114.131) [-1114.958] (-1116.085) -- 0:00:29
      521000 -- [-1113.891] (-1116.458) (-1115.668) (-1117.794) * (-1114.184) (-1115.817) (-1117.020) [-1116.048] -- 0:00:29
      521500 -- (-1115.683) (-1114.495) [-1115.884] (-1116.655) * (-1116.109) [-1113.661] (-1117.462) (-1116.220) -- 0:00:29
      522000 -- (-1113.268) [-1113.649] (-1115.722) (-1114.236) * (-1114.926) (-1113.771) (-1114.963) [-1117.294] -- 0:00:29
      522500 -- (-1114.026) (-1113.969) [-1114.916] (-1114.379) * (-1117.115) [-1115.512] (-1117.592) (-1115.562) -- 0:00:29
      523000 -- (-1114.339) (-1117.812) [-1115.201] (-1117.260) * (-1113.707) [-1116.730] (-1115.681) (-1114.484) -- 0:00:29
      523500 -- (-1115.564) (-1116.855) [-1117.410] (-1116.992) * (-1113.805) [-1114.967] (-1119.042) (-1115.132) -- 0:00:30
      524000 -- (-1119.960) (-1116.079) [-1115.739] (-1118.203) * (-1115.337) [-1118.350] (-1116.433) (-1114.399) -- 0:00:29
      524500 -- [-1114.314] (-1115.660) (-1121.582) (-1114.848) * (-1114.438) [-1116.326] (-1114.280) (-1115.398) -- 0:00:29
      525000