--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:15:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1661/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1008.14 -1011.08
2 -1008.15 -1011.64
--------------------------------------
TOTAL -1008.15 -1011.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000
r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003
r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000
r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008
r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000
r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010
r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002
pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001
pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001
pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000
pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000
alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000
alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000
pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -957.779453
Model 2: PositiveSelection -957.779453
Model 0: one-ratio -957.77997
Model 7: beta -957.779453
Model 8: beta&w>1 -957.77986
Model 0 vs 1 0.001034000000117885
Model 2 vs 1 0.0
Model 8 vs 7 8.139999999912106E-4
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247
C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
**************************************************
C1 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
**************************************************
C1 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
**************************************************
C1 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
**************************************************
C1 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7410]--->[7410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
**************************************************
C1 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
**************************************************
C1 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
**************************************************
C1 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
**************************************************
C1 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C2 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C3 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C4 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C5 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C6 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
**************************************************
C1 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C2 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C3 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C4 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C5 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C6 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
**************************************************
C1 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C2 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C3 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C4 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C5 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C6 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
**************************************************
C1 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C2 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C3 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C4 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C5 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C6 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
**************************************************
C1 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C2 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C3 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C4 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C5 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C6 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
**************************************************
C1 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C2 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C3 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C4 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C5 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C6 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
**************************************************
C1 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C2 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C3 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C4 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C5 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C6 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
**************************************************
C1 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C2 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C3 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C4 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C5 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C6 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
**************************************************
C1 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C2 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C3 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C4 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C5 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C6 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
**************************************************
C1 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C2 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C3 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C4 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C5 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C6 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
**************************************************
C1 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C2 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C3 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C4 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C5 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C6 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
**************************************************
C1 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C2 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C3 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C4 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C5 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C6 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
**************************************************
C1 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C2 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C3 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C4 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C5 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C6 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
**************************************************
C1 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C2 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C3 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C4 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C5 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C6 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
**************************************************
C1 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C2 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C3 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C4 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C5 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C6 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
*****************************************
>C1
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C2
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C3
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C4
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C5
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C6
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 741 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857260
Setting output file names to "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 353694223
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5597914545
Seed = 1215641637
Swapseed = 1579857260
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1658.393524 -- -24.965149
Chain 2 -- -1658.393271 -- -24.965149
Chain 3 -- -1658.393524 -- -24.965149
Chain 4 -- -1658.393524 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1658.393524 -- -24.965149
Chain 2 -- -1658.393524 -- -24.965149
Chain 3 -- -1658.393524 -- -24.965149
Chain 4 -- -1658.393429 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1658.394] (-1658.393) (-1658.394) (-1658.394) * [-1658.394] (-1658.394) (-1658.394) (-1658.393)
500 -- (-1031.861) (-1017.553) (-1025.933) [-1013.843] * (-1022.038) (-1021.999) [-1017.748] (-1027.858) -- 0:00:00
1000 -- (-1019.737) [-1016.194] (-1019.724) (-1012.420) * (-1029.613) (-1017.330) [-1013.435] (-1022.888) -- 0:00:00
1500 -- (-1025.184) (-1022.315) (-1020.040) [-1021.493] * (-1022.802) (-1019.389) [-1016.565] (-1013.781) -- 0:00:00
2000 -- (-1027.832) (-1018.352) (-1024.480) [-1014.107] * (-1015.329) (-1016.346) [-1014.961] (-1010.985) -- 0:00:00
2500 -- (-1018.776) (-1019.959) (-1017.666) [-1017.948] * (-1014.853) (-1013.984) (-1017.008) [-1019.922] -- 0:00:00
3000 -- (-1017.807) (-1025.490) [-1014.280] (-1013.657) * (-1022.261) (-1019.883) (-1016.423) [-1021.552] -- 0:00:00
3500 -- (-1018.671) (-1013.350) (-1020.242) [-1012.357] * (-1028.295) (-1014.668) (-1021.011) [-1020.194] -- 0:00:00
4000 -- (-1020.892) [-1012.713] (-1016.832) (-1015.869) * (-1015.899) [-1016.925] (-1020.170) (-1019.248) -- 0:00:00
4500 -- (-1011.620) [-1018.927] (-1017.010) (-1019.621) * (-1019.297) (-1013.783) (-1016.549) [-1016.172] -- 0:00:00
5000 -- [-1016.318] (-1022.782) (-1026.994) (-1022.346) * (-1023.831) [-1010.181] (-1027.321) (-1014.945) -- 0:00:00
Average standard deviation of split frequencies: 0.097274
5500 -- (-1019.949) (-1021.553) [-1020.528] (-1019.217) * (-1014.935) (-1013.217) [-1020.748] (-1021.085) -- 0:00:00
6000 -- (-1019.063) (-1017.075) [-1014.233] (-1022.006) * (-1019.914) (-1017.922) (-1018.926) [-1013.429] -- 0:00:00
6500 -- (-1025.149) (-1012.710) (-1018.378) [-1017.860] * (-1022.149) [-1017.596] (-1020.942) (-1015.168) -- 0:00:00
7000 -- [-1016.425] (-1022.237) (-1026.932) (-1026.760) * (-1016.963) (-1021.418) (-1019.391) [-1016.441] -- 0:00:00
7500 -- (-1021.756) (-1020.507) (-1024.448) [-1010.243] * (-1013.651) (-1019.309) (-1024.956) [-1028.414] -- 0:00:00
8000 -- (-1018.441) (-1017.572) [-1017.059] (-1017.054) * (-1021.656) (-1024.954) [-1014.236] (-1017.150) -- 0:00:00
8500 -- (-1020.397) [-1020.814] (-1012.471) (-1016.754) * (-1023.180) (-1015.967) [-1016.897] (-1017.890) -- 0:00:00
9000 -- (-1025.020) (-1016.627) [-1012.223] (-1020.792) * (-1026.815) (-1026.963) [-1013.462] (-1021.280) -- 0:00:00
9500 -- (-1016.701) (-1024.922) (-1014.247) [-1013.569] * (-1019.400) (-1015.321) (-1016.743) [-1018.525] -- 0:01:44
10000 -- (-1020.103) (-1020.865) (-1024.254) [-1019.817] * (-1015.924) (-1023.496) (-1013.020) [-1020.605] -- 0:01:39
Average standard deviation of split frequencies: 0.062608
10500 -- (-1015.403) (-1018.021) (-1014.188) [-1015.321] * (-1024.615) [-1016.872] (-1018.019) (-1018.565) -- 0:01:34
11000 -- (-1019.308) (-1019.419) (-1017.915) [-1015.713] * [-1013.412] (-1015.330) (-1023.291) (-1020.454) -- 0:01:29
11500 -- (-1015.677) (-1015.992) (-1015.457) [-1015.048] * (-1015.943) [-1016.058] (-1024.149) (-1018.433) -- 0:01:25
12000 -- (-1025.918) (-1024.227) [-1010.495] (-1021.220) * (-1010.667) [-1019.708] (-1026.373) (-1014.577) -- 0:01:22
12500 -- (-1019.380) (-1020.666) [-1019.156] (-1018.510) * (-1022.868) (-1017.359) [-1023.035] (-1021.873) -- 0:01:19
13000 -- [-1020.284] (-1031.878) (-1019.499) (-1017.966) * (-1024.703) (-1014.961) (-1021.300) [-1013.739] -- 0:01:15
13500 -- (-1013.822) (-1013.497) [-1017.896] (-1019.307) * (-1016.322) (-1020.403) (-1019.432) [-1022.382] -- 0:01:13
14000 -- (-1027.269) (-1014.949) [-1018.670] (-1020.396) * (-1024.602) [-1018.802] (-1015.483) (-1017.588) -- 0:01:10
14500 -- (-1018.774) [-1014.301] (-1023.402) (-1024.182) * [-1015.710] (-1024.996) (-1018.031) (-1020.127) -- 0:01:07
15000 -- (-1014.604) [-1017.488] (-1020.045) (-1017.770) * (-1023.144) [-1015.507] (-1017.007) (-1028.564) -- 0:01:05
Average standard deviation of split frequencies: 0.054274
15500 -- [-1010.958] (-1024.317) (-1026.460) (-1014.537) * (-1017.261) (-1019.779) (-1015.869) [-1010.046] -- 0:01:03
16000 -- (-1021.103) (-1015.456) (-1018.549) [-1017.040] * [-1016.505] (-1024.767) (-1012.719) (-1009.743) -- 0:01:01
16500 -- (-1012.912) (-1014.180) [-1015.243] (-1024.702) * (-1025.080) (-1017.237) (-1017.276) [-1008.671] -- 0:00:59
17000 -- [-1017.222] (-1013.087) (-1021.754) (-1018.880) * (-1020.544) (-1012.055) (-1021.385) [-1007.714] -- 0:00:57
17500 -- (-1017.089) (-1021.846) (-1016.802) [-1016.323] * (-1019.105) [-1019.290] (-1030.213) (-1010.170) -- 0:00:56
18000 -- (-1014.532) (-1018.071) (-1018.617) [-1010.704] * [-1020.211] (-1018.705) (-1019.793) (-1008.401) -- 0:00:54
18500 -- (-1019.106) (-1017.435) (-1011.775) [-1018.658] * [-1013.868] (-1020.951) (-1027.657) (-1008.385) -- 0:00:53
19000 -- (-1017.945) (-1019.031) [-1013.193] (-1021.436) * (-1014.480) (-1020.622) (-1023.178) [-1007.840] -- 0:00:51
19500 -- [-1019.527] (-1017.754) (-1028.765) (-1016.455) * (-1019.604) (-1014.548) (-1012.619) [-1007.981] -- 0:00:50
20000 -- (-1020.527) (-1015.087) (-1024.939) [-1019.945] * [-1013.947] (-1021.395) (-1008.903) (-1010.173) -- 0:00:49
Average standard deviation of split frequencies: 0.051702
20500 -- (-1021.857) [-1016.933] (-1021.689) (-1023.742) * (-1018.680) [-1020.149] (-1007.968) (-1009.291) -- 0:00:47
21000 -- [-1018.744] (-1025.668) (-1020.450) (-1012.751) * (-1026.848) [-1018.905] (-1007.478) (-1008.307) -- 0:00:46
21500 -- (-1025.876) [-1021.314] (-1018.060) (-1018.627) * (-1018.364) (-1015.794) [-1007.978] (-1008.741) -- 0:00:45
22000 -- [-1017.946] (-1022.415) (-1027.012) (-1026.642) * (-1022.658) (-1020.022) (-1012.391) [-1009.357] -- 0:00:44
22500 -- (-1026.391) (-1015.935) (-1017.011) [-1019.717] * (-1019.089) [-1015.796] (-1008.996) (-1010.553) -- 0:00:43
23000 -- (-1024.010) [-1016.029] (-1036.604) (-1015.092) * [-1010.772] (-1012.482) (-1007.775) (-1009.276) -- 0:00:42
23500 -- [-1013.441] (-1021.722) (-1009.163) (-1020.431) * (-1022.763) (-1028.709) [-1013.179] (-1007.053) -- 0:00:41
24000 -- (-1011.740) [-1018.208] (-1013.471) (-1020.758) * (-1017.957) (-1014.711) (-1009.673) [-1009.398] -- 0:00:40
24500 -- (-1010.689) [-1013.584] (-1010.198) (-1016.070) * [-1018.323] (-1010.096) (-1007.505) (-1006.965) -- 0:00:39
25000 -- (-1007.720) [-1019.436] (-1012.522) (-1015.760) * (-1014.766) (-1008.879) (-1008.415) [-1007.321] -- 0:01:18
Average standard deviation of split frequencies: 0.048624
25500 -- (-1007.807) [-1018.732] (-1007.989) (-1026.984) * (-1023.115) (-1008.676) (-1009.225) [-1007.675] -- 0:01:16
26000 -- (-1008.794) [-1017.736] (-1007.661) (-1019.309) * (-1013.203) [-1007.258] (-1008.394) (-1009.794) -- 0:01:14
26500 -- [-1008.742] (-1024.023) (-1007.084) (-1017.714) * [-1016.403] (-1008.653) (-1013.414) (-1007.889) -- 0:01:13
27000 -- [-1010.395] (-1014.579) (-1007.237) (-1015.577) * [-1014.643] (-1009.876) (-1009.148) (-1008.221) -- 0:01:12
27500 -- (-1010.161) [-1014.885] (-1010.075) (-1018.387) * [-1018.831] (-1007.844) (-1008.125) (-1008.018) -- 0:01:10
28000 -- (-1013.767) (-1014.352) (-1007.977) [-1016.860] * (-1022.134) (-1007.460) [-1008.018] (-1008.303) -- 0:01:09
28500 -- (-1014.306) (-1017.202) [-1007.923] (-1019.918) * (-1014.168) [-1008.021] (-1008.858) (-1009.343) -- 0:01:08
29000 -- [-1007.711] (-1017.352) (-1008.924) (-1018.298) * (-1025.199) (-1010.124) (-1011.215) [-1009.822] -- 0:01:06
29500 -- (-1007.236) [-1020.813] (-1009.014) (-1012.674) * (-1011.414) [-1008.238] (-1008.709) (-1009.030) -- 0:01:05
30000 -- (-1008.612) [-1018.921] (-1007.880) (-1013.853) * [-1020.252] (-1008.327) (-1008.092) (-1010.489) -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- [-1007.820] (-1018.489) (-1006.895) (-1013.301) * (-1019.785) (-1008.825) [-1007.672] (-1011.919) -- 0:01:03
31000 -- (-1007.775) (-1014.691) (-1008.654) [-1017.303] * (-1019.908) [-1008.311] (-1007.677) (-1007.668) -- 0:01:02
31500 -- (-1007.030) (-1021.808) [-1010.122] (-1017.594) * (-1033.510) (-1007.396) (-1009.906) [-1008.116] -- 0:01:01
32000 -- (-1006.999) (-1016.170) [-1009.283] (-1021.348) * (-1011.710) [-1007.428] (-1008.239) (-1008.242) -- 0:01:00
32500 -- [-1007.464] (-1019.016) (-1009.671) (-1015.294) * (-1024.891) (-1011.209) (-1008.652) [-1008.291] -- 0:00:59
33000 -- [-1007.936] (-1019.039) (-1008.592) (-1018.387) * [-1009.279] (-1008.746) (-1008.880) (-1007.366) -- 0:00:58
33500 -- (-1007.326) (-1015.007) [-1007.789] (-1026.175) * (-1009.125) (-1010.352) [-1008.839] (-1008.013) -- 0:00:57
34000 -- (-1010.456) (-1018.484) (-1007.983) [-1016.035] * (-1007.602) (-1010.254) (-1007.851) [-1007.538] -- 0:00:56
34500 -- (-1009.524) (-1014.794) [-1008.978] (-1016.914) * [-1007.005] (-1012.338) (-1008.075) (-1010.755) -- 0:00:55
35000 -- (-1011.129) (-1012.454) (-1008.471) [-1014.966] * (-1007.057) (-1010.178) [-1007.068] (-1014.092) -- 0:00:55
Average standard deviation of split frequencies: 0.036166
35500 -- (-1008.582) (-1014.762) (-1006.842) [-1013.330] * (-1011.612) (-1012.033) (-1010.429) [-1012.498] -- 0:00:54
36000 -- (-1009.119) (-1020.794) (-1010.190) [-1014.151] * (-1010.479) (-1010.073) (-1008.260) [-1011.444] -- 0:00:53
36500 -- [-1009.389] (-1016.776) (-1008.112) (-1020.449) * (-1009.109) [-1009.609] (-1009.158) (-1009.507) -- 0:00:52
37000 -- [-1008.039] (-1016.966) (-1009.420) (-1021.153) * (-1008.092) (-1008.065) [-1013.153] (-1008.441) -- 0:00:52
37500 -- [-1007.986] (-1017.007) (-1007.278) (-1008.241) * (-1009.320) (-1010.407) (-1008.650) [-1008.165] -- 0:00:51
38000 -- (-1013.090) (-1031.439) (-1008.838) [-1008.607] * (-1008.512) (-1008.430) (-1009.199) [-1008.309] -- 0:00:50
38500 -- (-1009.041) (-1020.147) (-1009.293) [-1007.971] * (-1007.759) (-1013.058) (-1008.592) [-1007.892] -- 0:00:49
39000 -- [-1009.120] (-1013.157) (-1008.294) (-1010.516) * (-1016.217) (-1011.030) (-1009.028) [-1010.607] -- 0:00:49
39500 -- (-1007.537) (-1020.001) [-1009.410] (-1008.469) * (-1012.653) (-1010.360) (-1016.394) [-1009.112] -- 0:00:48
40000 -- (-1008.241) (-1015.849) [-1008.393] (-1007.361) * [-1007.682] (-1010.764) (-1013.721) (-1007.852) -- 0:00:48
Average standard deviation of split frequencies: 0.032335
40500 -- (-1007.793) (-1017.324) (-1010.521) [-1007.630] * [-1007.057] (-1013.695) (-1015.351) (-1006.821) -- 0:00:47
41000 -- (-1008.990) (-1018.523) [-1007.520] (-1007.784) * (-1008.561) [-1014.687] (-1010.401) (-1007.487) -- 0:01:10
41500 -- [-1009.661] (-1018.412) (-1008.192) (-1008.156) * (-1010.960) [-1014.729] (-1007.480) (-1008.281) -- 0:01:09
42000 -- (-1008.799) (-1013.881) [-1007.278] (-1008.682) * (-1008.297) [-1011.797] (-1007.282) (-1009.304) -- 0:01:08
42500 -- (-1009.935) (-1019.699) (-1008.059) [-1006.888] * (-1007.936) [-1007.876] (-1008.155) (-1010.213) -- 0:01:07
43000 -- (-1014.065) (-1015.868) (-1008.334) [-1009.036] * [-1008.023] (-1007.655) (-1008.176) (-1009.568) -- 0:01:06
43500 -- (-1012.864) (-1014.045) (-1008.727) [-1009.428] * (-1009.412) [-1010.490] (-1007.328) (-1008.204) -- 0:01:05
44000 -- (-1011.761) (-1018.226) (-1007.558) [-1008.133] * (-1009.858) (-1013.945) [-1008.050] (-1007.627) -- 0:01:05
44500 -- [-1011.764] (-1028.974) (-1009.912) (-1009.111) * (-1007.921) [-1010.428] (-1007.685) (-1007.070) -- 0:01:04
45000 -- (-1011.028) (-1017.909) (-1007.306) [-1008.664] * (-1008.277) [-1008.777] (-1008.001) (-1007.629) -- 0:01:03
Average standard deviation of split frequencies: 0.029768
45500 -- (-1011.795) (-1013.680) [-1008.325] (-1008.083) * [-1009.430] (-1009.041) (-1009.963) (-1007.539) -- 0:01:02
46000 -- (-1010.717) (-1020.771) [-1007.567] (-1007.935) * (-1008.118) (-1011.540) (-1010.960) [-1007.622] -- 0:01:02
46500 -- (-1011.656) (-1017.346) (-1008.902) [-1007.354] * (-1007.903) (-1009.582) (-1009.263) [-1008.416] -- 0:01:01
47000 -- (-1009.516) (-1017.957) [-1007.244] (-1009.850) * (-1008.426) (-1011.135) (-1007.953) [-1008.870] -- 0:01:00
47500 -- (-1010.602) (-1020.084) [-1009.138] (-1010.782) * (-1007.913) (-1008.120) (-1009.402) [-1010.933] -- 0:01:00
48000 -- (-1008.736) (-1012.583) [-1009.490] (-1010.458) * (-1007.915) (-1008.762) [-1010.090] (-1008.674) -- 0:00:59
48500 -- (-1009.181) (-1017.381) (-1008.061) [-1009.707] * (-1007.981) (-1012.702) (-1008.544) [-1011.904] -- 0:00:58
49000 -- (-1011.744) (-1024.465) [-1008.165] (-1009.622) * (-1007.340) (-1010.216) (-1010.348) [-1009.288] -- 0:00:58
49500 -- (-1010.135) (-1023.564) (-1008.950) [-1009.538] * (-1010.723) (-1011.836) (-1008.480) [-1008.111] -- 0:00:57
50000 -- [-1011.968] (-1014.907) (-1008.910) (-1012.070) * (-1011.500) (-1009.179) (-1009.057) [-1009.236] -- 0:00:57
Average standard deviation of split frequencies: 0.029463
50500 -- (-1009.355) (-1018.760) (-1008.276) [-1015.263] * (-1008.391) (-1008.172) (-1008.587) [-1008.450] -- 0:00:56
51000 -- [-1010.615] (-1017.342) (-1009.057) (-1010.416) * (-1007.897) (-1008.780) (-1009.734) [-1009.003] -- 0:00:55
51500 -- (-1012.779) [-1016.569] (-1009.495) (-1015.267) * [-1008.344] (-1007.052) (-1009.538) (-1007.583) -- 0:00:55
52000 -- [-1012.241] (-1023.591) (-1010.371) (-1010.332) * (-1008.198) (-1007.392) (-1009.922) [-1009.973] -- 0:00:54
52500 -- (-1009.046) (-1019.673) (-1013.605) [-1010.039] * (-1008.126) (-1010.352) (-1011.275) [-1009.343] -- 0:00:54
53000 -- (-1011.340) [-1016.466] (-1015.856) (-1008.081) * (-1008.255) (-1011.626) [-1008.492] (-1008.043) -- 0:00:53
53500 -- [-1008.144] (-1016.008) (-1010.436) (-1011.396) * (-1009.826) (-1011.891) (-1010.246) [-1010.068] -- 0:00:53
54000 -- (-1009.098) [-1013.735] (-1008.085) (-1012.057) * [-1009.561] (-1011.196) (-1011.862) (-1010.075) -- 0:00:52
54500 -- (-1007.637) (-1014.571) (-1009.180) [-1008.089] * (-1011.423) (-1008.643) (-1012.173) [-1014.235] -- 0:00:52
55000 -- [-1007.753] (-1012.455) (-1009.501) (-1007.983) * (-1008.466) (-1007.097) (-1010.487) [-1009.654] -- 0:00:51
Average standard deviation of split frequencies: 0.030398
55500 -- (-1007.377) (-1020.988) (-1012.481) [-1008.853] * [-1010.613] (-1008.755) (-1011.446) (-1009.289) -- 0:00:51
56000 -- (-1007.379) (-1029.476) (-1012.494) [-1010.693] * (-1008.013) [-1007.773] (-1008.482) (-1008.262) -- 0:00:50
56500 -- (-1009.787) (-1013.576) (-1010.260) [-1008.231] * (-1009.346) [-1008.033] (-1008.043) (-1010.406) -- 0:00:50
57000 -- (-1012.251) (-1020.332) [-1008.849] (-1007.389) * (-1008.638) [-1010.357] (-1009.657) (-1009.561) -- 0:01:06
57500 -- (-1011.361) [-1023.089] (-1011.705) (-1008.944) * (-1011.835) (-1011.213) (-1012.970) [-1009.052] -- 0:01:05
58000 -- (-1009.209) (-1022.272) [-1009.594] (-1008.514) * (-1012.752) (-1009.414) [-1012.525] (-1010.037) -- 0:01:04
58500 -- (-1010.808) [-1021.209] (-1008.380) (-1008.501) * (-1010.184) (-1015.029) (-1014.101) [-1008.686] -- 0:01:04
59000 -- (-1014.705) (-1012.486) [-1011.832] (-1012.586) * (-1008.227) [-1008.301] (-1007.092) (-1011.742) -- 0:01:03
59500 -- (-1009.377) (-1014.303) [-1008.466] (-1012.336) * (-1007.817) (-1007.385) [-1009.039] (-1009.344) -- 0:01:03
60000 -- (-1014.889) (-1018.685) (-1007.783) [-1011.554] * (-1009.028) (-1006.986) [-1010.411] (-1007.928) -- 0:01:02
Average standard deviation of split frequencies: 0.030693
60500 -- (-1008.406) [-1016.411] (-1007.562) (-1009.860) * (-1007.921) (-1008.163) [-1009.640] (-1008.100) -- 0:01:02
61000 -- (-1009.555) (-1025.413) [-1006.982] (-1010.913) * (-1006.648) (-1008.306) (-1011.244) [-1010.163] -- 0:01:01
61500 -- [-1008.694] (-1028.024) (-1007.110) (-1009.370) * (-1008.386) [-1008.073] (-1008.153) (-1011.027) -- 0:01:01
62000 -- (-1008.043) (-1020.295) [-1008.377] (-1007.886) * [-1007.329] (-1007.223) (-1009.635) (-1011.482) -- 0:01:00
62500 -- (-1009.014) (-1007.934) (-1007.437) [-1007.354] * [-1007.563] (-1007.840) (-1011.386) (-1011.765) -- 0:01:00
63000 -- (-1008.445) (-1007.569) (-1008.045) [-1007.002] * [-1008.327] (-1008.461) (-1007.386) (-1007.775) -- 0:00:59
63500 -- (-1009.068) [-1007.770] (-1008.174) (-1006.794) * (-1009.996) [-1007.415] (-1008.224) (-1007.096) -- 0:00:58
64000 -- [-1012.269] (-1010.212) (-1007.812) (-1006.843) * (-1011.213) [-1009.110] (-1006.516) (-1012.797) -- 0:00:58
64500 -- (-1009.227) (-1007.564) (-1007.585) [-1006.766] * (-1009.851) (-1011.846) (-1006.877) [-1009.354] -- 0:00:58
65000 -- (-1010.153) (-1010.704) (-1007.857) [-1007.085] * (-1011.278) [-1011.569] (-1008.787) (-1010.119) -- 0:00:57
Average standard deviation of split frequencies: 0.028570
65500 -- (-1009.567) [-1006.531] (-1007.231) (-1009.485) * (-1012.020) (-1013.356) [-1011.132] (-1008.787) -- 0:00:57
66000 -- (-1012.449) [-1006.744] (-1007.232) (-1006.757) * (-1009.584) (-1009.839) [-1007.019] (-1011.897) -- 0:00:56
66500 -- [-1007.432] (-1008.389) (-1007.053) (-1007.468) * [-1011.861] (-1012.311) (-1008.935) (-1009.774) -- 0:00:56
67000 -- (-1008.471) [-1009.037] (-1006.697) (-1006.931) * (-1012.236) (-1013.866) (-1007.257) [-1010.155] -- 0:00:55
67500 -- (-1008.456) (-1013.728) [-1006.786] (-1015.025) * (-1012.388) (-1010.411) [-1007.777] (-1008.981) -- 0:00:55
68000 -- [-1009.447] (-1007.013) (-1008.781) (-1009.344) * (-1007.432) (-1009.412) [-1008.392] (-1006.951) -- 0:00:54
68500 -- [-1006.908] (-1007.827) (-1007.899) (-1009.623) * (-1010.383) (-1007.537) [-1008.001] (-1010.566) -- 0:00:54
69000 -- (-1009.024) (-1010.421) [-1007.372] (-1009.056) * (-1009.564) [-1007.327] (-1007.342) (-1009.211) -- 0:00:53
69500 -- [-1008.668] (-1008.026) (-1011.226) (-1009.195) * (-1012.202) (-1009.316) [-1007.376] (-1009.444) -- 0:00:53
70000 -- (-1012.286) (-1007.132) [-1010.128] (-1007.293) * (-1015.857) (-1008.862) (-1008.281) [-1007.293] -- 0:00:53
Average standard deviation of split frequencies: 0.025683
70500 -- (-1013.131) (-1008.683) (-1010.409) [-1010.735] * (-1007.879) (-1008.523) [-1007.821] (-1007.685) -- 0:00:52
71000 -- (-1009.706) (-1008.290) [-1009.712] (-1009.849) * (-1010.094) (-1008.831) (-1007.489) [-1007.823] -- 0:00:52
71500 -- (-1011.546) [-1008.288] (-1008.643) (-1012.118) * (-1009.863) [-1010.265] (-1008.203) (-1008.102) -- 0:00:51
72000 -- [-1011.026] (-1007.975) (-1012.981) (-1010.269) * (-1010.435) (-1012.016) (-1008.672) [-1009.435] -- 0:00:51
72500 -- [-1007.965] (-1011.651) (-1008.496) (-1009.713) * (-1008.319) (-1012.171) (-1006.826) [-1009.292] -- 0:00:51
73000 -- (-1008.193) (-1008.991) (-1008.981) [-1008.234] * (-1007.590) [-1011.642] (-1009.868) (-1008.556) -- 0:00:50
73500 -- (-1007.505) (-1011.028) (-1007.500) [-1007.251] * (-1009.628) [-1009.991] (-1008.596) (-1009.872) -- 0:01:03
74000 -- (-1010.656) (-1008.774) [-1007.529] (-1006.721) * (-1012.622) (-1007.577) (-1007.879) [-1008.940] -- 0:01:02
74500 -- (-1011.011) (-1008.706) [-1008.451] (-1007.429) * [-1008.279] (-1007.451) (-1016.922) (-1010.029) -- 0:01:02
75000 -- [-1008.174] (-1006.860) (-1009.260) (-1007.563) * (-1008.056) [-1008.121] (-1015.839) (-1010.811) -- 0:01:01
Average standard deviation of split frequencies: 0.026770
75500 -- [-1011.326] (-1006.990) (-1008.726) (-1007.996) * [-1008.230] (-1007.653) (-1014.426) (-1013.309) -- 0:01:01
76000 -- (-1010.740) (-1008.020) (-1009.229) [-1014.613] * (-1009.136) (-1006.941) (-1009.508) [-1011.320] -- 0:01:00
76500 -- (-1009.113) (-1009.877) [-1008.090] (-1010.186) * (-1010.087) [-1007.896] (-1010.385) (-1010.259) -- 0:01:00
77000 -- (-1009.699) [-1007.104] (-1008.538) (-1012.082) * (-1010.119) (-1010.827) [-1010.940] (-1009.450) -- 0:00:59
77500 -- (-1008.250) [-1007.653] (-1009.802) (-1012.326) * [-1010.830] (-1010.563) (-1009.259) (-1008.878) -- 0:00:59
78000 -- [-1009.437] (-1008.295) (-1008.007) (-1009.477) * (-1010.040) [-1008.881] (-1010.415) (-1008.966) -- 0:00:59
78500 -- (-1011.169) (-1008.754) (-1007.592) [-1010.547] * [-1010.697] (-1015.029) (-1010.332) (-1010.778) -- 0:00:58
79000 -- [-1009.973] (-1009.827) (-1011.801) (-1009.543) * (-1008.748) (-1012.013) [-1012.330] (-1008.777) -- 0:00:58
79500 -- (-1015.240) [-1008.107] (-1008.511) (-1010.768) * (-1008.205) [-1006.799] (-1010.311) (-1011.402) -- 0:00:57
80000 -- (-1011.445) [-1008.534] (-1010.073) (-1015.462) * [-1008.103] (-1007.017) (-1011.868) (-1011.468) -- 0:00:57
Average standard deviation of split frequencies: 0.024674
80500 -- (-1010.644) (-1008.179) [-1007.204] (-1010.602) * (-1008.648) (-1008.084) [-1007.625] (-1010.084) -- 0:00:57
81000 -- [-1006.858] (-1007.809) (-1009.132) (-1017.190) * (-1011.060) (-1007.267) (-1010.677) [-1008.580] -- 0:00:56
81500 -- (-1008.807) (-1008.335) [-1007.647] (-1011.137) * [-1010.591] (-1009.321) (-1010.333) (-1010.241) -- 0:00:56
82000 -- [-1008.327] (-1011.389) (-1009.810) (-1009.913) * [-1007.420] (-1007.414) (-1008.753) (-1014.382) -- 0:00:55
82500 -- (-1008.326) (-1012.604) [-1009.248] (-1008.273) * [-1009.012] (-1012.665) (-1007.946) (-1009.925) -- 0:00:55
83000 -- (-1006.594) (-1008.334) (-1008.110) [-1007.857] * (-1008.166) [-1008.312] (-1007.334) (-1008.324) -- 0:00:55
83500 -- [-1006.646] (-1009.793) (-1008.669) (-1007.761) * (-1013.957) [-1007.879] (-1008.170) (-1010.916) -- 0:00:54
84000 -- (-1006.915) (-1009.118) (-1011.340) [-1009.170] * (-1009.418) (-1009.627) [-1010.797] (-1011.310) -- 0:00:54
84500 -- (-1006.688) [-1007.130] (-1011.616) (-1009.762) * (-1010.333) (-1009.285) [-1010.058] (-1010.030) -- 0:00:54
85000 -- (-1008.264) (-1007.028) (-1009.215) [-1009.371] * [-1009.637] (-1011.098) (-1010.890) (-1008.712) -- 0:00:53
Average standard deviation of split frequencies: 0.023753
85500 -- (-1007.526) [-1007.896] (-1007.873) (-1010.550) * (-1008.672) (-1007.455) [-1008.496] (-1013.071) -- 0:00:53
86000 -- (-1008.242) (-1011.145) [-1008.302] (-1006.531) * [-1009.794] (-1011.661) (-1006.770) (-1011.536) -- 0:00:53
86500 -- (-1010.021) (-1013.695) [-1007.902] (-1006.479) * [-1008.772] (-1009.254) (-1008.902) (-1008.548) -- 0:00:52
87000 -- (-1008.281) (-1010.391) [-1008.226] (-1006.572) * (-1009.754) (-1012.946) (-1013.637) [-1007.580] -- 0:00:52
87500 -- (-1008.746) (-1009.925) [-1008.288] (-1008.286) * (-1007.840) (-1011.012) [-1010.803] (-1009.300) -- 0:00:52
88000 -- [-1008.160] (-1008.909) (-1010.438) (-1009.926) * [-1009.194] (-1008.837) (-1012.833) (-1008.410) -- 0:00:51
88500 -- (-1008.185) (-1008.489) [-1010.419] (-1006.913) * [-1009.260] (-1008.309) (-1009.912) (-1008.367) -- 0:00:51
89000 -- (-1007.022) [-1008.035] (-1007.081) (-1013.393) * (-1011.073) (-1010.266) [-1012.633] (-1007.157) -- 0:00:51
89500 -- (-1007.204) (-1007.684) [-1009.408] (-1007.946) * (-1010.390) (-1009.578) (-1016.191) [-1006.670] -- 0:00:50
90000 -- [-1008.441] (-1008.623) (-1007.163) (-1008.987) * (-1009.209) (-1010.244) (-1010.563) [-1007.211] -- 0:01:00
Average standard deviation of split frequencies: 0.027441
90500 -- (-1012.771) (-1008.340) (-1009.106) [-1007.660] * (-1007.202) (-1008.456) (-1013.185) [-1006.859] -- 0:01:00
91000 -- [-1008.543] (-1008.060) (-1007.792) (-1008.009) * (-1011.268) (-1006.567) [-1010.964] (-1006.995) -- 0:00:59
91500 -- (-1009.283) (-1008.060) [-1008.660] (-1007.896) * (-1008.629) (-1007.307) (-1009.500) [-1007.451] -- 0:00:59
92000 -- (-1006.813) (-1008.305) [-1006.959] (-1013.293) * (-1010.481) [-1008.642] (-1009.584) (-1007.190) -- 0:00:59
92500 -- [-1006.733] (-1009.166) (-1009.649) (-1011.744) * (-1008.453) [-1008.457] (-1010.294) (-1007.776) -- 0:00:58
93000 -- [-1007.900] (-1007.728) (-1007.988) (-1008.152) * [-1008.019] (-1008.415) (-1011.456) (-1008.867) -- 0:00:58
93500 -- [-1007.774] (-1008.949) (-1011.414) (-1008.838) * (-1008.033) [-1007.495] (-1011.604) (-1011.475) -- 0:00:58
94000 -- (-1009.858) [-1007.444] (-1012.298) (-1009.691) * (-1008.640) [-1008.982] (-1010.621) (-1012.436) -- 0:00:57
94500 -- [-1008.221] (-1009.432) (-1008.192) (-1012.943) * (-1008.256) [-1007.579] (-1011.199) (-1011.872) -- 0:00:57
95000 -- (-1009.124) (-1012.234) [-1010.429] (-1013.893) * [-1009.769] (-1009.157) (-1010.272) (-1010.170) -- 0:00:57
Average standard deviation of split frequencies: 0.026574
95500 -- (-1009.114) [-1009.416] (-1009.856) (-1011.850) * (-1007.881) [-1008.500] (-1009.759) (-1010.337) -- 0:00:56
96000 -- (-1007.821) (-1009.334) [-1007.469] (-1013.932) * (-1008.501) (-1008.046) (-1008.645) [-1009.841] -- 0:00:56
96500 -- [-1007.827] (-1009.579) (-1007.858) (-1013.302) * (-1007.627) [-1007.884] (-1008.753) (-1013.647) -- 0:00:56
97000 -- (-1008.244) [-1008.582] (-1012.557) (-1012.915) * (-1007.679) (-1008.134) (-1009.149) [-1010.643] -- 0:00:55
97500 -- (-1006.840) [-1007.862] (-1011.093) (-1010.702) * (-1010.180) [-1009.010] (-1010.120) (-1009.362) -- 0:00:55
98000 -- (-1007.501) (-1012.188) [-1008.476] (-1012.045) * (-1009.794) [-1008.820] (-1008.347) (-1008.949) -- 0:00:55
98500 -- [-1008.433] (-1007.598) (-1008.306) (-1009.806) * [-1007.444] (-1008.585) (-1008.748) (-1008.318) -- 0:00:54
99000 -- (-1012.716) (-1009.320) (-1008.762) [-1010.197] * (-1011.883) (-1007.661) (-1009.489) [-1009.304] -- 0:00:54
99500 -- [-1009.261] (-1009.376) (-1008.133) (-1011.514) * (-1009.440) (-1009.188) (-1006.798) [-1010.489] -- 0:00:54
100000 -- (-1007.686) (-1013.489) [-1007.448] (-1011.897) * [-1007.098] (-1010.221) (-1007.674) (-1010.750) -- 0:00:54
Average standard deviation of split frequencies: 0.027577
100500 -- [-1009.561] (-1009.157) (-1012.562) (-1009.425) * (-1007.596) (-1007.300) (-1006.962) [-1008.937] -- 0:00:53
101000 -- (-1007.405) (-1008.338) [-1007.745] (-1011.669) * [-1007.812] (-1008.678) (-1009.782) (-1011.380) -- 0:00:53
101500 -- [-1007.877] (-1010.991) (-1010.121) (-1009.676) * (-1007.518) [-1007.992] (-1008.536) (-1010.545) -- 0:00:53
102000 -- (-1009.923) [-1009.729] (-1013.381) (-1011.123) * (-1008.247) [-1009.697] (-1008.900) (-1010.285) -- 0:00:52
102500 -- [-1009.664] (-1011.074) (-1009.662) (-1009.370) * (-1009.051) (-1007.897) [-1008.090] (-1009.392) -- 0:00:52
103000 -- (-1011.038) [-1007.960] (-1009.229) (-1008.370) * (-1006.886) (-1007.803) [-1007.171] (-1008.557) -- 0:00:52
103500 -- (-1011.068) (-1008.298) [-1010.588] (-1010.219) * (-1007.935) [-1007.590] (-1007.261) (-1009.668) -- 0:00:51
104000 -- (-1010.661) (-1009.948) (-1008.087) [-1008.028] * (-1007.382) [-1009.080] (-1007.767) (-1017.825) -- 0:00:51
104500 -- (-1007.637) [-1007.156] (-1007.549) (-1008.848) * (-1008.041) (-1010.706) [-1007.069] (-1013.503) -- 0:00:51
105000 -- (-1009.085) [-1008.599] (-1008.118) (-1009.743) * (-1008.835) (-1007.836) (-1007.338) [-1008.907] -- 0:00:51
Average standard deviation of split frequencies: 0.026449
105500 -- (-1007.560) [-1008.579] (-1007.514) (-1010.331) * [-1008.453] (-1012.244) (-1008.384) (-1009.269) -- 0:00:50
106000 -- (-1009.129) [-1008.949] (-1010.510) (-1011.308) * [-1010.887] (-1010.586) (-1009.081) (-1008.882) -- 0:00:59
106500 -- (-1008.370) (-1008.029) (-1011.708) [-1011.997] * (-1009.422) [-1009.820] (-1008.038) (-1010.081) -- 0:00:58
107000 -- (-1009.140) [-1007.595] (-1009.394) (-1010.515) * [-1009.047] (-1008.268) (-1010.039) (-1007.952) -- 0:00:58
107500 -- [-1007.798] (-1011.475) (-1013.575) (-1008.206) * (-1009.949) (-1008.450) [-1009.172] (-1009.854) -- 0:00:58
108000 -- (-1006.688) (-1011.964) (-1007.489) [-1008.588] * (-1009.612) (-1006.608) (-1011.224) [-1009.578] -- 0:00:57
108500 -- [-1006.597] (-1011.770) (-1008.170) (-1008.528) * (-1007.967) [-1009.252] (-1011.313) (-1011.162) -- 0:00:57
109000 -- (-1008.892) (-1009.420) [-1009.181] (-1011.480) * [-1011.416] (-1009.740) (-1007.832) (-1010.015) -- 0:00:57
109500 -- (-1008.698) [-1010.611] (-1010.036) (-1009.200) * [-1008.985] (-1012.460) (-1010.329) (-1009.807) -- 0:00:56
110000 -- [-1009.920] (-1008.501) (-1009.734) (-1009.631) * (-1011.043) [-1008.986] (-1013.439) (-1010.651) -- 0:00:56
Average standard deviation of split frequencies: 0.026679
110500 -- (-1015.006) (-1009.085) (-1012.632) [-1009.288] * (-1009.361) [-1010.175] (-1008.978) (-1013.596) -- 0:00:56
111000 -- [-1009.427] (-1009.814) (-1014.859) (-1009.878) * (-1008.386) (-1010.121) [-1009.883] (-1008.204) -- 0:00:56
111500 -- (-1007.574) (-1007.964) (-1009.353) [-1007.368] * (-1011.186) [-1007.115] (-1009.014) (-1008.210) -- 0:00:55
112000 -- [-1008.145] (-1007.557) (-1009.838) (-1007.196) * [-1012.053] (-1009.621) (-1012.566) (-1009.299) -- 0:00:55
112500 -- (-1013.362) (-1006.821) [-1007.917] (-1009.941) * (-1010.086) [-1006.961] (-1008.470) (-1008.775) -- 0:00:55
113000 -- (-1008.187) (-1011.496) [-1007.010] (-1017.727) * (-1010.106) (-1009.642) [-1007.875] (-1010.428) -- 0:00:54
113500 -- (-1007.694) [-1008.369] (-1011.110) (-1009.052) * (-1009.903) [-1010.363] (-1012.597) (-1009.896) -- 0:00:54
114000 -- (-1012.451) (-1010.047) [-1008.293] (-1009.519) * (-1008.425) [-1008.296] (-1014.030) (-1008.827) -- 0:00:54
114500 -- [-1007.534] (-1008.147) (-1008.409) (-1010.956) * (-1006.983) [-1007.040] (-1008.065) (-1010.306) -- 0:00:54
115000 -- [-1008.927] (-1008.600) (-1011.657) (-1007.899) * (-1006.972) [-1008.645] (-1010.201) (-1014.028) -- 0:00:53
Average standard deviation of split frequencies: 0.025060
115500 -- (-1010.375) (-1009.475) (-1008.111) [-1009.560] * [-1007.288] (-1010.337) (-1009.163) (-1009.327) -- 0:00:53
116000 -- (-1011.109) [-1009.067] (-1009.523) (-1009.741) * (-1007.661) (-1007.708) (-1008.270) [-1007.676] -- 0:00:53
116500 -- (-1011.840) (-1010.294) [-1010.253] (-1010.143) * (-1007.360) (-1007.951) [-1007.400] (-1008.334) -- 0:00:53
117000 -- (-1008.808) (-1010.350) [-1008.474] (-1010.437) * [-1009.597] (-1008.131) (-1009.515) (-1010.897) -- 0:00:52
117500 -- [-1008.301] (-1007.420) (-1009.756) (-1008.469) * [-1006.858] (-1008.407) (-1008.845) (-1010.810) -- 0:00:52
118000 -- (-1008.442) [-1007.465] (-1008.271) (-1010.894) * (-1007.416) (-1011.267) (-1009.288) [-1009.093] -- 0:00:52
118500 -- (-1013.316) (-1007.867) [-1009.770] (-1009.731) * [-1007.606] (-1014.559) (-1008.909) (-1008.156) -- 0:00:52
119000 -- (-1010.251) (-1009.754) (-1010.274) [-1009.968] * (-1011.344) (-1007.902) [-1009.298] (-1010.460) -- 0:00:51
119500 -- (-1009.011) [-1012.318] (-1010.112) (-1011.747) * (-1012.366) (-1006.690) [-1007.211] (-1007.754) -- 0:00:51
120000 -- (-1008.607) (-1010.262) [-1007.895] (-1008.783) * [-1009.629] (-1008.330) (-1008.253) (-1011.242) -- 0:00:51
Average standard deviation of split frequencies: 0.023440
120500 -- (-1008.481) (-1009.832) [-1007.329] (-1008.889) * [-1007.911] (-1008.531) (-1011.318) (-1006.957) -- 0:00:51
121000 -- [-1008.964] (-1011.362) (-1006.541) (-1009.188) * (-1010.618) (-1007.727) [-1008.028] (-1009.402) -- 0:00:50
121500 -- (-1007.631) (-1009.584) [-1006.821] (-1009.557) * (-1008.768) (-1012.600) [-1009.764] (-1008.088) -- 0:00:50
122000 -- (-1009.111) (-1008.058) (-1007.364) [-1009.924] * (-1008.607) [-1014.618] (-1010.185) (-1007.862) -- 0:00:57
122500 -- (-1012.031) [-1009.219] (-1008.673) (-1008.569) * (-1008.866) (-1013.112) (-1013.347) [-1007.798] -- 0:00:57
123000 -- (-1010.187) [-1010.511] (-1008.781) (-1008.517) * (-1009.262) (-1008.887) (-1013.581) [-1008.118] -- 0:00:57
123500 -- (-1009.830) (-1010.851) [-1007.557] (-1009.430) * (-1008.766) [-1008.462] (-1011.068) (-1010.178) -- 0:00:56
124000 -- (-1010.052) (-1009.533) [-1008.282] (-1010.351) * [-1009.720] (-1008.638) (-1010.652) (-1007.632) -- 0:00:56
124500 -- (-1011.308) [-1007.431] (-1009.102) (-1013.049) * [-1012.685] (-1009.544) (-1007.395) (-1007.327) -- 0:00:56
125000 -- (-1012.605) (-1009.171) (-1010.295) [-1007.366] * (-1009.924) (-1012.014) (-1010.263) [-1008.571] -- 0:00:56
Average standard deviation of split frequencies: 0.023768
125500 -- (-1009.114) [-1008.114] (-1007.761) (-1009.964) * (-1008.825) (-1016.345) (-1009.553) [-1008.150] -- 0:00:55
126000 -- [-1008.817] (-1007.728) (-1012.274) (-1010.247) * (-1011.249) [-1008.561] (-1008.745) (-1006.862) -- 0:00:55
126500 -- (-1011.093) (-1006.916) [-1011.096] (-1009.608) * (-1008.616) (-1006.994) [-1008.968] (-1012.489) -- 0:00:55
127000 -- [-1008.915] (-1008.405) (-1009.744) (-1008.441) * (-1011.148) [-1008.398] (-1007.247) (-1013.799) -- 0:00:54
127500 -- (-1008.915) [-1008.374] (-1009.341) (-1010.967) * [-1008.582] (-1008.865) (-1007.276) (-1008.945) -- 0:00:54
128000 -- (-1007.484) [-1009.129] (-1007.385) (-1010.113) * (-1010.280) (-1007.695) [-1011.031] (-1007.396) -- 0:00:54
128500 -- [-1010.335] (-1007.534) (-1008.228) (-1009.900) * [-1007.306] (-1007.532) (-1017.832) (-1007.832) -- 0:00:54
129000 -- [-1008.834] (-1007.921) (-1008.660) (-1010.040) * (-1007.357) (-1008.484) (-1009.260) [-1009.440] -- 0:00:54
129500 -- (-1006.947) [-1007.471] (-1009.484) (-1013.317) * (-1016.228) (-1007.751) [-1007.217] (-1010.453) -- 0:00:53
130000 -- (-1007.120) (-1012.910) (-1008.425) [-1009.944] * (-1009.918) (-1008.472) [-1007.897] (-1010.315) -- 0:00:53
Average standard deviation of split frequencies: 0.026739
130500 -- (-1007.163) (-1009.919) (-1008.090) [-1011.010] * [-1008.463] (-1008.532) (-1008.606) (-1006.848) -- 0:00:53
131000 -- (-1007.306) (-1012.934) (-1008.079) [-1008.445] * [-1008.402] (-1008.723) (-1009.275) (-1006.889) -- 0:00:53
131500 -- (-1011.652) (-1010.048) (-1013.277) [-1007.715] * (-1008.342) [-1011.013] (-1007.056) (-1006.697) -- 0:00:52
132000 -- (-1008.686) (-1009.064) (-1009.380) [-1008.394] * (-1008.471) (-1010.426) (-1009.059) [-1011.063] -- 0:00:52
132500 -- (-1013.745) (-1013.455) (-1009.372) [-1008.514] * (-1008.174) (-1009.359) (-1007.509) [-1009.991] -- 0:00:52
133000 -- (-1011.538) [-1014.810] (-1009.175) (-1007.682) * [-1008.317] (-1008.110) (-1006.943) (-1008.323) -- 0:00:52
133500 -- (-1008.739) (-1011.990) (-1009.467) [-1006.714] * [-1007.989] (-1009.923) (-1007.465) (-1008.196) -- 0:00:51
134000 -- [-1007.216] (-1008.935) (-1013.677) (-1007.260) * (-1007.586) [-1007.781] (-1008.635) (-1008.865) -- 0:00:51
134500 -- (-1009.826) [-1007.816] (-1009.164) (-1007.747) * (-1007.899) [-1009.027] (-1009.358) (-1007.000) -- 0:00:51
135000 -- [-1010.356] (-1008.554) (-1008.991) (-1008.062) * (-1011.437) (-1009.451) (-1009.956) [-1011.372] -- 0:00:51
Average standard deviation of split frequencies: 0.025804
135500 -- (-1009.925) (-1009.226) [-1010.163] (-1008.319) * (-1008.492) (-1007.261) [-1014.103] (-1010.828) -- 0:00:51
136000 -- [-1008.998] (-1006.809) (-1011.450) (-1010.733) * (-1010.004) [-1010.217] (-1008.429) (-1009.350) -- 0:00:50
136500 -- [-1009.812] (-1008.436) (-1012.922) (-1008.827) * [-1008.801] (-1007.986) (-1010.086) (-1008.589) -- 0:00:50
137000 -- [-1008.313] (-1009.044) (-1009.781) (-1009.949) * (-1009.097) (-1007.489) (-1007.557) [-1009.498] -- 0:00:50
137500 -- (-1009.533) (-1008.778) (-1009.473) [-1009.624] * [-1008.195] (-1006.994) (-1012.875) (-1008.110) -- 0:00:50
138000 -- (-1011.113) (-1009.211) (-1009.708) [-1010.755] * [-1007.124] (-1009.397) (-1008.226) (-1007.830) -- 0:00:49
138500 -- (-1013.520) (-1007.889) [-1007.791] (-1010.390) * [-1007.609] (-1009.472) (-1008.348) (-1009.558) -- 0:00:55
139000 -- (-1008.016) [-1009.262] (-1010.246) (-1008.645) * (-1007.711) [-1008.086] (-1010.750) (-1008.610) -- 0:00:55
139500 -- (-1008.388) (-1012.313) (-1008.381) [-1007.101] * (-1010.615) [-1010.760] (-1010.531) (-1007.459) -- 0:00:55
140000 -- [-1007.911] (-1007.417) (-1009.817) (-1011.620) * (-1011.327) (-1007.975) (-1008.740) [-1007.530] -- 0:00:55
Average standard deviation of split frequencies: 0.024948
140500 -- (-1007.886) [-1010.495] (-1008.365) (-1006.900) * (-1009.962) [-1007.339] (-1008.365) (-1007.023) -- 0:00:55
141000 -- (-1007.791) (-1008.381) (-1007.149) [-1010.479] * (-1008.825) (-1007.715) [-1009.376] (-1007.091) -- 0:00:54
141500 -- (-1010.541) [-1008.635] (-1007.852) (-1008.381) * (-1013.551) [-1009.151] (-1008.039) (-1007.788) -- 0:00:54
142000 -- (-1007.903) (-1007.633) (-1007.893) [-1007.288] * (-1013.250) (-1009.395) (-1009.571) [-1007.286] -- 0:00:54
142500 -- (-1010.208) (-1008.777) [-1006.866] (-1011.276) * (-1010.369) (-1009.627) [-1011.366] (-1009.222) -- 0:00:54
143000 -- (-1012.933) (-1007.252) [-1007.323] (-1009.927) * (-1014.645) (-1010.026) [-1009.233] (-1009.774) -- 0:00:53
143500 -- [-1007.038] (-1013.093) (-1007.797) (-1008.495) * [-1011.520] (-1013.279) (-1009.984) (-1010.417) -- 0:00:53
144000 -- (-1008.057) (-1007.242) [-1007.795] (-1009.879) * (-1008.619) [-1008.603] (-1008.707) (-1011.401) -- 0:00:53
144500 -- [-1007.568] (-1010.721) (-1008.399) (-1008.671) * (-1012.050) (-1006.969) [-1010.465] (-1010.633) -- 0:00:53
145000 -- (-1008.998) [-1009.347] (-1010.775) (-1009.161) * (-1012.809) (-1007.750) (-1009.356) [-1010.604] -- 0:00:53
Average standard deviation of split frequencies: 0.022763
145500 -- [-1009.544] (-1007.718) (-1012.414) (-1008.670) * (-1017.514) [-1008.302] (-1010.846) (-1009.708) -- 0:00:52
146000 -- (-1010.847) [-1011.134] (-1012.812) (-1010.416) * [-1007.547] (-1007.350) (-1013.554) (-1010.282) -- 0:00:52
146500 -- (-1009.369) (-1009.234) (-1010.898) [-1009.396] * (-1006.898) [-1007.784] (-1011.718) (-1008.251) -- 0:00:52
147000 -- (-1007.076) (-1007.724) (-1009.399) [-1008.724] * [-1007.633] (-1013.441) (-1008.496) (-1008.951) -- 0:00:52
147500 -- (-1007.368) [-1008.052] (-1007.451) (-1006.670) * [-1007.851] (-1015.917) (-1008.254) (-1008.499) -- 0:00:52
148000 -- [-1007.748] (-1012.942) (-1012.560) (-1008.002) * [-1008.403] (-1008.552) (-1008.495) (-1008.134) -- 0:00:51
148500 -- (-1008.873) (-1009.800) [-1007.773] (-1010.245) * (-1008.768) (-1011.996) [-1009.042] (-1007.716) -- 0:00:51
149000 -- (-1008.669) [-1008.752] (-1008.240) (-1010.358) * [-1007.423] (-1006.825) (-1008.241) (-1009.383) -- 0:00:51
149500 -- [-1006.734] (-1009.498) (-1010.314) (-1013.786) * (-1010.193) (-1007.314) [-1009.958] (-1011.908) -- 0:00:51
150000 -- (-1007.933) (-1010.991) [-1009.715] (-1007.564) * [-1008.510] (-1007.811) (-1012.618) (-1008.354) -- 0:00:51
Average standard deviation of split frequencies: 0.022058
150500 -- (-1009.760) (-1015.466) [-1009.450] (-1006.945) * (-1007.653) (-1007.888) [-1010.152] (-1008.299) -- 0:00:50
151000 -- (-1008.361) (-1009.565) [-1009.567] (-1007.319) * (-1008.896) (-1008.102) [-1010.885] (-1008.417) -- 0:00:50
151500 -- (-1007.988) [-1008.396] (-1009.169) (-1007.316) * (-1010.477) [-1007.206] (-1008.423) (-1007.935) -- 0:00:50
152000 -- (-1008.134) (-1008.115) (-1010.572) [-1008.749] * (-1010.477) (-1009.160) [-1007.389] (-1009.173) -- 0:00:50
152500 -- (-1008.777) (-1008.583) [-1010.073] (-1009.603) * (-1010.515) (-1012.911) [-1007.421] (-1007.527) -- 0:00:50
153000 -- (-1009.599) (-1009.661) (-1009.041) [-1009.682] * (-1011.628) (-1012.906) (-1007.039) [-1007.759] -- 0:00:49
153500 -- (-1006.820) (-1008.168) [-1006.930] (-1008.434) * (-1008.478) (-1009.671) (-1007.638) [-1007.643] -- 0:00:49
154000 -- [-1007.081] (-1008.089) (-1007.897) (-1013.334) * [-1008.368] (-1010.692) (-1007.715) (-1007.257) -- 0:00:49
154500 -- [-1009.782] (-1007.604) (-1009.188) (-1012.229) * (-1007.875) (-1008.793) [-1008.095] (-1007.257) -- 0:00:49
155000 -- [-1008.889] (-1010.575) (-1008.051) (-1011.585) * (-1016.128) (-1008.442) (-1010.121) [-1009.686] -- 0:00:54
Average standard deviation of split frequencies: 0.022210
155500 -- [-1008.847] (-1006.682) (-1009.150) (-1010.936) * (-1008.389) [-1013.036] (-1008.242) (-1011.083) -- 0:00:54
156000 -- (-1011.399) [-1009.367] (-1009.143) (-1009.414) * (-1008.586) (-1008.458) [-1007.949] (-1008.027) -- 0:00:54
156500 -- [-1008.276] (-1008.590) (-1007.822) (-1010.243) * (-1010.409) (-1012.134) (-1011.081) [-1008.716] -- 0:00:53
157000 -- (-1008.870) (-1009.325) [-1007.798] (-1008.738) * [-1006.682] (-1009.056) (-1010.455) (-1008.436) -- 0:00:53
157500 -- (-1007.644) (-1007.425) (-1007.626) [-1008.790] * (-1006.577) (-1009.145) [-1007.636] (-1008.769) -- 0:00:53
158000 -- (-1009.696) (-1008.333) (-1008.745) [-1008.152] * (-1007.017) [-1008.159] (-1014.887) (-1011.890) -- 0:00:53
158500 -- (-1009.538) (-1009.031) (-1007.187) [-1007.806] * [-1008.407] (-1013.550) (-1009.124) (-1008.467) -- 0:00:53
159000 -- [-1008.326] (-1008.414) (-1008.896) (-1010.128) * (-1007.828) (-1009.446) (-1011.623) [-1008.780] -- 0:00:52
159500 -- (-1008.690) (-1008.373) (-1008.392) [-1008.787] * (-1010.212) (-1009.098) [-1012.941] (-1007.903) -- 0:00:52
160000 -- (-1011.748) (-1007.872) [-1007.067] (-1009.047) * (-1009.570) (-1010.352) [-1013.694] (-1007.946) -- 0:00:52
Average standard deviation of split frequencies: 0.019612
160500 -- (-1009.015) [-1008.360] (-1007.612) (-1008.703) * (-1010.537) [-1009.284] (-1007.426) (-1009.380) -- 0:00:52
161000 -- [-1010.068] (-1008.966) (-1007.435) (-1010.212) * (-1007.500) (-1009.001) [-1010.933] (-1011.869) -- 0:00:52
161500 -- [-1007.546] (-1008.509) (-1007.461) (-1010.414) * [-1008.683] (-1008.224) (-1007.552) (-1012.176) -- 0:00:51
162000 -- (-1010.209) (-1007.449) (-1008.941) [-1007.086] * (-1012.564) (-1010.152) [-1007.539] (-1008.914) -- 0:00:51
162500 -- (-1014.642) [-1008.148] (-1009.215) (-1007.700) * [-1011.156] (-1008.246) (-1008.537) (-1008.369) -- 0:00:51
163000 -- (-1017.493) (-1006.735) [-1007.753] (-1007.594) * (-1011.942) (-1007.838) [-1008.702] (-1008.931) -- 0:00:51
163500 -- [-1010.865] (-1009.465) (-1006.920) (-1007.562) * (-1007.890) (-1007.215) [-1009.695] (-1007.988) -- 0:00:51
164000 -- [-1008.382] (-1011.060) (-1013.896) (-1007.196) * (-1007.641) [-1010.384] (-1008.075) (-1010.605) -- 0:00:50
164500 -- [-1013.401] (-1006.958) (-1010.078) (-1008.118) * (-1009.678) (-1010.422) [-1007.567] (-1009.833) -- 0:00:50
165000 -- (-1013.251) (-1008.102) (-1006.827) [-1008.357] * (-1006.966) (-1007.267) (-1007.547) [-1010.012] -- 0:00:50
Average standard deviation of split frequencies: 0.018885
165500 -- [-1009.016] (-1008.674) (-1009.276) (-1008.284) * (-1006.731) (-1007.704) [-1007.347] (-1010.626) -- 0:00:50
166000 -- (-1010.288) (-1008.442) [-1006.808] (-1009.574) * (-1008.800) (-1007.512) (-1007.656) [-1011.982] -- 0:00:50
166500 -- (-1009.974) (-1008.565) [-1006.732] (-1008.514) * (-1011.547) (-1007.703) (-1006.741) [-1009.579] -- 0:00:50
167000 -- (-1009.217) [-1008.507] (-1006.648) (-1008.455) * (-1009.618) (-1014.467) [-1008.813] (-1009.239) -- 0:00:49
167500 -- (-1016.153) (-1009.284) (-1010.791) [-1007.993] * [-1007.027] (-1007.770) (-1008.278) (-1009.839) -- 0:00:49
168000 -- (-1011.393) (-1011.590) [-1006.580] (-1008.051) * (-1008.458) [-1007.491] (-1009.659) (-1006.920) -- 0:00:49
168500 -- (-1009.972) [-1010.320] (-1007.326) (-1007.718) * [-1008.051] (-1016.383) (-1008.951) (-1007.330) -- 0:00:49
169000 -- (-1010.626) (-1014.831) [-1010.039] (-1007.445) * [-1008.246] (-1014.452) (-1009.712) (-1007.689) -- 0:00:49
169500 -- [-1009.354] (-1012.867) (-1007.525) (-1007.504) * (-1008.383) (-1010.020) [-1010.559] (-1007.896) -- 0:00:48
170000 -- (-1013.030) [-1009.858] (-1009.904) (-1007.183) * [-1008.434] (-1007.276) (-1015.356) (-1013.600) -- 0:00:48
Average standard deviation of split frequencies: 0.016987
170500 -- (-1007.404) (-1010.765) [-1008.448] (-1008.644) * (-1009.462) [-1008.094] (-1011.131) (-1012.767) -- 0:00:48
171000 -- (-1008.441) [-1009.166] (-1009.347) (-1008.066) * (-1010.650) (-1009.467) (-1011.756) [-1009.687] -- 0:00:53
171500 -- (-1008.422) (-1010.544) [-1008.066] (-1007.763) * [-1008.488] (-1009.464) (-1008.197) (-1011.935) -- 0:00:53
172000 -- [-1008.388] (-1007.389) (-1006.880) (-1006.861) * [-1010.109] (-1008.497) (-1010.191) (-1014.332) -- 0:00:52
172500 -- (-1007.696) (-1011.160) [-1009.001] (-1008.766) * (-1008.418) (-1014.660) [-1007.952] (-1008.810) -- 0:00:52
173000 -- [-1007.945] (-1009.391) (-1008.269) (-1007.556) * (-1008.118) [-1007.810] (-1008.112) (-1008.970) -- 0:00:52
173500 -- (-1008.566) (-1008.799) (-1007.150) [-1009.543] * (-1012.289) (-1009.093) [-1008.812] (-1008.921) -- 0:00:52
174000 -- [-1007.577] (-1007.995) (-1009.457) (-1011.629) * (-1011.342) [-1006.802] (-1008.806) (-1009.798) -- 0:00:52
174500 -- (-1007.689) [-1009.219] (-1008.209) (-1007.610) * (-1009.549) [-1006.772] (-1011.888) (-1007.777) -- 0:00:52
175000 -- (-1007.453) (-1012.137) (-1007.566) [-1012.212] * [-1012.549] (-1008.142) (-1013.508) (-1007.777) -- 0:00:51
Average standard deviation of split frequencies: 0.016634
175500 -- (-1006.970) (-1009.891) (-1007.753) [-1007.980] * (-1008.600) (-1010.424) [-1008.000] (-1007.484) -- 0:00:51
176000 -- (-1007.677) (-1009.316) [-1007.771] (-1009.621) * (-1008.514) (-1007.952) [-1009.595] (-1011.186) -- 0:00:51
176500 -- [-1007.487] (-1009.058) (-1007.771) (-1007.015) * [-1008.414] (-1008.734) (-1007.528) (-1010.819) -- 0:00:51
177000 -- (-1012.620) [-1009.645] (-1008.410) (-1010.801) * [-1009.212] (-1007.596) (-1008.554) (-1014.948) -- 0:00:51
177500 -- [-1012.735] (-1008.031) (-1008.101) (-1006.784) * (-1010.182) [-1007.585] (-1009.051) (-1010.518) -- 0:00:50
178000 -- (-1008.962) (-1007.596) (-1008.121) [-1007.952] * (-1010.104) (-1009.264) [-1009.221] (-1011.726) -- 0:00:50
178500 -- (-1011.548) (-1011.063) (-1008.994) [-1011.375] * (-1007.553) (-1009.764) [-1008.446] (-1008.946) -- 0:00:50
179000 -- (-1008.489) (-1009.035) [-1010.132] (-1009.987) * [-1010.491] (-1009.257) (-1008.017) (-1009.218) -- 0:00:50
179500 -- (-1009.665) (-1007.311) [-1011.996] (-1008.627) * (-1007.964) [-1007.674] (-1007.427) (-1008.863) -- 0:00:50
180000 -- (-1007.410) [-1008.853] (-1010.791) (-1008.890) * [-1008.106] (-1007.003) (-1012.643) (-1007.760) -- 0:00:50
Average standard deviation of split frequencies: 0.016235
180500 -- [-1009.462] (-1012.215) (-1008.051) (-1007.613) * (-1010.745) (-1006.985) [-1008.277] (-1008.686) -- 0:00:49
181000 -- [-1008.224] (-1007.217) (-1009.817) (-1007.808) * (-1010.659) [-1011.463] (-1009.353) (-1010.754) -- 0:00:49
181500 -- [-1008.882] (-1011.275) (-1010.060) (-1012.462) * (-1009.255) [-1008.046] (-1011.761) (-1011.356) -- 0:00:49
182000 -- (-1007.551) (-1006.844) [-1008.437] (-1010.767) * (-1008.165) (-1009.680) (-1008.688) [-1009.501] -- 0:00:49
182500 -- (-1008.451) (-1008.946) [-1008.987] (-1008.010) * [-1009.782] (-1007.436) (-1009.380) (-1008.549) -- 0:00:49
183000 -- [-1010.675] (-1010.373) (-1013.200) (-1007.373) * (-1007.026) [-1008.619] (-1013.032) (-1012.932) -- 0:00:49
183500 -- [-1007.689] (-1009.439) (-1009.172) (-1009.185) * (-1007.028) (-1007.071) [-1012.161] (-1009.020) -- 0:00:48
184000 -- [-1007.684] (-1007.787) (-1007.206) (-1008.231) * (-1008.015) (-1007.404) [-1010.047] (-1011.326) -- 0:00:48
184500 -- (-1010.458) [-1008.304] (-1010.660) (-1008.364) * (-1008.232) [-1007.575] (-1007.689) (-1015.905) -- 0:00:48
185000 -- (-1008.086) (-1007.269) [-1008.837] (-1008.257) * (-1012.336) (-1008.831) [-1008.175] (-1012.761) -- 0:00:48
Average standard deviation of split frequencies: 0.015740
185500 -- (-1008.035) (-1008.711) (-1008.247) [-1007.529] * (-1009.571) (-1010.794) [-1009.071] (-1007.438) -- 0:00:48
186000 -- [-1007.019] (-1011.136) (-1008.329) (-1009.874) * (-1008.490) (-1009.312) [-1009.999] (-1010.818) -- 0:00:48
186500 -- (-1011.158) (-1011.506) [-1007.062] (-1007.367) * (-1009.294) (-1010.809) (-1010.811) [-1007.334] -- 0:00:47
187000 -- (-1013.182) [-1008.798] (-1007.245) (-1007.894) * (-1008.986) (-1009.982) [-1008.789] (-1007.459) -- 0:00:47
187500 -- (-1012.290) [-1008.589] (-1007.278) (-1011.664) * (-1011.413) (-1010.821) [-1008.980] (-1007.666) -- 0:00:52
188000 -- (-1012.136) [-1010.180] (-1008.226) (-1008.210) * (-1009.497) (-1011.364) [-1007.991] (-1007.920) -- 0:00:51
188500 -- [-1008.922] (-1010.565) (-1009.508) (-1009.923) * (-1009.130) [-1010.794] (-1007.373) (-1007.921) -- 0:00:51
189000 -- [-1008.596] (-1009.139) (-1007.042) (-1007.239) * (-1010.287) (-1007.855) [-1007.126] (-1007.978) -- 0:00:51
189500 -- (-1007.892) (-1009.574) [-1008.384] (-1007.239) * (-1010.434) (-1006.922) [-1008.022] (-1007.977) -- 0:00:51
190000 -- [-1012.023] (-1007.760) (-1009.083) (-1007.022) * (-1011.421) (-1007.284) [-1009.563] (-1008.666) -- 0:00:51
Average standard deviation of split frequencies: 0.014010
190500 -- (-1008.122) (-1008.657) [-1008.107] (-1007.706) * (-1008.453) (-1007.114) [-1013.726] (-1011.819) -- 0:00:50
191000 -- (-1007.353) (-1008.819) (-1008.375) [-1009.554] * (-1007.450) (-1007.789) [-1017.854] (-1009.602) -- 0:00:50
191500 -- (-1007.800) (-1008.039) [-1009.818] (-1009.729) * [-1008.290] (-1012.025) (-1015.929) (-1009.371) -- 0:00:50
192000 -- (-1007.892) (-1007.115) [-1008.224] (-1010.630) * (-1008.840) (-1009.649) [-1007.341] (-1014.903) -- 0:00:50
192500 -- (-1007.185) [-1008.250] (-1009.615) (-1014.449) * (-1006.903) (-1007.244) (-1010.402) [-1009.310] -- 0:00:50
193000 -- [-1008.173] (-1011.203) (-1008.325) (-1015.098) * [-1006.497] (-1008.222) (-1007.832) (-1010.541) -- 0:00:50
193500 -- (-1011.225) (-1011.881) [-1008.183] (-1009.108) * (-1006.774) (-1007.833) (-1007.464) [-1010.286] -- 0:00:50
194000 -- (-1008.173) (-1010.459) [-1007.947] (-1008.880) * (-1007.953) (-1010.539) (-1007.477) [-1007.219] -- 0:00:49
194500 -- [-1009.914] (-1008.726) (-1014.640) (-1007.721) * [-1009.212] (-1010.523) (-1008.779) (-1008.643) -- 0:00:49
195000 -- (-1007.241) (-1009.356) (-1012.684) [-1009.216] * [-1007.949] (-1008.745) (-1013.035) (-1011.643) -- 0:00:49
Average standard deviation of split frequencies: 0.011892
195500 -- (-1009.976) [-1010.334] (-1009.044) (-1009.024) * (-1007.819) [-1011.010] (-1009.022) (-1009.987) -- 0:00:49
196000 -- (-1008.456) (-1009.804) [-1009.363] (-1009.058) * (-1006.623) (-1009.653) [-1008.935] (-1009.124) -- 0:00:49
196500 -- (-1007.933) (-1007.703) (-1010.027) [-1007.944] * (-1006.527) (-1008.092) (-1007.181) [-1009.429] -- 0:00:49
197000 -- (-1007.521) [-1008.549] (-1008.513) (-1009.656) * [-1007.765] (-1014.205) (-1008.949) (-1007.640) -- 0:00:48
197500 -- (-1007.958) (-1007.987) (-1008.555) [-1010.119] * (-1008.958) (-1012.141) (-1008.362) [-1008.973] -- 0:00:48
198000 -- (-1007.140) (-1008.433) (-1008.868) [-1009.137] * (-1007.967) (-1010.829) (-1008.585) [-1012.429] -- 0:00:48
198500 -- (-1006.998) [-1009.455] (-1012.665) (-1008.126) * [-1009.736] (-1007.774) (-1007.818) (-1008.449) -- 0:00:48
199000 -- (-1008.750) (-1007.740) [-1008.656] (-1007.548) * [-1007.786] (-1008.597) (-1012.047) (-1008.154) -- 0:00:48
199500 -- [-1007.136] (-1006.848) (-1008.271) (-1009.726) * [-1009.407] (-1011.871) (-1009.622) (-1009.441) -- 0:00:48
200000 -- [-1006.869] (-1009.630) (-1007.706) (-1011.483) * (-1009.054) (-1008.467) [-1008.275] (-1008.788) -- 0:00:48
Average standard deviation of split frequencies: 0.014837
200500 -- [-1006.807] (-1011.265) (-1008.098) (-1009.663) * [-1008.061] (-1007.995) (-1011.738) (-1008.114) -- 0:00:47
201000 -- (-1009.208) (-1007.496) [-1008.042] (-1009.424) * (-1010.649) (-1011.943) (-1014.067) [-1009.340] -- 0:00:47
201500 -- (-1013.522) (-1007.232) (-1007.358) [-1010.131] * (-1010.019) (-1009.410) [-1009.682] (-1010.447) -- 0:00:47
202000 -- (-1009.756) (-1007.007) (-1007.200) [-1008.907] * (-1012.855) (-1008.298) (-1009.626) [-1007.131] -- 0:00:47
202500 -- (-1007.058) (-1007.145) (-1013.540) [-1008.563] * (-1008.998) (-1011.099) [-1011.905] (-1007.617) -- 0:00:47
203000 -- (-1010.307) (-1007.261) (-1008.020) [-1008.272] * [-1006.713] (-1014.321) (-1010.179) (-1008.609) -- 0:00:47
203500 -- (-1008.697) [-1008.538] (-1007.506) (-1009.184) * (-1007.538) (-1009.039) [-1009.323] (-1007.532) -- 0:00:50
204000 -- [-1006.872] (-1009.576) (-1006.996) (-1008.960) * (-1010.438) (-1014.132) [-1007.320] (-1007.068) -- 0:00:50
204500 -- (-1008.032) (-1008.181) (-1007.697) [-1007.739] * (-1007.900) (-1011.878) (-1010.629) [-1008.263] -- 0:00:50
205000 -- (-1007.395) (-1007.519) [-1007.648] (-1009.344) * (-1010.849) (-1008.437) (-1008.910) [-1007.704] -- 0:00:50
Average standard deviation of split frequencies: 0.014935
205500 -- [-1006.706] (-1008.431) (-1008.230) (-1010.763) * (-1010.751) (-1008.863) [-1011.154] (-1008.962) -- 0:00:50
206000 -- (-1006.706) [-1009.118] (-1012.580) (-1014.591) * (-1008.417) (-1007.624) [-1008.810] (-1013.295) -- 0:00:50
206500 -- [-1009.304] (-1008.825) (-1007.128) (-1011.754) * (-1011.082) [-1008.070] (-1008.413) (-1007.897) -- 0:00:49
207000 -- [-1007.164] (-1009.628) (-1008.412) (-1014.995) * (-1012.812) (-1007.324) (-1008.719) [-1006.677] -- 0:00:49
207500 -- (-1010.570) (-1010.892) (-1010.803) [-1009.515] * [-1007.999] (-1008.337) (-1009.183) (-1008.103) -- 0:00:49
208000 -- [-1010.643] (-1012.641) (-1007.234) (-1008.242) * (-1007.776) (-1007.489) (-1006.977) [-1006.769] -- 0:00:49
208500 -- [-1007.640] (-1011.724) (-1008.338) (-1008.229) * (-1006.963) (-1013.279) (-1007.881) [-1009.039] -- 0:00:49
209000 -- (-1008.975) (-1009.803) (-1009.629) [-1008.734] * [-1006.963] (-1008.824) (-1009.291) (-1008.161) -- 0:00:49
209500 -- (-1010.875) [-1009.144] (-1008.413) (-1008.743) * (-1008.725) (-1008.367) (-1010.380) [-1013.821] -- 0:00:49
210000 -- [-1009.142] (-1007.994) (-1011.598) (-1008.721) * (-1010.459) (-1008.568) (-1011.597) [-1009.711] -- 0:00:48
Average standard deviation of split frequencies: 0.015193
210500 -- (-1010.534) (-1007.624) (-1010.211) [-1009.193] * (-1007.188) (-1008.234) [-1009.151] (-1008.139) -- 0:00:48
211000 -- (-1014.222) (-1009.274) [-1008.140] (-1007.498) * [-1007.785] (-1010.744) (-1009.022) (-1009.971) -- 0:00:48
211500 -- (-1010.434) [-1011.365] (-1007.883) (-1009.697) * (-1012.841) [-1010.292] (-1012.238) (-1007.505) -- 0:00:48
212000 -- (-1010.508) (-1010.229) [-1007.304] (-1010.530) * (-1016.969) [-1010.309] (-1012.099) (-1011.840) -- 0:00:48
212500 -- (-1010.792) [-1012.044] (-1007.763) (-1009.068) * (-1010.224) [-1006.671] (-1012.043) (-1007.711) -- 0:00:48
213000 -- (-1012.470) (-1010.967) [-1007.920] (-1008.671) * [-1011.350] (-1007.937) (-1007.099) (-1010.921) -- 0:00:48
213500 -- (-1012.021) [-1008.222] (-1009.326) (-1007.281) * (-1009.381) (-1008.493) (-1008.563) [-1011.236] -- 0:00:47
214000 -- (-1016.101) (-1007.082) (-1009.138) [-1008.782] * (-1011.113) (-1009.323) [-1007.626] (-1008.240) -- 0:00:47
214500 -- (-1009.773) [-1007.126] (-1013.339) (-1007.696) * (-1012.249) [-1010.018] (-1009.598) (-1008.151) -- 0:00:47
215000 -- (-1011.379) [-1006.870] (-1008.334) (-1009.026) * [-1007.921] (-1009.845) (-1009.365) (-1008.821) -- 0:00:47
Average standard deviation of split frequencies: 0.014703
215500 -- (-1008.321) (-1010.788) (-1009.443) [-1010.177] * (-1008.429) [-1010.631] (-1012.069) (-1009.735) -- 0:00:47
216000 -- [-1008.858] (-1009.361) (-1009.911) (-1011.271) * (-1006.817) (-1009.966) (-1013.272) [-1007.939] -- 0:00:47
216500 -- (-1007.280) (-1009.835) [-1011.464] (-1008.316) * (-1008.564) (-1008.471) (-1010.041) [-1009.013] -- 0:00:47
217000 -- [-1007.429] (-1008.945) (-1009.255) (-1009.651) * [-1010.117] (-1010.405) (-1009.836) (-1009.695) -- 0:00:46
217500 -- (-1007.387) (-1008.945) (-1009.884) [-1008.905] * (-1007.761) [-1010.409] (-1009.979) (-1010.754) -- 0:00:46
218000 -- (-1011.227) (-1009.278) (-1007.430) [-1008.122] * (-1012.491) [-1009.122] (-1008.703) (-1009.763) -- 0:00:46
218500 -- (-1012.895) [-1007.253] (-1008.775) (-1006.869) * (-1009.595) (-1008.385) (-1007.852) [-1009.657] -- 0:00:46
219000 -- (-1008.296) (-1008.558) [-1009.662] (-1007.375) * [-1007.551] (-1009.636) (-1007.022) (-1008.844) -- 0:00:46
219500 -- [-1008.335] (-1008.713) (-1010.090) (-1007.641) * [-1007.696] (-1010.886) (-1010.881) (-1008.699) -- 0:00:46
220000 -- [-1008.251] (-1011.035) (-1010.691) (-1011.792) * [-1012.428] (-1009.434) (-1013.277) (-1007.758) -- 0:00:49
Average standard deviation of split frequencies: 0.014847
220500 -- (-1009.003) [-1008.689] (-1009.520) (-1009.945) * (-1010.212) [-1007.947] (-1013.264) (-1009.510) -- 0:00:49
221000 -- [-1010.554] (-1009.349) (-1010.700) (-1010.964) * (-1007.811) (-1007.748) [-1007.801] (-1013.623) -- 0:00:49
221500 -- (-1012.638) [-1007.802] (-1007.819) (-1009.426) * (-1006.566) (-1007.221) [-1008.294] (-1011.563) -- 0:00:49
222000 -- (-1007.646) [-1007.815] (-1010.297) (-1010.096) * (-1006.794) (-1014.014) [-1010.565] (-1007.565) -- 0:00:49
222500 -- (-1008.542) [-1009.044] (-1010.493) (-1009.936) * (-1010.042) [-1009.475] (-1008.619) (-1009.525) -- 0:00:48
223000 -- (-1009.527) (-1010.210) (-1013.809) [-1008.296] * (-1007.949) [-1008.808] (-1008.737) (-1008.466) -- 0:00:48
223500 -- (-1009.953) (-1012.757) [-1008.791] (-1008.655) * (-1007.233) (-1007.413) [-1010.666] (-1010.528) -- 0:00:48
224000 -- (-1011.500) (-1011.900) [-1007.589] (-1009.671) * (-1008.121) (-1009.207) (-1013.053) [-1007.614] -- 0:00:48
224500 -- (-1008.820) (-1011.096) [-1007.196] (-1009.067) * (-1012.405) (-1009.697) (-1009.877) [-1008.216] -- 0:00:48
225000 -- [-1010.538] (-1010.963) (-1012.172) (-1009.272) * (-1008.561) (-1017.956) (-1010.149) [-1010.121] -- 0:00:48
Average standard deviation of split frequencies: 0.014810
225500 -- [-1007.463] (-1008.043) (-1009.973) (-1010.039) * [-1007.830] (-1011.265) (-1012.775) (-1009.084) -- 0:00:48
226000 -- (-1010.958) (-1009.277) [-1012.745] (-1007.098) * (-1008.800) (-1009.043) (-1009.539) [-1008.489] -- 0:00:47
226500 -- (-1010.955) [-1009.150] (-1009.574) (-1007.097) * (-1007.804) (-1008.409) (-1007.816) [-1007.473] -- 0:00:47
227000 -- (-1014.792) (-1008.271) [-1009.355] (-1009.680) * (-1010.852) [-1009.072] (-1008.219) (-1006.793) -- 0:00:47
227500 -- (-1015.026) (-1009.018) [-1007.499] (-1010.490) * (-1010.856) (-1011.096) (-1008.734) [-1007.423] -- 0:00:47
228000 -- [-1010.986] (-1007.227) (-1008.120) (-1010.629) * (-1008.896) (-1013.371) [-1009.084] (-1009.337) -- 0:00:47
228500 -- [-1009.280] (-1007.224) (-1009.112) (-1009.725) * (-1008.972) (-1013.970) [-1010.448] (-1012.348) -- 0:00:47
229000 -- (-1006.479) (-1006.813) (-1011.339) [-1009.387] * (-1008.200) [-1007.650] (-1012.401) (-1008.640) -- 0:00:47
229500 -- [-1006.476] (-1006.888) (-1012.601) (-1008.827) * (-1009.489) (-1009.073) [-1007.928] (-1012.199) -- 0:00:47
230000 -- [-1006.876] (-1012.461) (-1007.629) (-1008.709) * (-1008.458) [-1010.977] (-1014.227) (-1011.272) -- 0:00:46
Average standard deviation of split frequencies: 0.012603
230500 -- (-1008.596) (-1007.419) (-1007.619) [-1007.374] * (-1011.156) (-1007.806) [-1009.112] (-1007.348) -- 0:00:46
231000 -- (-1007.269) (-1007.866) [-1007.952] (-1015.405) * (-1009.364) [-1007.028] (-1009.545) (-1009.743) -- 0:00:46
231500 -- [-1006.760] (-1009.866) (-1007.577) (-1009.924) * (-1008.502) [-1007.308] (-1007.970) (-1008.169) -- 0:00:46
232000 -- (-1008.027) [-1009.896] (-1007.581) (-1007.355) * (-1007.178) (-1011.863) (-1011.132) [-1008.329] -- 0:00:46
232500 -- [-1007.518] (-1011.383) (-1010.942) (-1009.311) * (-1007.571) (-1007.670) (-1007.815) [-1008.481] -- 0:00:46
233000 -- (-1012.890) (-1009.050) [-1008.903] (-1008.542) * (-1007.201) (-1010.456) (-1010.419) [-1008.151] -- 0:00:46
233500 -- (-1009.441) (-1009.430) [-1007.746] (-1008.647) * [-1007.910] (-1008.660) (-1012.397) (-1007.979) -- 0:00:45
234000 -- (-1009.608) (-1010.284) [-1007.054] (-1008.589) * (-1008.608) (-1009.328) (-1011.168) [-1011.314] -- 0:00:45
234500 -- [-1009.094] (-1008.784) (-1008.507) (-1007.605) * (-1009.388) [-1007.147] (-1008.229) (-1012.951) -- 0:00:45
235000 -- (-1008.169) [-1011.982] (-1012.343) (-1007.778) * (-1010.040) (-1006.855) [-1007.292] (-1012.896) -- 0:00:45
Average standard deviation of split frequencies: 0.012651
235500 -- [-1007.784] (-1008.963) (-1009.455) (-1011.004) * (-1012.230) (-1007.722) [-1007.348] (-1012.241) -- 0:00:45
236000 -- (-1008.864) (-1009.670) [-1009.844] (-1009.971) * (-1009.465) (-1007.647) [-1007.873] (-1012.299) -- 0:00:48
236500 -- [-1006.653] (-1008.444) (-1010.726) (-1009.294) * [-1008.145] (-1012.706) (-1007.212) (-1009.880) -- 0:00:48
237000 -- (-1008.625) [-1008.264] (-1011.300) (-1007.882) * (-1007.480) (-1016.900) [-1007.786] (-1010.430) -- 0:00:48
237500 -- (-1011.126) (-1007.322) [-1008.482] (-1009.065) * (-1007.921) [-1010.796] (-1007.167) (-1009.601) -- 0:00:48
238000 -- [-1006.985] (-1010.446) (-1009.333) (-1006.891) * (-1009.456) [-1010.042] (-1008.069) (-1008.610) -- 0:00:48
238500 -- (-1012.594) [-1007.828] (-1012.754) (-1006.826) * [-1007.520] (-1009.562) (-1008.882) (-1009.082) -- 0:00:47
239000 -- (-1007.551) (-1009.427) [-1010.926] (-1007.764) * (-1010.536) (-1009.671) (-1008.842) [-1008.594] -- 0:00:47
239500 -- (-1008.634) [-1007.540] (-1008.573) (-1007.761) * (-1009.436) [-1008.079] (-1009.706) (-1014.176) -- 0:00:47
240000 -- (-1008.298) (-1006.964) (-1010.938) [-1008.518] * (-1011.802) (-1009.574) [-1007.541] (-1010.471) -- 0:00:47
Average standard deviation of split frequencies: 0.013820
240500 -- (-1006.814) (-1010.717) (-1008.258) [-1008.292] * (-1008.969) (-1011.049) [-1008.189] (-1007.712) -- 0:00:47
241000 -- [-1007.525] (-1011.112) (-1008.688) (-1008.799) * (-1009.319) (-1009.650) [-1007.378] (-1009.973) -- 0:00:47
241500 -- [-1008.029] (-1010.696) (-1009.146) (-1009.595) * (-1007.406) (-1009.940) [-1008.267] (-1007.922) -- 0:00:47
242000 -- (-1009.921) (-1007.326) [-1008.803] (-1010.191) * (-1007.838) (-1007.829) (-1006.837) [-1011.655] -- 0:00:46
242500 -- (-1007.207) (-1007.394) (-1010.356) [-1007.809] * [-1007.373] (-1007.898) (-1009.089) (-1014.420) -- 0:00:46
243000 -- [-1007.111] (-1007.270) (-1010.676) (-1007.984) * (-1009.200) (-1009.199) (-1007.646) [-1009.511] -- 0:00:46
243500 -- [-1007.743] (-1007.237) (-1007.161) (-1010.201) * [-1009.459] (-1008.947) (-1009.791) (-1007.829) -- 0:00:46
244000 -- [-1007.576] (-1009.299) (-1008.260) (-1008.171) * (-1006.690) (-1007.527) [-1011.280] (-1009.553) -- 0:00:46
244500 -- (-1007.916) [-1007.293] (-1008.566) (-1007.986) * (-1007.161) (-1007.716) [-1008.679] (-1009.014) -- 0:00:46
245000 -- [-1010.042] (-1008.014) (-1006.436) (-1010.252) * (-1011.665) (-1011.193) [-1008.301] (-1006.687) -- 0:00:46
Average standard deviation of split frequencies: 0.013011
245500 -- (-1007.761) (-1006.947) [-1007.472] (-1011.660) * [-1007.019] (-1008.072) (-1007.000) (-1006.630) -- 0:00:46
246000 -- [-1008.956] (-1007.483) (-1007.507) (-1010.189) * [-1011.293] (-1009.255) (-1006.778) (-1006.925) -- 0:00:45
246500 -- (-1011.179) (-1007.588) [-1006.889] (-1016.085) * (-1011.690) [-1008.285] (-1008.324) (-1007.622) -- 0:00:45
247000 -- (-1012.733) [-1010.066] (-1009.398) (-1007.133) * (-1009.944) (-1010.481) [-1011.839] (-1010.498) -- 0:00:45
247500 -- (-1011.319) (-1008.828) (-1008.816) [-1008.694] * (-1010.951) [-1008.852] (-1006.719) (-1008.558) -- 0:00:45
248000 -- (-1006.752) [-1007.878] (-1009.152) (-1007.053) * (-1008.492) (-1007.296) [-1008.101] (-1009.177) -- 0:00:45
248500 -- (-1007.763) (-1007.411) [-1008.338] (-1009.894) * [-1007.486] (-1011.897) (-1008.413) (-1014.667) -- 0:00:45
249000 -- [-1007.268] (-1009.132) (-1008.142) (-1010.622) * [-1009.998] (-1007.834) (-1009.168) (-1013.877) -- 0:00:45
249500 -- (-1007.481) [-1008.037] (-1009.057) (-1007.241) * [-1008.000] (-1008.148) (-1008.645) (-1008.349) -- 0:00:45
250000 -- (-1010.445) (-1009.441) [-1009.539] (-1008.855) * (-1008.045) (-1008.541) (-1008.449) [-1008.244] -- 0:00:45
Average standard deviation of split frequencies: 0.012669
250500 -- (-1007.987) (-1018.033) (-1008.520) [-1009.242] * [-1009.239] (-1008.509) (-1010.266) (-1011.026) -- 0:00:44
251000 -- [-1007.377] (-1008.396) (-1011.420) (-1008.084) * (-1008.501) (-1010.153) [-1011.827] (-1010.819) -- 0:00:44
251500 -- (-1007.619) (-1009.892) [-1009.607] (-1008.091) * (-1007.406) (-1007.421) (-1011.571) [-1010.339] -- 0:00:44
252000 -- (-1007.424) (-1014.742) [-1007.859] (-1008.170) * (-1007.378) (-1007.162) (-1008.244) [-1007.350] -- 0:00:44
252500 -- [-1008.394] (-1012.325) (-1008.686) (-1008.000) * (-1007.223) (-1006.778) (-1010.550) [-1007.408] -- 0:00:47
253000 -- (-1008.074) (-1010.926) [-1011.284] (-1007.131) * (-1009.526) (-1018.934) (-1007.771) [-1008.822] -- 0:00:47
253500 -- [-1010.448] (-1008.915) (-1008.202) (-1007.466) * (-1009.762) (-1012.248) (-1008.880) [-1007.917] -- 0:00:47
254000 -- (-1008.279) (-1008.247) (-1009.229) [-1008.669] * (-1008.412) [-1011.237] (-1012.298) (-1008.806) -- 0:00:46
254500 -- (-1008.460) [-1008.362] (-1007.970) (-1013.247) * (-1010.877) (-1010.839) [-1007.862] (-1006.646) -- 0:00:46
255000 -- (-1011.904) [-1008.736] (-1007.936) (-1009.229) * (-1011.163) [-1008.779] (-1012.294) (-1009.387) -- 0:00:46
Average standard deviation of split frequencies: 0.013627
255500 -- (-1008.780) [-1009.905] (-1010.306) (-1009.193) * (-1010.630) (-1008.927) [-1007.057] (-1010.420) -- 0:00:46
256000 -- [-1010.190] (-1013.087) (-1007.981) (-1009.737) * (-1009.354) (-1011.126) (-1007.961) [-1008.193] -- 0:00:46
256500 -- [-1007.766] (-1009.528) (-1009.061) (-1011.813) * (-1008.527) [-1008.714] (-1008.041) (-1008.167) -- 0:00:46
257000 -- (-1009.193) (-1009.127) [-1013.101] (-1009.756) * (-1009.263) [-1006.945] (-1007.349) (-1008.204) -- 0:00:46
257500 -- (-1011.194) (-1012.780) [-1008.094] (-1007.758) * (-1009.276) (-1007.355) (-1009.197) [-1010.010] -- 0:00:46
258000 -- (-1007.787) (-1011.670) [-1008.772] (-1006.755) * (-1008.465) (-1007.891) (-1012.781) [-1009.866] -- 0:00:46
258500 -- [-1009.046] (-1008.740) (-1008.228) (-1007.870) * (-1009.521) [-1009.004] (-1011.674) (-1012.466) -- 0:00:45
259000 -- (-1009.293) (-1013.040) [-1007.880] (-1010.217) * (-1012.101) [-1010.381] (-1016.894) (-1013.505) -- 0:00:45
259500 -- (-1009.714) (-1011.604) (-1007.932) [-1009.240] * [-1009.557] (-1009.400) (-1014.420) (-1008.277) -- 0:00:45
260000 -- (-1008.446) (-1011.207) [-1010.382] (-1008.473) * (-1008.967) [-1008.220] (-1009.482) (-1007.086) -- 0:00:45
Average standard deviation of split frequencies: 0.013706
260500 -- (-1007.265) (-1009.394) [-1010.514] (-1008.926) * (-1009.990) [-1008.964] (-1010.800) (-1008.379) -- 0:00:45
261000 -- (-1007.481) [-1009.381] (-1008.451) (-1008.634) * (-1010.245) (-1012.957) [-1010.637] (-1009.154) -- 0:00:45
261500 -- (-1009.696) (-1008.516) [-1009.441] (-1009.640) * (-1008.863) (-1011.783) [-1008.583] (-1012.050) -- 0:00:45
262000 -- (-1009.304) [-1009.888] (-1007.575) (-1009.206) * (-1009.404) (-1011.923) (-1007.601) [-1008.100] -- 0:00:45
262500 -- (-1009.701) (-1013.615) [-1009.449] (-1007.975) * (-1009.162) (-1014.658) [-1008.180] (-1008.061) -- 0:00:44
263000 -- (-1008.484) (-1011.916) (-1008.365) [-1011.120] * (-1009.780) (-1011.863) [-1009.024] (-1011.926) -- 0:00:44
263500 -- (-1009.758) (-1008.872) (-1009.469) [-1007.792] * [-1009.116] (-1009.568) (-1008.403) (-1009.569) -- 0:00:44
264000 -- (-1011.026) (-1008.710) (-1009.149) [-1008.601] * (-1012.190) [-1010.912] (-1010.069) (-1007.821) -- 0:00:44
264500 -- (-1008.421) (-1007.478) [-1008.311] (-1009.479) * [-1009.761] (-1010.369) (-1008.054) (-1008.295) -- 0:00:44
265000 -- [-1009.854] (-1007.994) (-1009.067) (-1011.668) * (-1010.034) [-1011.904] (-1012.463) (-1014.455) -- 0:00:44
Average standard deviation of split frequencies: 0.012494
265500 -- [-1008.798] (-1010.750) (-1006.960) (-1008.098) * (-1006.867) [-1012.624] (-1008.263) (-1013.790) -- 0:00:44
266000 -- [-1009.286] (-1009.416) (-1007.374) (-1010.078) * (-1007.997) (-1008.620) (-1010.381) [-1010.631] -- 0:00:44
266500 -- (-1011.232) (-1008.642) [-1009.439] (-1010.359) * (-1009.910) (-1008.713) (-1008.788) [-1009.303] -- 0:00:44
267000 -- (-1009.308) (-1008.459) (-1009.509) [-1008.421] * (-1008.372) (-1008.109) (-1008.250) [-1009.099] -- 0:00:43
267500 -- [-1008.702] (-1007.401) (-1008.401) (-1015.600) * [-1009.540] (-1007.969) (-1008.028) (-1009.669) -- 0:00:43
268000 -- (-1010.726) (-1007.394) (-1008.980) [-1009.133] * [-1008.234] (-1009.873) (-1007.408) (-1007.175) -- 0:00:43
268500 -- (-1008.094) (-1007.434) (-1009.328) [-1010.438] * (-1010.025) (-1011.170) (-1009.975) [-1007.831] -- 0:00:46
269000 -- (-1008.967) (-1010.739) (-1007.966) [-1008.425] * (-1009.456) (-1010.767) (-1014.491) [-1012.759] -- 0:00:46
269500 -- [-1010.506] (-1009.480) (-1009.411) (-1007.550) * [-1010.830] (-1011.903) (-1007.160) (-1021.016) -- 0:00:46
270000 -- (-1012.202) (-1010.310) (-1007.082) [-1006.858] * (-1012.299) (-1009.209) [-1007.886] (-1011.459) -- 0:00:45
Average standard deviation of split frequencies: 0.012975
270500 -- [-1011.081] (-1010.123) (-1007.364) (-1007.150) * (-1009.044) (-1008.971) [-1007.902] (-1009.047) -- 0:00:45
271000 -- (-1012.948) (-1009.669) (-1009.045) [-1010.158] * (-1009.598) (-1014.915) (-1009.945) [-1008.673] -- 0:00:45
271500 -- [-1011.952] (-1009.742) (-1008.787) (-1016.658) * [-1009.113] (-1009.931) (-1008.260) (-1009.050) -- 0:00:45
272000 -- (-1017.174) [-1013.874] (-1006.684) (-1015.428) * (-1006.826) [-1009.665] (-1011.321) (-1008.491) -- 0:00:45
272500 -- (-1012.064) (-1008.663) (-1007.775) [-1011.136] * (-1007.318) [-1007.473] (-1007.840) (-1009.945) -- 0:00:45
273000 -- (-1008.251) (-1008.667) (-1006.743) [-1009.192] * (-1013.368) (-1007.187) (-1008.027) [-1007.733] -- 0:00:45
273500 -- (-1009.746) (-1009.871) (-1007.614) [-1010.905] * (-1008.996) (-1009.345) [-1007.331] (-1009.166) -- 0:00:45
274000 -- [-1008.077] (-1008.815) (-1008.610) (-1009.456) * (-1011.865) (-1010.088) [-1007.820] (-1008.753) -- 0:00:45
274500 -- (-1017.303) (-1009.297) [-1009.472] (-1010.472) * (-1009.662) [-1009.783] (-1010.602) (-1010.042) -- 0:00:44
275000 -- (-1008.886) (-1010.523) (-1015.801) [-1006.984] * [-1010.337] (-1008.131) (-1011.846) (-1009.398) -- 0:00:44
Average standard deviation of split frequencies: 0.012495
275500 -- (-1008.220) [-1009.965] (-1008.208) (-1007.905) * (-1008.041) (-1007.740) [-1007.471] (-1008.025) -- 0:00:44
276000 -- (-1007.955) (-1013.946) [-1008.342] (-1008.154) * (-1008.377) (-1009.727) [-1007.052] (-1009.273) -- 0:00:44
276500 -- (-1007.970) [-1007.173] (-1008.574) (-1008.936) * (-1007.838) [-1009.438] (-1010.444) (-1007.961) -- 0:00:44
277000 -- (-1009.614) (-1009.588) (-1011.664) [-1006.921] * (-1008.038) [-1009.554] (-1007.382) (-1009.579) -- 0:00:44
277500 -- (-1010.479) (-1008.908) (-1009.191) [-1006.952] * (-1007.882) (-1011.140) [-1013.556] (-1008.418) -- 0:00:44
278000 -- (-1010.014) [-1007.457] (-1008.370) (-1006.722) * (-1010.199) (-1007.045) (-1009.157) [-1007.989] -- 0:00:44
278500 -- (-1007.567) (-1007.792) (-1010.280) [-1008.141] * (-1009.234) (-1007.811) [-1008.221] (-1009.031) -- 0:00:44
279000 -- (-1008.207) (-1008.422) (-1009.353) [-1009.389] * (-1008.804) (-1008.870) (-1008.534) [-1008.254] -- 0:00:43
279500 -- (-1008.413) (-1006.847) [-1010.225] (-1014.139) * (-1012.376) [-1007.304] (-1009.705) (-1009.857) -- 0:00:43
280000 -- [-1008.989] (-1006.958) (-1010.744) (-1015.056) * (-1012.931) (-1009.079) (-1008.338) [-1009.187] -- 0:00:43
Average standard deviation of split frequencies: 0.013343
280500 -- [-1006.755] (-1007.331) (-1008.988) (-1012.402) * (-1010.091) (-1007.947) (-1008.302) [-1012.191] -- 0:00:43
281000 -- (-1007.456) (-1007.853) (-1010.106) [-1010.307] * (-1009.532) (-1008.279) (-1013.486) [-1008.481] -- 0:00:43
281500 -- (-1012.488) [-1007.472] (-1007.936) (-1007.374) * [-1008.568] (-1009.189) (-1009.341) (-1009.876) -- 0:00:45
282000 -- [-1009.816] (-1008.567) (-1006.764) (-1009.425) * (-1008.973) [-1009.478] (-1010.353) (-1009.823) -- 0:00:45
282500 -- (-1008.649) (-1008.892) [-1008.158] (-1015.097) * (-1009.754) (-1010.201) [-1008.214] (-1007.180) -- 0:00:45
283000 -- (-1012.368) (-1010.885) [-1008.153] (-1013.210) * (-1008.189) (-1011.760) [-1008.166] (-1007.983) -- 0:00:45
283500 -- (-1013.172) (-1011.310) [-1009.872] (-1008.915) * [-1008.064] (-1013.269) (-1009.425) (-1007.114) -- 0:00:45
284000 -- (-1012.951) (-1008.766) [-1009.390] (-1007.467) * (-1007.214) (-1008.810) (-1006.663) [-1009.599] -- 0:00:45
284500 -- (-1010.637) [-1009.662] (-1010.577) (-1009.153) * (-1008.063) (-1015.747) (-1013.586) [-1008.239] -- 0:00:45
285000 -- (-1010.814) (-1009.098) (-1009.556) [-1007.276] * (-1006.879) (-1011.922) (-1011.576) [-1010.299] -- 0:00:45
Average standard deviation of split frequencies: 0.013269
285500 -- [-1011.149] (-1008.539) (-1012.476) (-1010.096) * [-1009.842] (-1015.703) (-1011.598) (-1010.317) -- 0:00:45
286000 -- (-1008.060) [-1007.977] (-1011.871) (-1011.144) * (-1007.849) (-1008.598) [-1009.065] (-1008.776) -- 0:00:44
286500 -- (-1008.369) (-1007.969) [-1009.432] (-1009.301) * (-1007.268) [-1006.973] (-1009.472) (-1009.015) -- 0:00:44
287000 -- (-1014.717) (-1006.839) (-1010.205) [-1008.533] * (-1014.645) (-1007.908) (-1009.307) [-1008.564] -- 0:00:44
287500 -- (-1012.310) [-1007.052] (-1008.634) (-1009.859) * (-1014.118) (-1009.489) [-1008.807] (-1009.194) -- 0:00:44
288000 -- (-1007.974) [-1007.246] (-1008.292) (-1012.351) * (-1007.891) [-1008.573] (-1007.407) (-1009.782) -- 0:00:44
288500 -- [-1012.113] (-1008.763) (-1008.911) (-1007.469) * (-1007.439) [-1008.571] (-1006.760) (-1007.087) -- 0:00:44
289000 -- (-1010.998) (-1009.234) (-1008.595) [-1008.708] * (-1010.173) [-1008.485] (-1007.744) (-1006.836) -- 0:00:44
289500 -- (-1010.059) (-1009.941) (-1014.897) [-1008.386] * (-1008.719) (-1009.515) [-1008.433] (-1010.957) -- 0:00:44
290000 -- (-1007.517) [-1007.400] (-1013.774) (-1010.753) * (-1008.878) [-1009.156] (-1007.363) (-1009.853) -- 0:00:44
Average standard deviation of split frequencies: 0.012614
290500 -- (-1008.660) [-1006.917] (-1008.197) (-1008.532) * (-1008.491) (-1011.313) [-1011.026] (-1013.043) -- 0:00:43
291000 -- [-1009.911] (-1009.328) (-1007.465) (-1008.412) * (-1008.203) (-1009.738) (-1007.589) [-1009.770] -- 0:00:43
291500 -- [-1008.496] (-1006.930) (-1009.293) (-1010.442) * (-1010.056) (-1008.330) (-1007.791) [-1006.575] -- 0:00:43
292000 -- (-1009.858) [-1007.964] (-1010.316) (-1008.227) * [-1016.650] (-1007.689) (-1010.998) (-1009.419) -- 0:00:43
292500 -- (-1012.353) [-1008.180] (-1011.535) (-1008.707) * (-1012.011) (-1009.406) (-1007.246) [-1006.502] -- 0:00:43
293000 -- (-1007.880) (-1008.072) (-1009.738) [-1008.536] * (-1009.198) (-1011.160) (-1010.565) [-1007.579] -- 0:00:43
293500 -- [-1006.593] (-1006.866) (-1008.419) (-1012.173) * (-1008.835) [-1010.518] (-1014.076) (-1007.578) -- 0:00:43
294000 -- (-1012.905) [-1007.504] (-1008.713) (-1012.069) * (-1009.199) [-1012.428] (-1013.404) (-1009.191) -- 0:00:43
294500 -- [-1008.735] (-1009.997) (-1011.691) (-1006.991) * (-1008.639) (-1011.432) (-1011.135) [-1009.169] -- 0:00:43
295000 -- (-1011.427) (-1010.314) [-1010.737] (-1007.802) * [-1009.857] (-1008.929) (-1007.245) (-1011.377) -- 0:00:43
Average standard deviation of split frequencies: 0.011944
295500 -- (-1011.708) (-1011.025) (-1008.993) [-1007.805] * (-1007.919) (-1008.262) (-1012.459) [-1010.170] -- 0:00:42
296000 -- (-1009.887) (-1008.079) (-1010.669) [-1007.422] * (-1008.192) [-1010.898] (-1009.438) (-1009.372) -- 0:00:42
296500 -- (-1009.103) [-1008.308] (-1014.712) (-1008.462) * [-1014.252] (-1008.411) (-1009.559) (-1012.221) -- 0:00:45
297000 -- [-1008.198] (-1008.581) (-1007.979) (-1008.832) * (-1009.241) (-1008.944) [-1007.509] (-1009.905) -- 0:00:44
297500 -- (-1010.862) [-1007.897] (-1009.698) (-1010.769) * (-1013.645) (-1007.537) [-1008.038] (-1007.673) -- 0:00:44
298000 -- [-1012.064] (-1009.251) (-1012.058) (-1007.173) * (-1007.903) (-1010.938) (-1007.954) [-1007.980] -- 0:00:44
298500 -- (-1008.121) [-1008.827] (-1009.937) (-1015.388) * (-1007.842) [-1008.383] (-1008.091) (-1008.015) -- 0:00:44
299000 -- (-1009.526) [-1009.302] (-1013.645) (-1010.187) * (-1007.686) (-1007.736) (-1013.213) [-1009.349] -- 0:00:44
299500 -- [-1009.751] (-1014.050) (-1006.892) (-1013.466) * (-1007.898) [-1008.630] (-1009.919) (-1013.655) -- 0:00:44
300000 -- (-1009.691) [-1017.025] (-1010.798) (-1013.172) * [-1007.023] (-1009.221) (-1012.965) (-1009.378) -- 0:00:44
Average standard deviation of split frequencies: 0.012194
300500 -- (-1014.070) [-1012.629] (-1010.564) (-1010.281) * (-1007.737) (-1013.664) (-1010.928) [-1007.257] -- 0:00:44
301000 -- (-1012.208) (-1011.851) [-1010.502] (-1008.178) * (-1010.020) (-1010.816) (-1008.563) [-1007.376] -- 0:00:44
301500 -- (-1008.462) (-1010.939) [-1009.197] (-1009.128) * (-1011.086) [-1006.952] (-1011.373) (-1006.854) -- 0:00:44
302000 -- (-1011.636) (-1010.051) [-1008.264] (-1009.604) * (-1011.847) (-1009.016) (-1016.373) [-1007.195] -- 0:00:43
302500 -- (-1011.832) [-1009.463] (-1009.062) (-1008.778) * (-1010.251) [-1009.555] (-1011.801) (-1010.138) -- 0:00:43
303000 -- (-1012.009) (-1009.745) (-1010.106) [-1006.792] * (-1009.909) [-1012.097] (-1014.533) (-1011.648) -- 0:00:43
303500 -- [-1009.160] (-1009.226) (-1011.518) (-1007.168) * (-1007.744) [-1008.598] (-1011.627) (-1009.274) -- 0:00:43
304000 -- (-1008.763) (-1009.114) (-1008.473) [-1009.935] * (-1009.093) [-1009.621] (-1010.267) (-1011.667) -- 0:00:43
304500 -- (-1012.680) [-1008.579] (-1008.583) (-1008.219) * (-1009.253) (-1013.179) [-1014.311] (-1010.290) -- 0:00:43
305000 -- (-1010.919) (-1008.554) [-1008.663] (-1013.671) * [-1008.292] (-1010.793) (-1009.160) (-1007.340) -- 0:00:43
Average standard deviation of split frequencies: 0.011896
305500 -- (-1011.600) (-1008.549) [-1009.674] (-1008.248) * [-1006.645] (-1011.273) (-1008.807) (-1012.226) -- 0:00:43
306000 -- (-1009.114) (-1009.186) [-1008.774] (-1008.794) * (-1006.561) [-1007.477] (-1009.215) (-1013.461) -- 0:00:43
306500 -- (-1007.671) (-1010.054) (-1013.633) [-1007.909] * (-1008.864) (-1009.784) [-1008.232] (-1010.579) -- 0:00:42
307000 -- (-1011.057) (-1012.887) (-1010.946) [-1007.119] * (-1011.944) (-1011.516) (-1010.575) [-1007.920] -- 0:00:42
307500 -- (-1012.430) [-1007.828] (-1012.365) (-1009.775) * (-1007.911) [-1007.622] (-1008.199) (-1009.878) -- 0:00:42
308000 -- [-1008.597] (-1015.074) (-1010.832) (-1007.691) * (-1007.500) (-1011.313) [-1008.178] (-1009.765) -- 0:00:42
308500 -- (-1011.214) (-1012.328) [-1008.724] (-1009.342) * (-1008.607) (-1010.415) (-1008.818) [-1009.883] -- 0:00:42
309000 -- (-1007.720) (-1008.142) [-1007.728] (-1010.842) * (-1007.458) (-1008.670) (-1013.784) [-1008.037] -- 0:00:42
309500 -- (-1009.329) (-1011.239) (-1007.879) [-1008.344] * [-1007.166] (-1007.406) (-1011.131) (-1007.429) -- 0:00:44
310000 -- [-1007.958] (-1006.565) (-1009.060) (-1009.907) * (-1006.861) (-1007.694) (-1011.491) [-1009.466] -- 0:00:44
Average standard deviation of split frequencies: 0.011549
310500 -- [-1007.451] (-1007.239) (-1007.505) (-1008.938) * (-1010.241) (-1011.551) (-1010.482) [-1008.308] -- 0:00:44
311000 -- (-1009.222) [-1007.827] (-1008.219) (-1010.030) * (-1012.901) (-1009.925) [-1009.314] (-1009.030) -- 0:00:44
311500 -- [-1007.739] (-1007.644) (-1010.606) (-1007.922) * [-1008.628] (-1009.091) (-1011.366) (-1008.240) -- 0:00:44
312000 -- (-1006.607) (-1008.811) (-1008.490) [-1008.909] * [-1008.786] (-1012.109) (-1009.276) (-1007.793) -- 0:00:44
312500 -- [-1006.861] (-1008.622) (-1007.456) (-1010.604) * (-1008.369) [-1007.721] (-1006.905) (-1008.006) -- 0:00:44
313000 -- [-1008.519] (-1007.178) (-1008.310) (-1007.491) * (-1009.042) (-1010.323) (-1006.891) [-1007.471] -- 0:00:43
313500 -- (-1007.073) (-1008.076) (-1010.250) [-1008.468] * (-1013.612) (-1008.150) [-1006.576] (-1011.728) -- 0:00:43
314000 -- (-1008.379) (-1008.128) (-1008.887) [-1007.959] * (-1013.607) [-1010.044] (-1007.095) (-1009.664) -- 0:00:43
314500 -- (-1008.022) (-1008.258) [-1010.305] (-1010.220) * (-1008.448) (-1009.476) [-1007.838] (-1008.595) -- 0:00:43
315000 -- (-1007.687) [-1008.743] (-1013.017) (-1009.623) * (-1007.609) (-1007.348) [-1008.549] (-1010.607) -- 0:00:43
Average standard deviation of split frequencies: 0.012183
315500 -- (-1011.337) (-1011.120) [-1009.503] (-1008.219) * (-1007.844) [-1007.335] (-1014.374) (-1014.397) -- 0:00:43
316000 -- (-1009.322) (-1010.646) [-1010.012] (-1008.220) * (-1007.539) [-1007.180] (-1013.122) (-1009.012) -- 0:00:43
316500 -- [-1008.625] (-1012.698) (-1008.546) (-1007.769) * (-1009.019) (-1011.551) [-1007.909] (-1008.047) -- 0:00:43
317000 -- (-1012.611) (-1009.719) [-1007.687] (-1006.971) * (-1011.693) (-1011.840) (-1011.052) [-1010.136] -- 0:00:43
317500 -- (-1007.890) (-1010.406) (-1010.482) [-1007.823] * [-1010.414] (-1008.140) (-1015.960) (-1011.199) -- 0:00:42
318000 -- (-1009.414) [-1008.622] (-1010.888) (-1010.796) * [-1012.298] (-1010.093) (-1014.348) (-1010.101) -- 0:00:42
318500 -- (-1008.908) (-1009.116) [-1010.182] (-1008.434) * (-1009.482) (-1008.243) [-1009.374] (-1009.820) -- 0:00:42
319000 -- (-1008.771) (-1008.395) [-1010.287] (-1008.466) * (-1007.145) [-1009.306] (-1007.958) (-1008.883) -- 0:00:42
319500 -- (-1011.116) (-1011.901) [-1011.071] (-1009.150) * (-1011.281) [-1007.756] (-1009.737) (-1010.898) -- 0:00:42
320000 -- (-1009.800) (-1011.677) (-1010.080) [-1010.782] * [-1009.583] (-1007.917) (-1007.640) (-1007.046) -- 0:00:42
Average standard deviation of split frequencies: 0.012986
320500 -- (-1007.738) (-1012.266) (-1011.775) [-1008.880] * (-1007.643) (-1007.584) [-1007.073] (-1007.017) -- 0:00:42
321000 -- [-1007.850] (-1017.426) (-1013.740) (-1009.626) * [-1006.719] (-1010.679) (-1008.039) (-1007.179) -- 0:00:42
321500 -- (-1006.718) (-1013.084) [-1015.223] (-1007.863) * (-1008.129) (-1007.607) [-1007.451] (-1017.013) -- 0:00:42
322000 -- (-1006.829) (-1012.459) (-1008.911) [-1009.544] * (-1007.328) [-1008.575] (-1012.619) (-1014.964) -- 0:00:42
322500 -- [-1008.945] (-1013.334) (-1010.322) (-1007.941) * (-1008.649) [-1011.568] (-1012.039) (-1013.144) -- 0:00:42
323000 -- [-1009.448] (-1012.415) (-1010.381) (-1015.061) * (-1007.928) [-1009.607] (-1010.900) (-1009.221) -- 0:00:41
323500 -- (-1009.733) (-1008.089) (-1007.545) [-1009.121] * (-1008.358) (-1007.397) [-1014.714] (-1007.948) -- 0:00:41
324000 -- (-1008.551) [-1007.699] (-1006.911) (-1010.366) * (-1007.980) (-1009.730) [-1008.498] (-1009.869) -- 0:00:41
324500 -- (-1010.264) (-1007.490) (-1007.340) [-1010.006] * (-1008.468) [-1007.957] (-1009.699) (-1013.217) -- 0:00:43
325000 -- (-1007.401) [-1008.426] (-1006.882) (-1009.916) * [-1006.620] (-1009.546) (-1007.773) (-1008.940) -- 0:00:43
Average standard deviation of split frequencies: 0.012613
325500 -- [-1008.844] (-1008.291) (-1010.424) (-1010.200) * (-1007.880) [-1008.354] (-1007.311) (-1009.157) -- 0:00:43
326000 -- (-1013.092) (-1009.590) (-1007.184) [-1006.977] * (-1008.446) (-1008.117) (-1006.925) [-1008.757] -- 0:00:43
326500 -- (-1007.292) (-1006.877) [-1006.904] (-1008.742) * (-1009.438) [-1008.354] (-1008.822) (-1009.593) -- 0:00:43
327000 -- (-1009.166) (-1010.777) (-1006.746) [-1010.691] * (-1008.079) (-1008.279) (-1008.373) [-1008.613] -- 0:00:43
327500 -- (-1011.677) (-1008.461) [-1006.813] (-1010.753) * [-1009.408] (-1011.337) (-1010.500) (-1007.766) -- 0:00:43
328000 -- [-1007.219] (-1008.189) (-1006.890) (-1010.807) * (-1007.106) (-1009.355) [-1009.625] (-1007.104) -- 0:00:43
328500 -- (-1008.851) [-1007.661] (-1012.916) (-1009.777) * (-1006.993) [-1008.442] (-1008.821) (-1008.448) -- 0:00:42
329000 -- [-1008.671] (-1008.337) (-1008.868) (-1009.113) * [-1008.529] (-1012.659) (-1007.897) (-1009.649) -- 0:00:42
329500 -- (-1007.995) [-1008.592] (-1009.083) (-1007.505) * (-1007.445) (-1010.536) (-1007.843) [-1009.727] -- 0:00:42
330000 -- (-1013.696) (-1007.358) [-1008.546] (-1007.625) * (-1010.072) [-1009.936] (-1008.904) (-1009.677) -- 0:00:42
Average standard deviation of split frequencies: 0.012514
330500 -- (-1012.866) (-1009.669) [-1007.421] (-1010.144) * (-1009.547) [-1008.700] (-1008.395) (-1010.926) -- 0:00:42
331000 -- (-1009.616) (-1007.809) (-1007.932) [-1010.296] * (-1009.061) [-1008.647] (-1011.587) (-1007.916) -- 0:00:42
331500 -- (-1009.401) [-1009.094] (-1009.473) (-1009.861) * (-1010.167) [-1010.870] (-1010.446) (-1008.920) -- 0:00:42
332000 -- (-1006.785) [-1008.596] (-1010.767) (-1009.096) * (-1008.565) (-1013.466) [-1010.148] (-1009.403) -- 0:00:42
332500 -- (-1006.785) (-1010.650) [-1008.874] (-1012.158) * (-1009.374) (-1013.649) [-1008.001] (-1009.367) -- 0:00:42
333000 -- (-1007.187) (-1009.641) [-1007.934] (-1009.517) * (-1009.172) (-1010.108) [-1008.614] (-1006.766) -- 0:00:42
333500 -- [-1010.291] (-1008.239) (-1007.879) (-1008.320) * (-1014.359) (-1009.319) (-1008.227) [-1007.308] -- 0:00:41
334000 -- (-1012.731) (-1011.530) (-1008.079) [-1012.935] * (-1007.916) (-1013.220) [-1007.707] (-1006.994) -- 0:00:41
334500 -- (-1007.565) (-1008.517) [-1009.503] (-1008.281) * [-1008.224] (-1011.120) (-1009.220) (-1009.886) -- 0:00:41
335000 -- (-1007.127) (-1011.857) [-1007.041] (-1009.529) * [-1007.483] (-1007.667) (-1010.147) (-1006.617) -- 0:00:41
Average standard deviation of split frequencies: 0.012861
335500 -- (-1008.794) (-1012.104) [-1008.443] (-1009.001) * [-1009.260] (-1007.855) (-1010.058) (-1007.506) -- 0:00:41
336000 -- (-1014.747) (-1014.132) [-1007.028] (-1008.438) * [-1010.420] (-1009.014) (-1008.998) (-1008.150) -- 0:00:41
336500 -- (-1010.598) [-1008.104] (-1008.022) (-1010.004) * (-1007.867) [-1008.481] (-1010.444) (-1010.377) -- 0:00:41
337000 -- (-1009.051) (-1010.429) [-1010.136] (-1008.515) * [-1007.813] (-1008.481) (-1012.850) (-1010.434) -- 0:00:41
337500 -- [-1008.354] (-1007.982) (-1008.008) (-1009.953) * (-1008.245) (-1010.132) (-1009.269) [-1008.863] -- 0:00:41
338000 -- (-1007.049) (-1008.971) (-1006.846) [-1008.746] * [-1009.631] (-1010.424) (-1009.992) (-1010.855) -- 0:00:41
338500 -- (-1008.415) [-1009.313] (-1006.856) (-1008.815) * (-1009.085) (-1009.354) (-1008.006) [-1009.334] -- 0:00:41
339000 -- (-1008.293) [-1009.406] (-1013.963) (-1009.447) * (-1009.378) [-1010.720] (-1009.858) (-1009.334) -- 0:00:40
339500 -- (-1007.726) [-1010.645] (-1009.885) (-1011.647) * (-1007.622) [-1008.069] (-1010.370) (-1008.093) -- 0:00:42
340000 -- (-1008.779) (-1010.050) [-1010.223] (-1010.798) * (-1007.241) (-1008.497) (-1007.505) [-1008.190] -- 0:00:42
Average standard deviation of split frequencies: 0.013530
340500 -- (-1007.435) (-1010.579) [-1009.609] (-1009.101) * [-1009.817] (-1008.639) (-1007.810) (-1011.716) -- 0:00:42
341000 -- [-1007.912] (-1008.778) (-1008.040) (-1008.513) * [-1010.464] (-1009.593) (-1010.274) (-1012.857) -- 0:00:42
341500 -- (-1006.983) (-1009.830) [-1007.536] (-1008.993) * [-1010.993] (-1008.906) (-1009.378) (-1012.787) -- 0:00:42
342000 -- (-1009.299) (-1012.006) (-1008.155) [-1008.252] * [-1014.258] (-1009.359) (-1008.843) (-1007.823) -- 0:00:42
342500 -- (-1007.398) (-1010.193) [-1008.023] (-1011.968) * (-1009.303) [-1008.522] (-1008.860) (-1007.500) -- 0:00:42
343000 -- (-1011.387) (-1008.877) (-1008.403) [-1009.643] * (-1007.364) [-1010.846] (-1013.299) (-1007.567) -- 0:00:42
343500 -- (-1009.884) (-1007.830) (-1008.274) [-1008.377] * [-1009.452] (-1012.744) (-1013.170) (-1007.219) -- 0:00:42
344000 -- (-1007.906) (-1011.868) [-1008.918] (-1008.537) * [-1009.167] (-1012.792) (-1009.083) (-1009.265) -- 0:00:41
344500 -- (-1009.697) (-1011.145) [-1007.283] (-1009.267) * [-1010.974] (-1008.439) (-1009.118) (-1007.838) -- 0:00:41
345000 -- (-1010.186) [-1010.392] (-1008.092) (-1010.454) * (-1010.682) [-1009.676] (-1011.912) (-1008.440) -- 0:00:41
Average standard deviation of split frequencies: 0.013776
345500 -- (-1012.425) (-1010.006) (-1010.692) [-1008.156] * [-1007.492] (-1009.511) (-1012.046) (-1008.519) -- 0:00:41
346000 -- [-1010.416] (-1009.640) (-1010.144) (-1010.698) * (-1008.529) [-1012.945] (-1011.715) (-1007.686) -- 0:00:41
346500 -- [-1014.612] (-1013.940) (-1009.938) (-1007.003) * [-1010.628] (-1009.480) (-1009.777) (-1009.119) -- 0:00:41
347000 -- (-1009.308) (-1015.119) (-1011.119) [-1006.576] * [-1007.338] (-1009.044) (-1010.311) (-1007.948) -- 0:00:41
347500 -- (-1010.095) (-1008.765) [-1008.067] (-1011.958) * (-1008.690) (-1008.741) [-1008.997] (-1008.969) -- 0:00:41
348000 -- (-1008.387) [-1009.454] (-1009.310) (-1007.021) * (-1007.108) (-1011.161) [-1009.024] (-1008.745) -- 0:00:41
348500 -- [-1008.181] (-1011.856) (-1009.496) (-1009.474) * (-1007.115) (-1013.543) [-1009.456] (-1012.798) -- 0:00:41
349000 -- (-1008.254) (-1011.221) (-1008.529) [-1007.583] * (-1007.584) [-1011.284] (-1008.844) (-1007.964) -- 0:00:41
349500 -- (-1007.813) [-1009.180] (-1011.546) (-1009.757) * [-1010.255] (-1007.603) (-1011.730) (-1008.806) -- 0:00:40
350000 -- (-1007.346) (-1008.632) (-1010.128) [-1010.186] * (-1011.874) (-1007.667) [-1007.393] (-1012.408) -- 0:00:40
Average standard deviation of split frequencies: 0.014563
350500 -- [-1008.004] (-1008.777) (-1013.972) (-1009.050) * (-1012.617) (-1008.285) (-1008.772) [-1013.789] -- 0:00:40
351000 -- (-1008.935) [-1011.300] (-1013.352) (-1008.258) * (-1008.318) [-1008.616] (-1009.370) (-1008.631) -- 0:00:40
351500 -- (-1007.878) (-1014.125) (-1007.844) [-1009.895] * [-1007.166] (-1006.960) (-1007.853) (-1010.490) -- 0:00:40
352000 -- (-1009.315) (-1012.640) (-1008.729) [-1010.807] * [-1009.342] (-1007.216) (-1009.087) (-1014.261) -- 0:00:40
352500 -- (-1007.335) (-1009.202) (-1007.437) [-1009.512] * (-1011.322) (-1010.619) [-1009.172] (-1012.424) -- 0:00:40
353000 -- (-1008.862) [-1008.960] (-1009.703) (-1008.080) * (-1010.521) (-1010.612) [-1010.729] (-1011.167) -- 0:00:40
353500 -- [-1008.101] (-1013.756) (-1007.163) (-1008.906) * [-1009.543] (-1012.920) (-1012.175) (-1008.676) -- 0:00:40
354000 -- (-1008.594) [-1008.924] (-1008.856) (-1009.741) * (-1008.179) (-1010.052) (-1009.613) [-1008.099] -- 0:00:40
354500 -- (-1008.551) (-1011.196) (-1006.922) [-1008.759] * (-1013.727) (-1007.589) (-1010.679) [-1010.056] -- 0:00:40
355000 -- (-1010.444) [-1012.759] (-1014.727) (-1008.941) * (-1008.563) (-1010.325) [-1008.670] (-1008.418) -- 0:00:41
Average standard deviation of split frequencies: 0.014488
355500 -- (-1010.148) [-1008.949] (-1009.666) (-1007.319) * (-1009.019) (-1007.961) (-1008.555) [-1008.925] -- 0:00:41
356000 -- (-1008.412) (-1010.447) (-1018.747) [-1007.244] * (-1007.900) (-1008.814) (-1007.934) [-1012.189] -- 0:00:41
356500 -- (-1008.947) [-1007.178] (-1014.970) (-1008.566) * (-1012.093) (-1012.083) (-1011.868) [-1007.001] -- 0:00:41
357000 -- (-1008.944) (-1007.219) (-1008.021) [-1008.195] * (-1007.849) [-1010.234] (-1008.176) (-1007.690) -- 0:00:41
357500 -- (-1009.261) [-1008.377] (-1007.085) (-1011.227) * (-1010.237) (-1009.769) (-1008.689) [-1008.166] -- 0:00:41
358000 -- (-1009.922) [-1007.631] (-1009.532) (-1010.169) * (-1007.634) [-1008.487] (-1008.055) (-1007.835) -- 0:00:41
358500 -- (-1013.648) (-1007.355) [-1008.043] (-1007.646) * [-1013.336] (-1007.354) (-1011.561) (-1008.785) -- 0:00:41
359000 -- (-1008.908) (-1008.015) [-1008.112] (-1009.277) * (-1011.348) (-1008.030) [-1009.971] (-1008.461) -- 0:00:41
359500 -- (-1009.451) (-1007.100) [-1007.252] (-1010.943) * (-1011.031) [-1007.936] (-1008.573) (-1008.154) -- 0:00:40
360000 -- (-1009.627) (-1008.090) [-1008.862] (-1010.931) * [-1010.635] (-1006.669) (-1013.198) (-1008.570) -- 0:00:40
Average standard deviation of split frequencies: 0.014685
360500 -- (-1009.395) (-1009.166) [-1008.483] (-1007.480) * (-1011.248) (-1006.554) (-1012.040) [-1008.461] -- 0:00:40
361000 -- [-1009.544] (-1011.441) (-1010.452) (-1013.435) * (-1011.020) [-1007.812] (-1011.716) (-1009.706) -- 0:00:40
361500 -- (-1013.385) (-1006.867) [-1008.514] (-1009.552) * (-1010.293) (-1007.148) [-1008.486] (-1007.774) -- 0:00:40
362000 -- (-1007.655) (-1009.495) [-1007.248] (-1010.134) * (-1009.487) (-1007.981) (-1009.143) [-1008.421] -- 0:00:40
362500 -- (-1008.899) (-1007.277) [-1007.199] (-1009.049) * (-1011.821) (-1008.236) (-1008.252) [-1007.704] -- 0:00:40
363000 -- (-1008.689) [-1006.847] (-1010.022) (-1008.956) * (-1008.385) (-1007.910) [-1012.873] (-1011.871) -- 0:00:40
363500 -- [-1008.051] (-1009.220) (-1010.394) (-1007.853) * (-1009.508) (-1008.046) [-1010.417] (-1014.739) -- 0:00:40
364000 -- (-1008.623) (-1007.799) (-1011.646) [-1008.842] * (-1011.093) (-1010.591) [-1008.740] (-1008.569) -- 0:00:40
364500 -- (-1012.488) (-1008.181) [-1010.913] (-1008.361) * (-1010.114) (-1015.642) [-1006.697] (-1008.569) -- 0:00:40
365000 -- (-1010.965) (-1009.249) (-1011.409) [-1009.026] * (-1008.237) (-1008.236) [-1006.945] (-1008.471) -- 0:00:40
Average standard deviation of split frequencies: 0.015027
365500 -- (-1013.433) [-1009.643] (-1010.419) (-1012.299) * (-1012.441) [-1007.552] (-1008.433) (-1007.775) -- 0:00:39
366000 -- (-1013.579) [-1008.494] (-1007.483) (-1008.532) * (-1009.390) (-1010.946) (-1008.041) [-1008.930] -- 0:00:39
366500 -- (-1011.571) [-1010.161] (-1007.372) (-1008.393) * (-1010.261) (-1008.796) (-1010.473) [-1010.473] -- 0:00:39
367000 -- [-1009.106] (-1008.344) (-1007.982) (-1010.718) * (-1008.090) (-1009.490) [-1010.810] (-1010.380) -- 0:00:39
367500 -- (-1009.440) (-1010.006) [-1006.506] (-1007.666) * (-1011.258) (-1009.725) (-1007.548) [-1009.123] -- 0:00:39
368000 -- (-1014.044) (-1007.048) [-1008.449] (-1010.220) * (-1008.795) (-1009.918) (-1009.847) [-1012.127] -- 0:00:39
368500 -- (-1011.160) (-1007.048) [-1007.777] (-1012.694) * (-1011.707) (-1009.921) [-1011.415] (-1009.611) -- 0:00:39
369000 -- (-1009.082) (-1008.108) [-1008.801] (-1009.561) * (-1008.782) (-1009.015) [-1007.758] (-1007.234) -- 0:00:39
369500 -- (-1007.700) (-1007.808) (-1007.522) [-1008.588] * (-1009.806) (-1007.664) [-1007.818] (-1007.239) -- 0:00:39
370000 -- (-1007.884) (-1011.702) [-1009.200] (-1009.485) * (-1007.693) (-1008.144) (-1008.448) [-1007.509] -- 0:00:39
Average standard deviation of split frequencies: 0.014908
370500 -- [-1009.342] (-1006.747) (-1009.295) (-1008.687) * (-1007.117) (-1010.732) [-1010.027] (-1012.378) -- 0:00:39
371000 -- [-1010.235] (-1006.834) (-1009.766) (-1009.630) * (-1012.233) [-1009.698] (-1007.868) (-1009.676) -- 0:00:40
371500 -- (-1009.680) [-1007.288] (-1007.394) (-1008.740) * (-1011.098) (-1008.425) (-1008.713) [-1009.578] -- 0:00:40
372000 -- (-1011.421) (-1008.803) [-1008.073] (-1012.094) * (-1009.157) [-1007.149] (-1007.529) (-1009.832) -- 0:00:40
372500 -- (-1009.661) (-1008.766) [-1008.340] (-1007.916) * (-1010.146) (-1009.909) (-1010.181) [-1011.209] -- 0:00:40
373000 -- (-1009.322) (-1008.146) (-1008.036) [-1008.015] * (-1010.335) [-1009.016] (-1010.303) (-1008.634) -- 0:00:40
373500 -- (-1010.193) [-1008.862] (-1009.365) (-1012.344) * (-1009.862) [-1010.340] (-1007.838) (-1008.552) -- 0:00:40
374000 -- (-1012.853) (-1009.993) [-1007.971] (-1015.742) * (-1009.473) [-1009.972] (-1008.032) (-1007.731) -- 0:00:40
374500 -- [-1008.182] (-1012.046) (-1008.166) (-1009.403) * (-1010.913) (-1009.708) [-1009.967] (-1010.302) -- 0:00:40
375000 -- (-1009.661) [-1007.804] (-1007.497) (-1009.488) * (-1009.851) (-1010.142) (-1010.527) [-1007.727] -- 0:00:40
Average standard deviation of split frequencies: 0.015184
375500 -- [-1008.482] (-1009.748) (-1009.042) (-1012.925) * [-1008.808] (-1009.826) (-1007.795) (-1007.933) -- 0:00:39
376000 -- (-1008.845) (-1010.542) (-1007.957) [-1007.965] * (-1008.683) [-1008.756] (-1008.398) (-1008.354) -- 0:00:39
376500 -- (-1011.061) (-1008.823) (-1008.691) [-1010.328] * (-1008.799) (-1009.606) (-1007.598) [-1009.351] -- 0:00:39
377000 -- [-1009.773] (-1009.893) (-1009.640) (-1009.738) * (-1008.769) [-1006.975] (-1010.708) (-1009.682) -- 0:00:39
377500 -- [-1010.430] (-1010.726) (-1008.232) (-1011.143) * (-1008.958) (-1007.266) [-1013.712] (-1009.812) -- 0:00:39
378000 -- (-1009.196) (-1007.502) (-1008.490) [-1008.320] * [-1009.283] (-1007.265) (-1007.463) (-1009.681) -- 0:00:39
378500 -- (-1011.582) (-1008.506) (-1015.493) [-1008.136] * (-1009.715) (-1006.704) (-1008.583) [-1007.515] -- 0:00:39
379000 -- [-1007.377] (-1011.491) (-1009.416) (-1008.787) * (-1012.735) (-1008.614) [-1009.785] (-1010.352) -- 0:00:39
379500 -- (-1007.736) [-1011.004] (-1012.061) (-1009.584) * (-1010.039) (-1008.715) [-1008.280] (-1010.987) -- 0:00:39
380000 -- (-1009.556) [-1010.700] (-1007.854) (-1011.443) * (-1008.925) (-1007.747) [-1012.513] (-1008.631) -- 0:00:39
Average standard deviation of split frequencies: 0.015225
380500 -- (-1009.157) [-1009.162] (-1015.083) (-1009.036) * (-1008.359) [-1008.831] (-1007.392) (-1009.408) -- 0:00:39
381000 -- (-1008.996) [-1014.774] (-1007.541) (-1014.945) * [-1007.310] (-1007.413) (-1011.486) (-1007.608) -- 0:00:38
381500 -- (-1011.203) (-1009.400) (-1008.204) [-1007.732] * (-1007.090) (-1011.847) [-1008.592] (-1010.311) -- 0:00:38
382000 -- [-1007.470] (-1009.481) (-1013.145) (-1008.932) * (-1008.395) [-1007.048] (-1008.346) (-1008.536) -- 0:00:38
382500 -- [-1007.925] (-1013.864) (-1008.751) (-1009.238) * [-1010.080] (-1006.965) (-1009.379) (-1008.230) -- 0:00:38
383000 -- (-1008.194) [-1008.677] (-1007.739) (-1007.887) * (-1008.240) (-1007.186) (-1007.581) [-1006.790] -- 0:00:38
383500 -- (-1009.049) (-1007.249) (-1009.369) [-1007.731] * (-1010.999) (-1009.335) (-1008.326) [-1009.999] -- 0:00:38
384000 -- (-1007.121) [-1008.536] (-1010.834) (-1006.633) * [-1010.803] (-1008.826) (-1010.046) (-1011.006) -- 0:00:38
384500 -- [-1007.735] (-1009.685) (-1011.636) (-1006.499) * (-1008.301) [-1007.605] (-1007.464) (-1011.162) -- 0:00:38
385000 -- (-1007.315) [-1011.611] (-1016.251) (-1008.848) * (-1008.495) [-1009.669] (-1007.422) (-1011.159) -- 0:00:38
Average standard deviation of split frequencies: 0.014859
385500 -- [-1007.728] (-1010.968) (-1013.597) (-1012.234) * (-1007.453) (-1011.129) (-1007.525) [-1007.485] -- 0:00:38
386000 -- (-1007.128) (-1009.831) [-1010.012] (-1008.760) * (-1008.984) (-1009.483) [-1007.426] (-1007.487) -- 0:00:38
386500 -- (-1006.899) (-1009.590) [-1009.672] (-1008.508) * (-1008.236) [-1010.481] (-1009.392) (-1010.905) -- 0:00:38
387000 -- (-1008.029) (-1008.206) (-1008.890) [-1007.060] * (-1007.356) (-1014.616) (-1011.481) [-1009.844] -- 0:00:38
387500 -- (-1009.672) (-1007.762) [-1007.506] (-1012.903) * [-1008.874] (-1010.648) (-1008.374) (-1010.450) -- 0:00:39
388000 -- (-1009.072) [-1010.176] (-1008.239) (-1008.840) * [-1007.406] (-1008.979) (-1008.031) (-1007.564) -- 0:00:39
388500 -- (-1011.202) (-1010.318) (-1008.138) [-1010.660] * (-1006.693) [-1007.968] (-1008.317) (-1008.434) -- 0:00:39
389000 -- (-1010.744) [-1006.718] (-1008.727) (-1008.780) * (-1007.366) (-1011.877) (-1009.964) [-1008.421] -- 0:00:39
389500 -- [-1008.296] (-1010.610) (-1008.341) (-1010.750) * (-1008.712) (-1012.560) [-1009.315] (-1011.335) -- 0:00:39
390000 -- [-1010.705] (-1010.146) (-1007.887) (-1014.897) * (-1007.636) (-1008.082) [-1007.787] (-1012.143) -- 0:00:39
Average standard deviation of split frequencies: 0.014681
390500 -- (-1008.819) (-1007.286) (-1008.511) [-1008.527] * (-1012.470) [-1008.436] (-1006.986) (-1007.489) -- 0:00:39
391000 -- [-1007.545] (-1007.289) (-1008.117) (-1009.076) * (-1009.247) (-1008.048) (-1007.614) [-1007.824] -- 0:00:38
391500 -- [-1008.188] (-1007.554) (-1008.121) (-1011.015) * (-1007.592) (-1009.407) (-1010.223) [-1007.126] -- 0:00:38
392000 -- (-1011.439) [-1007.746] (-1007.371) (-1010.783) * (-1009.359) (-1009.513) [-1011.049] (-1007.754) -- 0:00:38
392500 -- (-1012.843) (-1006.843) [-1010.524] (-1009.284) * (-1010.616) (-1011.223) (-1012.374) [-1008.928] -- 0:00:38
393000 -- (-1012.773) (-1008.345) (-1009.467) [-1011.002] * (-1009.760) (-1011.220) (-1007.848) [-1007.678] -- 0:00:38
393500 -- (-1012.493) [-1010.453] (-1008.481) (-1015.094) * (-1008.233) [-1008.736] (-1012.914) (-1014.625) -- 0:00:38
394000 -- (-1011.758) (-1011.068) [-1008.806] (-1007.125) * (-1007.713) (-1008.634) [-1009.472] (-1008.827) -- 0:00:38
394500 -- (-1011.496) (-1008.296) [-1006.746] (-1008.221) * (-1010.605) (-1009.218) [-1008.630] (-1011.565) -- 0:00:38
395000 -- (-1008.822) (-1008.660) (-1008.727) [-1007.130] * (-1008.021) (-1009.385) [-1007.598] (-1013.820) -- 0:00:38
Average standard deviation of split frequencies: 0.014915
395500 -- (-1011.830) [-1007.598] (-1008.882) (-1010.103) * (-1011.752) (-1008.936) (-1009.147) [-1009.532] -- 0:00:38
396000 -- (-1008.312) [-1008.824] (-1007.550) (-1007.188) * (-1009.212) [-1007.760] (-1008.268) (-1007.165) -- 0:00:38
396500 -- (-1007.757) [-1008.316] (-1008.963) (-1007.685) * (-1009.119) (-1008.523) [-1009.192] (-1007.053) -- 0:00:38
397000 -- (-1007.272) (-1008.721) (-1007.313) [-1007.368] * (-1009.207) [-1011.418] (-1006.856) (-1009.234) -- 0:00:37
397500 -- (-1007.390) [-1010.056] (-1013.159) (-1011.042) * (-1010.135) (-1010.904) (-1007.656) [-1008.393] -- 0:00:37
398000 -- (-1007.100) [-1008.377] (-1007.707) (-1013.704) * [-1007.743] (-1006.780) (-1010.376) (-1009.156) -- 0:00:37
398500 -- (-1007.339) [-1007.987] (-1008.210) (-1008.140) * (-1009.975) [-1008.529] (-1008.392) (-1009.601) -- 0:00:37
399000 -- (-1006.723) [-1007.175] (-1008.869) (-1010.065) * (-1007.759) (-1009.149) [-1007.717] (-1008.379) -- 0:00:37
399500 -- (-1011.187) [-1008.079] (-1008.449) (-1009.797) * (-1007.387) [-1014.059] (-1007.746) (-1008.625) -- 0:00:37
400000 -- (-1010.969) [-1009.709] (-1008.793) (-1010.995) * [-1008.259] (-1013.258) (-1011.146) (-1010.752) -- 0:00:37
Average standard deviation of split frequencies: 0.014395
400500 -- (-1010.961) [-1007.624] (-1017.349) (-1009.565) * (-1008.665) (-1014.041) (-1009.552) [-1012.238] -- 0:00:37
401000 -- [-1010.264] (-1006.930) (-1016.652) (-1010.833) * (-1007.698) (-1011.746) (-1010.390) [-1007.084] -- 0:00:37
401500 -- (-1011.482) (-1007.953) (-1008.723) [-1008.425] * [-1007.202] (-1008.556) (-1009.285) (-1008.442) -- 0:00:37
402000 -- (-1009.314) [-1006.868] (-1006.728) (-1009.708) * (-1016.079) (-1010.118) (-1008.042) [-1008.204] -- 0:00:37
402500 -- [-1011.680] (-1008.560) (-1010.161) (-1011.376) * (-1007.180) (-1012.961) [-1009.158] (-1008.473) -- 0:00:37
403000 -- [-1010.034] (-1010.062) (-1009.555) (-1007.028) * (-1010.034) (-1010.300) (-1008.976) [-1007.224] -- 0:00:37
403500 -- [-1010.443] (-1009.644) (-1010.833) (-1012.383) * (-1013.120) [-1009.452] (-1008.941) (-1008.397) -- 0:00:38
404000 -- (-1008.696) (-1009.677) (-1007.235) [-1010.805] * (-1011.898) [-1011.921] (-1011.295) (-1011.558) -- 0:00:38
404500 -- [-1007.117] (-1013.285) (-1008.626) (-1011.131) * (-1012.397) (-1008.175) (-1007.859) [-1007.423] -- 0:00:38
405000 -- [-1006.969] (-1016.497) (-1010.616) (-1011.181) * (-1008.199) (-1008.050) [-1011.272] (-1008.710) -- 0:00:38
Average standard deviation of split frequencies: 0.013592
405500 -- (-1006.873) [-1009.590] (-1009.575) (-1008.972) * (-1011.967) (-1012.792) [-1008.133] (-1012.662) -- 0:00:38
406000 -- [-1008.681] (-1009.995) (-1009.944) (-1011.925) * [-1008.819] (-1014.892) (-1007.355) (-1009.074) -- 0:00:38
406500 -- (-1009.735) (-1008.469) (-1010.962) [-1008.329] * (-1007.417) (-1008.527) (-1007.574) [-1011.915] -- 0:00:37
407000 -- (-1009.015) (-1009.725) [-1009.679] (-1006.785) * (-1007.835) (-1007.373) (-1008.749) [-1010.474] -- 0:00:37
407500 -- (-1011.745) [-1009.168] (-1008.794) (-1006.847) * [-1008.669] (-1009.054) (-1011.901) (-1008.699) -- 0:00:37
408000 -- (-1009.415) (-1011.104) (-1007.208) [-1010.034] * (-1007.408) [-1007.415] (-1008.407) (-1010.099) -- 0:00:37
408500 -- [-1009.865] (-1007.826) (-1010.098) (-1009.800) * (-1008.623) (-1008.112) (-1009.294) [-1009.667] -- 0:00:37
409000 -- (-1012.283) (-1009.526) (-1011.043) [-1009.400] * (-1012.760) (-1009.113) (-1010.794) [-1009.954] -- 0:00:37
409500 -- (-1009.159) (-1012.295) (-1010.018) [-1009.197] * (-1008.276) (-1009.881) (-1009.308) [-1009.147] -- 0:00:37
410000 -- (-1010.078) (-1009.184) [-1013.311] (-1007.452) * [-1007.705] (-1006.449) (-1009.132) (-1012.528) -- 0:00:37
Average standard deviation of split frequencies: 0.013100
410500 -- (-1008.784) (-1007.515) [-1009.535] (-1008.030) * (-1010.405) [-1006.745] (-1008.822) (-1009.072) -- 0:00:37
411000 -- [-1007.353] (-1007.137) (-1008.521) (-1011.415) * [-1008.372] (-1008.600) (-1008.098) (-1010.509) -- 0:00:37
411500 -- (-1007.307) [-1008.447] (-1007.900) (-1009.124) * (-1008.444) (-1007.727) [-1006.735] (-1010.648) -- 0:00:37
412000 -- (-1007.641) [-1008.664] (-1008.161) (-1010.038) * (-1007.991) [-1007.101] (-1009.250) (-1007.802) -- 0:00:37
412500 -- (-1011.231) [-1006.766] (-1009.381) (-1006.905) * (-1008.480) (-1007.514) [-1011.290] (-1007.122) -- 0:00:37
413000 -- (-1011.155) (-1009.146) [-1007.323] (-1011.491) * (-1009.150) [-1010.322] (-1008.075) (-1007.089) -- 0:00:36
413500 -- (-1008.147) (-1007.215) (-1008.863) [-1013.190] * (-1009.256) (-1010.348) [-1009.877] (-1008.297) -- 0:00:36
414000 -- (-1009.296) [-1010.277] (-1007.205) (-1012.162) * (-1010.946) [-1007.857] (-1009.605) (-1008.432) -- 0:00:36
414500 -- (-1006.923) (-1012.795) [-1009.473] (-1010.099) * (-1009.604) [-1008.275] (-1010.524) (-1007.073) -- 0:00:36
415000 -- (-1008.308) [-1009.486] (-1010.684) (-1008.890) * (-1009.414) (-1011.591) [-1010.857] (-1009.135) -- 0:00:36
Average standard deviation of split frequencies: 0.012890
415500 -- [-1009.264] (-1008.101) (-1009.024) (-1017.417) * [-1011.729] (-1011.332) (-1013.870) (-1008.650) -- 0:00:36
416000 -- (-1011.486) [-1008.601] (-1010.039) (-1015.655) * [-1007.516] (-1007.576) (-1012.950) (-1008.689) -- 0:00:36
416500 -- (-1011.470) [-1010.989] (-1011.899) (-1013.384) * (-1010.454) [-1009.987] (-1009.045) (-1010.543) -- 0:00:36
417000 -- [-1009.680] (-1010.029) (-1008.560) (-1009.648) * (-1009.122) (-1009.010) [-1011.486] (-1011.333) -- 0:00:36
417500 -- [-1008.667] (-1009.273) (-1009.058) (-1007.528) * [-1008.895] (-1009.370) (-1008.592) (-1009.779) -- 0:00:36
418000 -- [-1007.660] (-1007.800) (-1008.235) (-1007.825) * [-1009.199] (-1013.115) (-1007.900) (-1008.212) -- 0:00:36
418500 -- [-1007.393] (-1008.005) (-1009.955) (-1006.666) * (-1010.631) (-1011.472) [-1008.714] (-1008.221) -- 0:00:36
419000 -- (-1011.401) (-1009.662) (-1010.212) [-1008.141] * (-1009.991) [-1009.911] (-1007.368) (-1007.466) -- 0:00:36
419500 -- (-1007.048) [-1012.233] (-1007.585) (-1008.200) * (-1008.854) (-1007.750) [-1007.010] (-1011.210) -- 0:00:35
420000 -- (-1010.268) (-1007.530) (-1009.896) [-1008.290] * (-1011.801) (-1010.211) (-1008.666) [-1008.664] -- 0:00:37
Average standard deviation of split frequencies: 0.012187
420500 -- (-1008.653) (-1009.977) [-1014.033] (-1008.904) * (-1008.911) [-1009.222] (-1008.953) (-1014.008) -- 0:00:37
421000 -- [-1009.289] (-1010.284) (-1008.376) (-1008.531) * (-1008.105) [-1008.255] (-1009.913) (-1012.707) -- 0:00:37
421500 -- (-1010.228) (-1010.140) [-1012.219] (-1008.318) * [-1008.159] (-1007.290) (-1007.982) (-1009.345) -- 0:00:37
422000 -- (-1007.781) (-1009.543) (-1008.946) [-1008.910] * (-1008.017) [-1009.736] (-1008.465) (-1010.610) -- 0:00:36
422500 -- (-1010.443) [-1009.319] (-1011.443) (-1009.460) * [-1006.863] (-1009.529) (-1011.832) (-1008.816) -- 0:00:36
423000 -- (-1008.798) (-1007.868) (-1009.012) [-1009.461] * (-1008.258) [-1010.830] (-1010.103) (-1008.391) -- 0:00:36
423500 -- (-1010.290) (-1007.342) [-1009.128] (-1011.235) * [-1009.275] (-1009.863) (-1009.252) (-1015.236) -- 0:00:36
424000 -- (-1008.503) [-1007.397] (-1013.003) (-1007.694) * [-1012.800] (-1010.778) (-1007.928) (-1015.524) -- 0:00:36
424500 -- (-1019.274) (-1008.014) (-1011.309) [-1007.451] * (-1009.922) [-1007.729] (-1010.351) (-1010.041) -- 0:00:36
425000 -- (-1013.350) (-1010.184) (-1011.467) [-1006.861] * [-1008.276] (-1008.957) (-1009.822) (-1009.533) -- 0:00:36
Average standard deviation of split frequencies: 0.013214
425500 -- (-1020.069) [-1012.077] (-1010.787) (-1009.933) * (-1009.594) (-1011.775) (-1011.002) [-1007.538] -- 0:00:36
426000 -- (-1008.216) (-1008.453) [-1009.132] (-1009.844) * (-1007.546) [-1010.256] (-1006.999) (-1007.845) -- 0:00:36
426500 -- (-1011.927) [-1006.930] (-1010.640) (-1008.218) * (-1015.481) (-1009.799) [-1007.778] (-1012.970) -- 0:00:36
427000 -- (-1009.631) [-1007.004] (-1007.737) (-1009.860) * (-1008.195) (-1007.473) [-1008.002] (-1009.593) -- 0:00:36
427500 -- (-1007.172) (-1007.011) (-1009.777) [-1008.029] * [-1008.179] (-1009.633) (-1013.784) (-1008.543) -- 0:00:36
428000 -- (-1008.747) (-1007.935) [-1007.367] (-1010.490) * [-1009.160] (-1009.124) (-1009.398) (-1008.372) -- 0:00:36
428500 -- (-1007.591) (-1006.963) [-1008.693] (-1011.577) * [-1007.786] (-1009.644) (-1008.224) (-1007.830) -- 0:00:36
429000 -- (-1008.737) (-1007.029) [-1008.901] (-1011.282) * [-1009.416] (-1010.040) (-1010.350) (-1008.443) -- 0:00:35
429500 -- (-1007.695) (-1007.215) [-1009.791] (-1010.619) * [-1007.715] (-1009.400) (-1008.619) (-1008.920) -- 0:00:35
430000 -- (-1008.163) (-1007.687) [-1010.759] (-1008.923) * (-1009.318) (-1009.611) (-1011.604) [-1008.699] -- 0:00:35
Average standard deviation of split frequencies: 0.013272
430500 -- (-1008.247) (-1011.962) [-1014.330] (-1007.346) * (-1011.154) (-1008.435) (-1008.834) [-1006.970] -- 0:00:35
431000 -- (-1009.558) (-1010.298) (-1015.634) [-1007.659] * [-1010.457] (-1007.960) (-1008.442) (-1006.974) -- 0:00:35
431500 -- (-1012.930) [-1010.469] (-1011.045) (-1009.233) * (-1008.626) (-1007.969) (-1008.031) [-1006.965] -- 0:00:35
432000 -- [-1006.987] (-1008.084) (-1007.676) (-1008.904) * (-1008.778) [-1010.626] (-1011.223) (-1006.900) -- 0:00:35
432500 -- (-1007.449) [-1010.775] (-1006.979) (-1008.348) * (-1007.835) (-1012.387) [-1008.470] (-1015.714) -- 0:00:35
433000 -- (-1007.663) [-1008.652] (-1014.044) (-1011.570) * (-1006.693) (-1010.725) [-1011.405] (-1013.646) -- 0:00:35
433500 -- (-1011.815) [-1010.197] (-1015.107) (-1008.667) * [-1006.708] (-1008.432) (-1013.573) (-1012.475) -- 0:00:35
434000 -- [-1011.413] (-1010.089) (-1011.914) (-1009.315) * (-1007.922) (-1008.072) (-1014.567) [-1008.104] -- 0:00:35
434500 -- (-1012.879) (-1007.193) (-1008.728) [-1009.534] * (-1009.525) [-1010.321] (-1010.541) (-1011.589) -- 0:00:35
435000 -- (-1012.607) (-1008.313) (-1009.232) [-1007.872] * (-1009.123) [-1009.216] (-1008.215) (-1011.972) -- 0:00:35
Average standard deviation of split frequencies: 0.013583
435500 -- (-1010.162) (-1008.747) (-1007.874) [-1008.934] * (-1007.340) (-1007.700) (-1010.513) [-1008.082] -- 0:00:34
436000 -- (-1008.767) [-1007.840] (-1013.437) (-1008.262) * (-1007.495) [-1008.832] (-1007.659) (-1009.027) -- 0:00:36
436500 -- [-1009.847] (-1007.353) (-1008.136) (-1007.934) * [-1010.931] (-1007.891) (-1008.855) (-1007.546) -- 0:00:36
437000 -- (-1008.703) [-1007.492] (-1008.451) (-1007.901) * (-1008.847) (-1008.558) (-1010.025) [-1011.094] -- 0:00:36
437500 -- (-1013.795) (-1008.632) [-1008.517] (-1009.288) * (-1006.547) [-1008.375] (-1008.431) (-1009.786) -- 0:00:36
438000 -- [-1010.012] (-1013.240) (-1010.700) (-1011.600) * (-1008.017) (-1009.632) (-1009.221) [-1009.952] -- 0:00:35
438500 -- (-1008.843) (-1009.116) [-1008.751] (-1009.801) * (-1007.878) [-1009.286] (-1008.122) (-1007.747) -- 0:00:35
439000 -- (-1008.916) (-1007.612) [-1007.791] (-1010.823) * (-1010.820) (-1011.353) [-1007.440] (-1009.000) -- 0:00:35
439500 -- [-1010.022] (-1008.134) (-1008.920) (-1011.183) * (-1009.559) (-1010.682) [-1008.965] (-1007.802) -- 0:00:35
440000 -- [-1009.839] (-1011.778) (-1011.216) (-1007.856) * (-1007.627) [-1015.128] (-1012.969) (-1008.335) -- 0:00:35
Average standard deviation of split frequencies: 0.012703
440500 -- [-1009.018] (-1009.546) (-1008.038) (-1007.542) * (-1007.645) (-1011.597) [-1006.972] (-1010.582) -- 0:00:35
441000 -- (-1008.621) [-1007.779] (-1008.315) (-1007.039) * (-1009.206) (-1008.596) [-1007.133] (-1009.335) -- 0:00:35
441500 -- (-1007.309) [-1010.937] (-1010.116) (-1007.935) * (-1008.356) (-1007.365) [-1009.618] (-1007.924) -- 0:00:35
442000 -- (-1008.083) (-1011.369) (-1010.954) [-1007.308] * (-1007.598) (-1008.378) [-1008.552] (-1009.193) -- 0:00:35
442500 -- (-1011.429) (-1009.232) [-1007.096] (-1008.999) * (-1011.662) (-1007.767) [-1008.117] (-1008.960) -- 0:00:35
443000 -- (-1007.411) (-1008.348) [-1007.833] (-1010.406) * (-1011.030) (-1008.825) [-1007.886] (-1007.145) -- 0:00:35
443500 -- [-1008.074] (-1009.181) (-1008.061) (-1008.836) * (-1010.231) (-1009.319) [-1006.966] (-1007.895) -- 0:00:35
444000 -- (-1007.771) [-1010.268] (-1008.343) (-1007.889) * [-1008.022] (-1008.787) (-1007.171) (-1007.266) -- 0:00:35
444500 -- (-1010.894) (-1010.395) (-1010.065) [-1008.423] * (-1008.606) (-1007.447) [-1009.640] (-1008.076) -- 0:00:34
445000 -- (-1013.027) [-1012.344] (-1008.185) (-1007.752) * (-1008.786) [-1008.612] (-1010.160) (-1007.246) -- 0:00:34
Average standard deviation of split frequencies: 0.012621
445500 -- (-1010.184) (-1011.849) [-1007.702] (-1008.768) * (-1008.722) [-1009.617] (-1009.638) (-1007.310) -- 0:00:34
446000 -- (-1010.189) (-1012.179) (-1010.420) [-1008.330] * (-1008.224) (-1007.842) (-1014.470) [-1010.477] -- 0:00:34
446500 -- (-1010.385) (-1006.641) [-1012.598] (-1008.482) * (-1011.931) (-1008.698) (-1012.404) [-1009.463] -- 0:00:34
447000 -- [-1007.457] (-1008.584) (-1013.279) (-1013.945) * (-1007.846) [-1009.687] (-1011.271) (-1007.666) -- 0:00:34
447500 -- (-1007.549) (-1007.476) (-1011.502) [-1010.452] * (-1007.146) (-1007.842) [-1010.532] (-1009.040) -- 0:00:34
448000 -- (-1009.469) (-1007.677) [-1008.804] (-1006.992) * (-1010.366) (-1008.049) (-1010.047) [-1009.685] -- 0:00:34
448500 -- (-1009.629) (-1007.405) (-1009.761) [-1010.035] * (-1008.791) (-1009.621) (-1014.030) [-1008.078] -- 0:00:34
449000 -- (-1008.910) [-1011.000] (-1010.336) (-1013.104) * (-1012.286) (-1013.181) [-1008.134] (-1010.559) -- 0:00:34
449500 -- (-1010.711) [-1007.818] (-1010.733) (-1012.863) * (-1010.927) (-1009.491) (-1009.309) [-1008.377] -- 0:00:34
450000 -- [-1010.211] (-1013.894) (-1009.418) (-1008.676) * (-1008.516) [-1006.794] (-1014.304) (-1008.391) -- 0:00:34
Average standard deviation of split frequencies: 0.013106
450500 -- (-1008.937) (-1009.188) [-1008.869] (-1009.483) * (-1010.836) (-1008.150) (-1011.351) [-1008.844] -- 0:00:34
451000 -- [-1008.148] (-1008.285) (-1009.756) (-1009.789) * (-1007.859) (-1008.307) [-1009.376] (-1008.310) -- 0:00:34
451500 -- [-1014.973] (-1008.991) (-1008.840) (-1010.442) * (-1009.294) [-1008.996] (-1007.941) (-1007.962) -- 0:00:34
452000 -- (-1013.511) (-1009.498) [-1007.481] (-1007.501) * [-1009.365] (-1008.709) (-1008.678) (-1012.553) -- 0:00:33
452500 -- (-1012.145) (-1007.816) (-1010.250) [-1010.636] * (-1009.467) [-1008.646] (-1010.065) (-1009.106) -- 0:00:35
453000 -- (-1011.797) (-1007.967) [-1007.876] (-1013.358) * (-1007.914) (-1010.990) (-1008.367) [-1006.854] -- 0:00:35
453500 -- [-1009.083] (-1007.967) (-1008.052) (-1009.814) * (-1009.363) [-1007.077] (-1014.038) (-1009.525) -- 0:00:34
454000 -- [-1010.284] (-1008.970) (-1009.441) (-1007.378) * (-1009.080) (-1006.953) (-1010.453) [-1007.179] -- 0:00:34
454500 -- [-1008.927] (-1009.885) (-1008.035) (-1007.053) * (-1008.388) (-1008.032) (-1009.649) [-1010.454] -- 0:00:34
455000 -- (-1008.298) [-1009.132] (-1010.168) (-1009.545) * [-1009.893] (-1006.656) (-1009.266) (-1008.529) -- 0:00:34
Average standard deviation of split frequencies: 0.013310
455500 -- (-1008.104) [-1008.383] (-1010.896) (-1012.188) * (-1010.297) [-1006.657] (-1007.368) (-1008.401) -- 0:00:34
456000 -- (-1013.154) (-1009.220) [-1009.799] (-1009.909) * (-1011.732) (-1011.670) (-1007.361) [-1008.031] -- 0:00:34
456500 -- (-1008.494) (-1007.748) (-1007.791) [-1010.164] * [-1007.735] (-1014.546) (-1007.122) (-1007.718) -- 0:00:34
457000 -- (-1007.204) [-1009.097] (-1008.402) (-1011.969) * [-1009.588] (-1009.246) (-1008.805) (-1009.120) -- 0:00:34
457500 -- [-1009.428] (-1008.535) (-1012.080) (-1010.541) * (-1008.344) (-1008.772) (-1008.030) [-1009.093] -- 0:00:34
458000 -- (-1007.432) [-1007.729] (-1011.517) (-1010.397) * [-1008.150] (-1011.856) (-1008.695) (-1012.661) -- 0:00:34
458500 -- (-1006.997) (-1007.229) [-1009.135] (-1014.564) * (-1008.921) (-1007.857) [-1011.032] (-1010.481) -- 0:00:34
459000 -- [-1006.775] (-1010.669) (-1009.050) (-1009.020) * (-1007.531) [-1007.877] (-1008.079) (-1014.242) -- 0:00:34
459500 -- [-1011.733] (-1011.056) (-1011.860) (-1007.277) * (-1013.796) (-1009.000) [-1007.234] (-1013.439) -- 0:00:34
460000 -- (-1008.052) (-1010.079) [-1007.832] (-1008.306) * [-1007.305] (-1008.452) (-1006.795) (-1010.180) -- 0:00:34
Average standard deviation of split frequencies: 0.013495
460500 -- [-1011.941] (-1010.981) (-1007.011) (-1008.291) * (-1007.678) [-1008.082] (-1008.443) (-1009.240) -- 0:00:33
461000 -- (-1009.366) [-1009.728] (-1012.672) (-1008.530) * [-1010.690] (-1007.863) (-1008.771) (-1011.299) -- 0:00:33
461500 -- (-1009.763) [-1007.460] (-1008.135) (-1007.187) * (-1012.784) (-1012.401) [-1007.800] (-1012.177) -- 0:00:33
462000 -- (-1007.003) (-1006.661) (-1009.749) [-1007.024] * (-1012.204) [-1008.126] (-1008.905) (-1010.020) -- 0:00:33
462500 -- (-1012.098) (-1011.410) [-1011.043] (-1010.063) * (-1010.593) (-1007.470) (-1014.710) [-1012.612] -- 0:00:33
463000 -- (-1014.937) (-1011.696) [-1008.627] (-1009.020) * (-1011.266) (-1006.743) [-1007.507] (-1014.286) -- 0:00:33
463500 -- (-1013.248) [-1007.546] (-1010.075) (-1008.136) * [-1009.551] (-1009.251) (-1007.165) (-1009.213) -- 0:00:33
464000 -- (-1009.825) [-1007.937] (-1007.195) (-1008.730) * [-1008.610] (-1009.440) (-1008.129) (-1010.365) -- 0:00:33
464500 -- (-1009.194) (-1008.047) [-1007.311] (-1008.408) * (-1009.818) (-1006.857) [-1008.358] (-1007.729) -- 0:00:33
465000 -- [-1008.327] (-1007.806) (-1008.607) (-1008.158) * (-1010.351) (-1007.646) [-1008.292] (-1012.601) -- 0:00:33
Average standard deviation of split frequencies: 0.012645
465500 -- [-1007.303] (-1009.054) (-1008.416) (-1012.782) * [-1008.230] (-1010.276) (-1008.414) (-1008.829) -- 0:00:33
466000 -- (-1008.405) [-1007.046] (-1008.772) (-1008.951) * [-1007.337] (-1008.976) (-1011.812) (-1014.593) -- 0:00:33
466500 -- (-1010.673) (-1008.749) [-1009.650] (-1008.929) * [-1010.993] (-1010.505) (-1009.181) (-1008.438) -- 0:00:33
467000 -- (-1011.257) (-1012.233) [-1009.346] (-1010.069) * (-1010.932) [-1007.948] (-1011.956) (-1008.602) -- 0:00:33
467500 -- (-1010.615) [-1011.355] (-1012.398) (-1010.824) * (-1008.578) (-1009.381) [-1010.060] (-1011.742) -- 0:00:33
468000 -- (-1007.334) (-1010.646) [-1009.620] (-1008.684) * (-1008.103) [-1009.533] (-1009.627) (-1010.415) -- 0:00:32
468500 -- [-1007.647] (-1011.472) (-1010.445) (-1009.716) * (-1009.964) (-1008.437) [-1006.909] (-1007.818) -- 0:00:32
469000 -- (-1008.929) [-1009.329] (-1008.633) (-1014.753) * (-1008.996) [-1007.888] (-1008.898) (-1007.471) -- 0:00:33
469500 -- (-1011.573) [-1008.786] (-1008.743) (-1007.555) * (-1008.908) (-1011.008) (-1013.456) [-1010.906] -- 0:00:33
470000 -- [-1008.657] (-1011.462) (-1011.968) (-1006.869) * (-1010.662) (-1010.234) (-1014.475) [-1008.797] -- 0:00:33
Average standard deviation of split frequencies: 0.012457
470500 -- [-1009.151] (-1008.222) (-1010.113) (-1008.245) * [-1010.077] (-1008.031) (-1014.673) (-1011.832) -- 0:00:33
471000 -- (-1009.219) (-1007.277) (-1012.481) [-1007.609] * (-1008.152) [-1007.513] (-1009.512) (-1011.993) -- 0:00:33
471500 -- (-1012.413) (-1009.053) (-1011.041) [-1008.610] * (-1012.404) (-1011.102) [-1009.685] (-1013.530) -- 0:00:33
472000 -- (-1009.732) (-1008.586) (-1007.587) [-1009.171] * (-1010.685) [-1008.333] (-1008.033) (-1011.172) -- 0:00:33
472500 -- (-1008.725) (-1009.693) [-1007.531] (-1011.398) * (-1010.250) [-1009.733] (-1013.286) (-1009.415) -- 0:00:33
473000 -- (-1007.885) (-1009.366) [-1009.115] (-1010.437) * [-1006.879] (-1008.355) (-1012.685) (-1009.272) -- 0:00:33
473500 -- (-1010.096) (-1011.976) (-1007.681) [-1006.651] * (-1009.047) (-1007.452) (-1008.767) [-1007.805] -- 0:00:33
474000 -- (-1011.046) [-1008.502] (-1009.082) (-1008.015) * (-1009.919) (-1008.262) [-1009.586] (-1008.249) -- 0:00:33
474500 -- [-1008.992] (-1009.831) (-1007.762) (-1007.334) * (-1006.716) [-1007.352] (-1010.901) (-1007.342) -- 0:00:33
475000 -- (-1012.465) (-1007.549) [-1008.348] (-1009.532) * (-1007.828) [-1007.057] (-1014.552) (-1007.420) -- 0:00:33
Average standard deviation of split frequencies: 0.011698
475500 -- (-1010.611) (-1011.074) [-1010.903] (-1010.270) * (-1011.326) (-1007.451) [-1014.301] (-1011.530) -- 0:00:33
476000 -- (-1007.956) [-1009.786] (-1008.157) (-1009.629) * [-1008.123] (-1011.112) (-1009.505) (-1009.689) -- 0:00:33
476500 -- (-1011.100) [-1009.885] (-1011.159) (-1007.557) * (-1010.150) (-1009.204) [-1008.892] (-1007.030) -- 0:00:32
477000 -- (-1009.041) (-1014.187) [-1006.763] (-1007.376) * (-1013.653) (-1011.547) [-1011.750] (-1010.259) -- 0:00:32
477500 -- (-1014.435) [-1009.991] (-1008.954) (-1009.459) * (-1009.609) (-1010.025) (-1011.313) [-1009.462] -- 0:00:32
478000 -- (-1010.232) (-1009.474) [-1010.947] (-1009.402) * (-1008.428) (-1008.135) (-1015.286) [-1008.390] -- 0:00:32
478500 -- [-1009.385] (-1010.478) (-1009.825) (-1010.436) * (-1007.325) (-1009.363) (-1011.568) [-1007.929] -- 0:00:32
479000 -- (-1009.968) (-1008.605) (-1008.349) [-1014.019] * [-1007.615] (-1006.847) (-1009.826) (-1008.687) -- 0:00:32
479500 -- [-1008.067] (-1009.632) (-1006.879) (-1010.637) * (-1008.254) [-1009.065] (-1008.532) (-1009.135) -- 0:00:32
480000 -- (-1007.276) (-1008.617) [-1006.887] (-1010.176) * [-1008.811] (-1009.386) (-1008.427) (-1009.485) -- 0:00:32
Average standard deviation of split frequencies: 0.012014
480500 -- (-1011.190) (-1009.540) [-1007.287] (-1008.797) * (-1009.722) (-1009.125) [-1007.641] (-1007.094) -- 0:00:32
481000 -- (-1007.374) (-1008.304) [-1008.967] (-1010.558) * [-1008.171] (-1007.535) (-1009.219) (-1010.117) -- 0:00:32
481500 -- (-1012.628) (-1008.242) (-1011.072) [-1008.052] * (-1010.061) [-1011.702] (-1007.358) (-1008.720) -- 0:00:32
482000 -- (-1007.873) [-1006.701] (-1007.034) (-1009.428) * (-1011.317) (-1012.262) [-1009.420] (-1008.296) -- 0:00:32
482500 -- (-1010.401) (-1007.571) (-1007.472) [-1009.849] * (-1010.922) (-1009.363) [-1008.115] (-1010.670) -- 0:00:32
483000 -- (-1008.159) [-1008.370] (-1007.472) (-1011.757) * [-1009.984] (-1008.205) (-1007.833) (-1009.015) -- 0:00:32
483500 -- (-1016.143) (-1006.929) [-1008.603] (-1011.747) * (-1009.875) (-1008.809) [-1010.002] (-1010.172) -- 0:00:32
484000 -- (-1011.834) (-1008.127) [-1008.195] (-1009.774) * (-1009.251) [-1009.281] (-1007.983) (-1010.032) -- 0:00:31
484500 -- (-1010.602) (-1007.021) (-1008.878) [-1010.318] * (-1007.406) [-1007.565] (-1006.578) (-1011.348) -- 0:00:31
485000 -- (-1008.646) [-1010.171] (-1009.081) (-1011.774) * (-1009.047) (-1008.059) [-1007.162] (-1009.815) -- 0:00:32
Average standard deviation of split frequencies: 0.012367
485500 -- (-1008.685) (-1008.254) (-1008.226) [-1008.706] * [-1009.473] (-1009.678) (-1007.902) (-1006.890) -- 0:00:32
486000 -- (-1007.973) (-1008.213) [-1010.468] (-1007.905) * (-1009.524) (-1008.100) (-1007.131) [-1007.553] -- 0:00:32
486500 -- (-1008.032) (-1010.256) (-1011.185) [-1008.244] * (-1008.752) (-1007.937) [-1011.010] (-1007.813) -- 0:00:32
487000 -- (-1008.383) [-1007.592] (-1008.784) (-1007.648) * (-1009.184) (-1008.781) (-1008.711) [-1009.166] -- 0:00:32
487500 -- (-1011.711) [-1007.770] (-1006.657) (-1007.726) * (-1009.291) (-1015.063) [-1007.911] (-1007.712) -- 0:00:32
488000 -- [-1007.496] (-1008.227) (-1008.054) (-1009.611) * [-1007.791] (-1013.447) (-1008.316) (-1009.279) -- 0:00:32
488500 -- (-1008.168) (-1009.967) [-1006.754] (-1008.493) * [-1008.272] (-1010.689) (-1006.990) (-1008.407) -- 0:00:32
489000 -- [-1008.082] (-1007.635) (-1010.627) (-1006.880) * (-1010.224) (-1016.638) (-1006.990) [-1009.117] -- 0:00:32
489500 -- [-1008.181] (-1007.350) (-1008.412) (-1007.532) * (-1008.640) [-1009.100] (-1007.371) (-1008.582) -- 0:00:32
490000 -- [-1007.752] (-1010.475) (-1009.926) (-1009.846) * (-1008.730) (-1010.726) [-1007.627] (-1009.087) -- 0:00:32
Average standard deviation of split frequencies: 0.012069
490500 -- (-1009.992) (-1016.118) (-1009.903) [-1011.457] * (-1008.287) [-1010.395] (-1008.895) (-1012.596) -- 0:00:32
491000 -- (-1007.790) (-1008.756) (-1009.766) [-1008.670] * (-1008.225) [-1007.172] (-1011.719) (-1010.626) -- 0:00:32
491500 -- [-1006.934] (-1010.031) (-1007.210) (-1007.068) * [-1008.500] (-1007.649) (-1008.648) (-1010.588) -- 0:00:32
492000 -- (-1007.543) [-1009.683] (-1011.252) (-1007.029) * [-1010.284] (-1008.418) (-1008.404) (-1010.849) -- 0:00:32
492500 -- (-1007.556) (-1008.376) (-1009.130) [-1008.742] * (-1010.403) [-1009.576] (-1007.524) (-1011.641) -- 0:00:31
493000 -- [-1009.476] (-1010.375) (-1007.779) (-1007.923) * [-1009.342] (-1010.775) (-1009.062) (-1007.883) -- 0:00:31
493500 -- (-1008.771) (-1007.988) (-1015.756) [-1010.582] * (-1007.600) (-1008.861) (-1011.057) [-1008.522] -- 0:00:31
494000 -- (-1011.272) [-1008.429] (-1009.227) (-1009.260) * [-1007.897] (-1012.895) (-1010.042) (-1009.371) -- 0:00:31
494500 -- [-1008.953] (-1008.137) (-1009.102) (-1008.410) * (-1010.720) (-1010.226) [-1014.206] (-1009.242) -- 0:00:31
495000 -- (-1007.818) [-1007.380] (-1009.090) (-1012.408) * [-1011.665] (-1007.397) (-1009.027) (-1013.494) -- 0:00:31
Average standard deviation of split frequencies: 0.012712
495500 -- [-1011.749] (-1007.721) (-1010.379) (-1011.484) * (-1009.035) [-1008.244] (-1011.087) (-1012.904) -- 0:00:31
496000 -- (-1016.216) (-1009.793) (-1007.943) [-1008.149] * (-1008.363) (-1009.596) (-1007.907) [-1012.449] -- 0:00:31
496500 -- (-1009.571) (-1007.922) (-1009.029) [-1009.266] * (-1010.484) (-1010.477) [-1011.248] (-1007.983) -- 0:00:31
497000 -- (-1008.675) (-1008.879) [-1007.718] (-1009.764) * (-1006.819) (-1008.733) (-1009.068) [-1006.873] -- 0:00:31
497500 -- [-1007.165] (-1006.905) (-1008.333) (-1006.955) * (-1010.145) [-1010.606] (-1009.319) (-1009.411) -- 0:00:31
498000 -- (-1008.641) (-1007.233) [-1008.355] (-1010.624) * (-1007.266) [-1007.902] (-1013.444) (-1008.274) -- 0:00:31
498500 -- (-1014.020) [-1007.047] (-1007.961) (-1011.984) * (-1008.170) (-1010.502) (-1009.787) [-1012.782] -- 0:00:31
499000 -- (-1007.868) [-1007.595] (-1013.108) (-1010.378) * (-1009.501) [-1011.190] (-1007.859) (-1009.225) -- 0:00:31
499500 -- (-1010.809) (-1008.260) [-1008.781] (-1009.917) * [-1006.747] (-1009.103) (-1012.772) (-1008.400) -- 0:00:31
500000 -- [-1008.689] (-1009.843) (-1011.932) (-1007.613) * (-1011.728) (-1007.838) (-1012.227) [-1007.418] -- 0:00:31
Average standard deviation of split frequencies: 0.012946
500500 -- (-1007.209) (-1007.128) (-1007.836) [-1007.244] * (-1007.770) [-1007.554] (-1013.256) (-1007.663) -- 0:00:30
501000 -- (-1014.949) (-1007.774) (-1010.030) [-1007.248] * [-1009.114] (-1013.066) (-1012.449) (-1010.810) -- 0:00:31
501500 -- (-1014.225) (-1008.699) (-1010.364) [-1007.325] * (-1009.024) (-1009.232) [-1008.648] (-1007.265) -- 0:00:31
502000 -- [-1011.418] (-1007.664) (-1009.963) (-1007.325) * [-1008.183] (-1009.139) (-1009.493) (-1006.600) -- 0:00:31
502500 -- (-1012.146) [-1008.965] (-1009.115) (-1008.007) * [-1013.271] (-1007.126) (-1011.798) (-1006.602) -- 0:00:31
503000 -- [-1007.337] (-1009.719) (-1008.973) (-1011.338) * (-1009.429) (-1008.045) [-1007.781] (-1008.800) -- 0:00:31
503500 -- (-1008.115) (-1008.923) [-1009.837] (-1008.006) * [-1011.698] (-1008.156) (-1009.800) (-1008.171) -- 0:00:31
504000 -- (-1009.707) (-1015.268) (-1011.583) [-1010.588] * (-1008.552) [-1009.516] (-1008.682) (-1008.063) -- 0:00:31
504500 -- [-1007.313] (-1009.925) (-1011.829) (-1007.806) * [-1008.476] (-1010.453) (-1008.999) (-1008.726) -- 0:00:31
505000 -- (-1008.369) (-1008.993) [-1007.811] (-1009.468) * (-1007.989) [-1008.144] (-1010.454) (-1007.667) -- 0:00:31
Average standard deviation of split frequencies: 0.013207
505500 -- [-1008.645] (-1006.806) (-1008.050) (-1008.992) * [-1009.625] (-1009.777) (-1008.294) (-1010.197) -- 0:00:31
506000 -- (-1012.609) (-1008.050) (-1008.688) [-1009.611] * [-1010.197] (-1008.221) (-1008.011) (-1009.910) -- 0:00:31
506500 -- (-1011.727) (-1008.713) (-1010.530) [-1007.859] * [-1007.963] (-1009.330) (-1009.269) (-1010.777) -- 0:00:31
507000 -- [-1008.521] (-1008.142) (-1008.802) (-1006.823) * (-1015.332) (-1009.414) (-1007.498) [-1008.696] -- 0:00:31
507500 -- (-1006.559) [-1009.382] (-1010.448) (-1008.397) * (-1011.340) (-1009.205) (-1010.230) [-1008.612] -- 0:00:31
508000 -- (-1007.194) (-1009.251) [-1009.778] (-1006.832) * [-1009.851] (-1008.754) (-1010.232) (-1008.855) -- 0:00:30
508500 -- (-1008.625) [-1008.718] (-1008.507) (-1009.664) * (-1009.694) [-1008.641] (-1009.461) (-1010.648) -- 0:00:30
509000 -- (-1008.296) (-1006.544) [-1006.798] (-1010.923) * (-1008.738) (-1007.915) [-1007.846] (-1007.491) -- 0:00:30
509500 -- (-1008.163) (-1010.096) (-1009.376) [-1007.974] * (-1011.747) (-1012.265) [-1013.046] (-1009.749) -- 0:00:30
510000 -- [-1007.563] (-1007.810) (-1007.834) (-1011.858) * (-1009.103) (-1012.825) [-1007.609] (-1009.801) -- 0:00:30
Average standard deviation of split frequencies: 0.013684
510500 -- (-1006.621) (-1010.049) [-1008.038] (-1007.322) * (-1008.316) (-1016.647) [-1007.819] (-1014.414) -- 0:00:30
511000 -- (-1008.503) (-1008.913) (-1009.489) [-1007.815] * (-1009.338) (-1012.549) [-1007.994] (-1008.605) -- 0:00:30
511500 -- [-1008.095] (-1010.435) (-1008.508) (-1007.803) * [-1007.269] (-1008.444) (-1009.349) (-1007.450) -- 0:00:30
512000 -- (-1008.388) [-1009.860] (-1010.942) (-1018.953) * (-1008.436) [-1007.373] (-1007.910) (-1006.584) -- 0:00:30
512500 -- (-1007.762) (-1009.314) (-1007.955) [-1006.798] * (-1008.965) (-1008.072) (-1007.633) [-1012.969] -- 0:00:30
513000 -- (-1010.606) (-1006.884) [-1009.459] (-1009.506) * [-1007.030] (-1010.022) (-1009.415) (-1007.345) -- 0:00:30
513500 -- (-1016.348) [-1008.784] (-1007.952) (-1009.382) * (-1009.102) (-1007.702) (-1009.875) [-1009.306] -- 0:00:30
514000 -- [-1012.476] (-1009.090) (-1009.559) (-1008.159) * (-1008.633) (-1008.031) (-1014.238) [-1007.599] -- 0:00:30
514500 -- (-1008.377) (-1008.691) (-1009.654) [-1007.854] * (-1009.798) (-1009.328) (-1010.128) [-1007.604] -- 0:00:30
515000 -- [-1007.779] (-1010.766) (-1009.155) (-1013.616) * (-1007.662) (-1008.026) (-1008.064) [-1008.756] -- 0:00:30
Average standard deviation of split frequencies: 0.014566
515500 -- [-1007.841] (-1009.857) (-1008.496) (-1007.868) * [-1007.891] (-1009.567) (-1008.181) (-1010.470) -- 0:00:30
516000 -- (-1008.073) (-1009.174) (-1010.534) [-1007.338] * (-1008.043) (-1008.485) (-1007.048) [-1009.861] -- 0:00:30
516500 -- (-1008.857) [-1009.611] (-1009.024) (-1008.526) * (-1010.093) (-1008.903) [-1009.563] (-1011.203) -- 0:00:29
517000 -- (-1007.822) [-1007.813] (-1010.420) (-1009.591) * [-1007.574] (-1010.048) (-1010.078) (-1011.979) -- 0:00:29
517500 -- (-1008.516) (-1009.213) (-1009.002) [-1007.885] * (-1010.353) (-1012.564) [-1008.317] (-1012.429) -- 0:00:30
518000 -- (-1008.247) (-1008.976) [-1007.941] (-1007.417) * (-1012.607) (-1013.790) (-1008.917) [-1009.218] -- 0:00:30
518500 -- [-1007.772] (-1008.765) (-1006.940) (-1009.623) * (-1008.386) [-1006.845] (-1011.344) (-1010.212) -- 0:00:30
519000 -- [-1008.246] (-1007.858) (-1007.414) (-1009.180) * [-1012.234] (-1007.012) (-1013.828) (-1009.699) -- 0:00:30
519500 -- (-1009.418) (-1008.074) [-1008.312] (-1008.986) * (-1014.899) [-1006.860] (-1010.199) (-1010.207) -- 0:00:30
520000 -- (-1007.770) (-1011.672) (-1007.406) [-1008.219] * (-1008.643) (-1007.446) [-1011.683] (-1012.056) -- 0:00:30
Average standard deviation of split frequencies: 0.014436
520500 -- (-1007.905) (-1019.960) [-1009.667] (-1008.493) * (-1009.324) [-1008.339] (-1007.371) (-1007.613) -- 0:00:30
521000 -- (-1010.633) [-1008.015] (-1011.013) (-1008.578) * (-1009.802) (-1010.253) (-1007.512) [-1007.831] -- 0:00:30
521500 -- [-1008.267] (-1007.170) (-1010.627) (-1009.945) * (-1009.407) (-1009.200) (-1007.025) [-1007.990] -- 0:00:30
522000 -- [-1009.102] (-1007.229) (-1007.822) (-1010.343) * (-1008.596) (-1008.338) [-1008.539] (-1008.714) -- 0:00:30
522500 -- (-1007.744) [-1007.194] (-1008.720) (-1008.650) * (-1010.191) (-1008.025) (-1014.063) [-1007.525] -- 0:00:30
523000 -- (-1008.838) [-1008.410] (-1007.020) (-1006.759) * (-1008.918) (-1009.599) (-1015.459) [-1007.184] -- 0:00:30
523500 -- (-1012.279) (-1008.589) [-1008.222] (-1008.514) * (-1009.901) [-1009.574] (-1011.570) (-1010.489) -- 0:00:30
524000 -- (-1011.217) (-1008.436) [-1009.855] (-1007.807) * [-1010.132] (-1008.218) (-1014.158) (-1010.799) -- 0:00:29
524500 -- (-1009.914) (-1007.510) (-1012.659) [-1008.034] * (-1011.866) (-1007.670) (-1016.437) [-1009.794] -- 0:00:29
525000 -- (-1009.798) [-1007.375] (-1009.668) (-1007.387) * (-1007.884) (-1008.619) [-1011.280] (-1011.037) -- 0:00:29
Average standard deviation of split frequencies: 0.014240
525500 -- (-1010.897) (-1009.461) [-1009.093] (-1010.218) * (-1007.661) [-1008.935] (-1012.683) (-1011.660) -- 0:00:29
526000 -- [-1008.648] (-1008.055) (-1010.726) (-1009.972) * (-1011.659) (-1007.568) [-1008.752] (-1010.713) -- 0:00:29
526500 -- (-1008.712) [-1010.471] (-1007.237) (-1009.877) * (-1007.768) [-1006.618] (-1010.213) (-1007.272) -- 0:00:29
527000 -- (-1015.594) (-1010.248) [-1007.223] (-1007.899) * (-1008.433) (-1010.786) [-1008.486] (-1009.375) -- 0:00:29
527500 -- (-1013.135) (-1014.140) [-1007.613] (-1008.745) * (-1008.473) (-1010.094) (-1009.374) [-1012.498] -- 0:00:29
528000 -- (-1010.070) (-1013.626) [-1011.816] (-1009.918) * (-1010.158) (-1008.087) (-1014.498) [-1010.738] -- 0:00:29
528500 -- (-1015.784) (-1012.218) (-1010.917) [-1007.187] * (-1006.931) [-1011.767] (-1009.062) (-1007.352) -- 0:00:29
529000 -- [-1011.022] (-1016.824) (-1008.878) (-1008.844) * (-1007.505) [-1009.619] (-1011.739) (-1007.457) -- 0:00:29
529500 -- (-1008.694) (-1008.055) (-1009.401) [-1007.235] * (-1007.624) (-1007.586) (-1009.222) [-1008.188] -- 0:00:29
530000 -- (-1008.717) (-1007.958) [-1010.012] (-1007.405) * (-1008.767) (-1007.969) (-1008.041) [-1015.330] -- 0:00:29
Average standard deviation of split frequencies: 0.013522
530500 -- (-1009.348) (-1009.113) [-1008.212] (-1009.680) * (-1006.914) [-1008.038] (-1009.692) (-1012.117) -- 0:00:29
531000 -- (-1012.259) (-1009.085) [-1007.837] (-1010.366) * (-1007.568) [-1011.015] (-1008.039) (-1009.716) -- 0:00:29
531500 -- (-1015.400) (-1008.089) [-1007.121] (-1014.420) * (-1009.486) [-1008.336] (-1008.144) (-1008.493) -- 0:00:29
532000 -- (-1011.017) [-1009.290] (-1008.553) (-1009.946) * (-1010.492) (-1006.722) [-1008.836] (-1013.458) -- 0:00:29
532500 -- (-1008.021) [-1009.160] (-1011.407) (-1009.032) * (-1010.166) [-1008.045] (-1010.274) (-1009.917) -- 0:00:28
533000 -- (-1009.581) (-1012.815) [-1011.649] (-1010.267) * [-1007.618] (-1010.296) (-1009.450) (-1012.684) -- 0:00:29
533500 -- (-1008.256) [-1009.251] (-1010.263) (-1009.376) * (-1011.399) [-1010.874] (-1009.922) (-1011.087) -- 0:00:29
534000 -- [-1007.734] (-1008.730) (-1007.349) (-1009.330) * [-1008.529] (-1011.183) (-1007.859) (-1007.695) -- 0:00:29
534500 -- (-1010.868) (-1009.156) [-1007.494] (-1009.089) * [-1008.304] (-1006.993) (-1009.338) (-1008.762) -- 0:00:29
535000 -- (-1008.605) [-1008.689] (-1012.156) (-1008.041) * (-1009.771) [-1010.223] (-1009.753) (-1008.530) -- 0:00:29
Average standard deviation of split frequencies: 0.013388
535500 -- (-1010.447) (-1008.117) (-1009.686) [-1008.299] * (-1009.608) [-1009.705] (-1008.848) (-1007.512) -- 0:00:29
536000 -- [-1008.497] (-1008.003) (-1010.954) (-1011.942) * (-1008.029) (-1011.204) (-1008.550) [-1007.722] -- 0:00:29
536500 -- (-1007.166) [-1008.179] (-1010.573) (-1009.294) * (-1009.241) (-1016.369) (-1011.006) [-1007.136] -- 0:00:29
537000 -- (-1009.013) [-1007.588] (-1007.841) (-1010.740) * [-1010.474] (-1008.397) (-1014.694) (-1012.444) -- 0:00:29
537500 -- [-1007.553] (-1007.316) (-1008.289) (-1006.638) * (-1008.451) (-1008.339) (-1010.759) [-1012.704] -- 0:00:29
538000 -- [-1008.777] (-1010.146) (-1008.364) (-1007.115) * (-1009.432) (-1007.680) (-1009.565) [-1012.067] -- 0:00:29
538500 -- [-1007.056] (-1012.957) (-1012.461) (-1008.720) * [-1009.341] (-1007.680) (-1008.330) (-1011.022) -- 0:00:29
539000 -- (-1007.031) (-1013.425) [-1008.667] (-1007.965) * (-1012.205) (-1011.092) [-1009.247] (-1010.428) -- 0:00:29
539500 -- [-1007.486] (-1007.597) (-1007.722) (-1010.184) * (-1011.011) [-1008.989] (-1010.576) (-1009.409) -- 0:00:29
540000 -- (-1007.217) (-1008.457) (-1007.846) [-1009.171] * (-1014.130) (-1010.473) (-1007.852) [-1007.704] -- 0:00:28
Average standard deviation of split frequencies: 0.013078
540500 -- (-1008.126) (-1010.591) [-1008.584] (-1011.525) * (-1009.590) (-1020.550) (-1009.996) [-1008.608] -- 0:00:28
541000 -- [-1006.853] (-1008.929) (-1010.556) (-1009.452) * (-1008.983) (-1011.400) [-1007.063] (-1008.765) -- 0:00:28
541500 -- [-1006.741] (-1009.784) (-1010.487) (-1008.300) * (-1009.753) (-1008.185) (-1008.602) [-1010.072] -- 0:00:28
542000 -- (-1007.957) (-1006.626) [-1008.284] (-1008.464) * (-1020.817) (-1010.005) [-1012.086] (-1007.167) -- 0:00:28
542500 -- (-1007.956) (-1008.287) (-1009.179) [-1007.820] * (-1006.738) (-1010.074) [-1007.368] (-1014.209) -- 0:00:28
543000 -- (-1008.163) [-1008.103] (-1009.964) (-1009.491) * (-1010.906) (-1007.520) [-1007.420] (-1007.786) -- 0:00:28
543500 -- (-1007.184) (-1009.639) (-1009.452) [-1008.094] * (-1008.281) (-1008.814) [-1007.966] (-1012.894) -- 0:00:28
544000 -- (-1012.473) (-1007.285) (-1007.758) [-1007.979] * (-1010.467) [-1008.183] (-1007.434) (-1012.008) -- 0:00:28
544500 -- (-1008.507) [-1006.457] (-1008.222) (-1008.562) * (-1008.761) (-1011.137) (-1010.186) [-1008.553] -- 0:00:28
545000 -- (-1008.523) (-1006.869) [-1008.268] (-1008.332) * (-1009.058) [-1011.275] (-1009.636) (-1007.748) -- 0:00:28
Average standard deviation of split frequencies: 0.012567
545500 -- (-1008.528) (-1007.462) [-1007.608] (-1008.904) * (-1011.095) [-1008.585] (-1008.645) (-1007.965) -- 0:00:28
546000 -- (-1012.219) (-1007.812) (-1009.258) [-1007.568] * (-1009.555) (-1012.393) (-1007.458) [-1006.829] -- 0:00:28
546500 -- [-1009.396] (-1010.095) (-1009.040) (-1011.295) * (-1009.647) (-1008.780) (-1007.024) [-1007.030] -- 0:00:28
547000 -- [-1009.128] (-1008.231) (-1007.994) (-1011.225) * (-1009.745) (-1008.325) (-1012.614) [-1007.506] -- 0:00:28
547500 -- (-1013.037) [-1008.217] (-1008.189) (-1008.001) * (-1008.056) (-1008.703) (-1011.088) [-1008.206] -- 0:00:28
548000 -- (-1009.037) [-1009.885] (-1009.817) (-1014.442) * (-1008.017) (-1010.111) (-1012.864) [-1008.587] -- 0:00:28
548500 -- (-1009.257) [-1013.265] (-1010.255) (-1013.170) * (-1009.165) [-1010.217] (-1009.742) (-1007.325) -- 0:00:28
549000 -- (-1010.142) (-1013.072) [-1009.687] (-1009.483) * (-1008.925) [-1011.892] (-1010.339) (-1008.970) -- 0:00:28
549500 -- (-1009.092) (-1008.712) [-1009.037] (-1010.463) * (-1010.230) (-1012.012) [-1008.588] (-1008.703) -- 0:00:28
550000 -- (-1009.426) (-1007.808) [-1008.077] (-1008.668) * (-1010.193) (-1009.100) (-1007.794) [-1010.610] -- 0:00:28
Average standard deviation of split frequencies: 0.012791
550500 -- (-1009.587) (-1007.484) (-1007.819) [-1011.976] * (-1010.383) (-1008.176) (-1011.533) [-1008.536] -- 0:00:28
551000 -- (-1010.886) (-1007.261) (-1012.889) [-1012.171] * (-1011.216) [-1008.481] (-1009.466) (-1008.439) -- 0:00:28
551500 -- (-1009.720) [-1013.443] (-1009.195) (-1009.556) * [-1010.108] (-1009.817) (-1007.982) (-1008.439) -- 0:00:28
552000 -- (-1010.428) (-1008.071) (-1008.587) [-1011.986] * (-1008.418) (-1007.128) [-1009.299] (-1010.838) -- 0:00:28
552500 -- (-1013.628) [-1007.472] (-1008.788) (-1012.238) * (-1010.094) (-1012.202) (-1009.246) [-1008.967] -- 0:00:28
553000 -- [-1008.481] (-1012.075) (-1011.848) (-1008.881) * (-1013.468) (-1007.493) [-1007.985] (-1008.260) -- 0:00:28
553500 -- (-1007.392) [-1007.216] (-1015.828) (-1010.660) * (-1012.640) (-1007.303) (-1008.530) [-1007.162] -- 0:00:28
554000 -- (-1009.450) (-1007.033) [-1009.545] (-1009.578) * (-1010.101) (-1010.843) (-1008.426) [-1007.566] -- 0:00:28
554500 -- [-1007.242] (-1009.479) (-1010.294) (-1012.270) * [-1008.116] (-1010.108) (-1010.287) (-1008.017) -- 0:00:28
555000 -- (-1007.978) (-1010.999) [-1009.405] (-1007.259) * (-1009.505) [-1007.799] (-1009.479) (-1010.594) -- 0:00:28
Average standard deviation of split frequencies: 0.012718
555500 -- (-1012.015) [-1009.834] (-1012.044) (-1008.983) * [-1007.334] (-1009.066) (-1009.677) (-1009.358) -- 0:00:28
556000 -- (-1010.201) (-1007.133) (-1009.821) [-1007.164] * (-1010.368) (-1008.630) (-1008.486) [-1010.210] -- 0:00:27
556500 -- [-1008.244] (-1009.513) (-1007.740) (-1007.820) * (-1009.514) (-1010.435) [-1010.736] (-1008.754) -- 0:00:27
557000 -- (-1010.581) [-1009.771] (-1008.804) (-1008.337) * (-1010.943) (-1010.899) (-1007.729) [-1007.562] -- 0:00:27
557500 -- (-1011.003) (-1009.644) [-1008.921] (-1008.810) * (-1010.656) (-1007.989) (-1007.400) [-1007.128] -- 0:00:27
558000 -- (-1008.534) [-1007.919] (-1012.092) (-1008.810) * (-1011.933) (-1009.990) [-1009.083] (-1008.031) -- 0:00:27
558500 -- (-1007.660) [-1008.555] (-1010.625) (-1008.939) * (-1010.122) (-1009.783) (-1009.763) [-1009.028] -- 0:00:27
559000 -- [-1008.213] (-1008.263) (-1007.759) (-1007.773) * (-1007.450) (-1007.338) (-1008.848) [-1007.947] -- 0:00:27
559500 -- (-1008.178) (-1008.601) (-1009.110) [-1008.231] * (-1007.884) [-1010.702] (-1011.994) (-1009.029) -- 0:00:27
560000 -- (-1012.075) (-1009.619) [-1009.538] (-1010.814) * [-1007.782] (-1011.733) (-1008.759) (-1012.301) -- 0:00:27
Average standard deviation of split frequencies: 0.013057
560500 -- (-1009.576) [-1008.605] (-1009.924) (-1010.138) * [-1007.685] (-1013.168) (-1007.859) (-1013.887) -- 0:00:27
561000 -- [-1007.025] (-1009.422) (-1007.857) (-1008.015) * (-1007.706) (-1009.315) [-1007.278] (-1009.534) -- 0:00:27
561500 -- (-1010.028) (-1009.620) (-1007.950) [-1007.209] * (-1010.627) (-1009.814) [-1007.278] (-1007.215) -- 0:00:27
562000 -- (-1010.579) (-1012.430) [-1009.246] (-1007.616) * (-1009.035) (-1009.919) (-1007.839) [-1009.714] -- 0:00:27
562500 -- [-1008.638] (-1011.994) (-1008.493) (-1010.745) * (-1007.518) (-1009.214) (-1007.082) [-1007.882] -- 0:00:27
563000 -- (-1008.358) (-1015.504) [-1006.951] (-1008.141) * (-1008.721) (-1008.015) [-1007.255] (-1011.210) -- 0:00:27
563500 -- (-1010.323) (-1011.129) (-1009.977) [-1008.397] * (-1009.639) (-1010.954) [-1008.534] (-1011.073) -- 0:00:27
564000 -- [-1010.005] (-1013.979) (-1010.720) (-1009.760) * [-1009.642] (-1010.252) (-1008.357) (-1011.005) -- 0:00:27
564500 -- [-1007.461] (-1011.765) (-1009.469) (-1011.381) * (-1010.729) (-1011.604) (-1007.637) [-1008.573] -- 0:00:27
565000 -- (-1008.727) (-1009.467) [-1007.119] (-1006.920) * (-1006.727) [-1008.727] (-1006.731) (-1008.650) -- 0:00:27
Average standard deviation of split frequencies: 0.013032
565500 -- (-1009.218) [-1007.317] (-1007.779) (-1008.278) * (-1009.283) (-1007.695) [-1009.962] (-1008.978) -- 0:00:27
566000 -- [-1010.533] (-1007.255) (-1010.195) (-1009.279) * [-1008.967] (-1006.813) (-1007.372) (-1007.208) -- 0:00:27
566500 -- (-1010.836) (-1011.977) (-1010.485) [-1009.318] * (-1009.274) (-1016.027) [-1007.098] (-1011.177) -- 0:00:27
567000 -- [-1011.309] (-1018.306) (-1007.207) (-1009.139) * (-1007.702) [-1009.407] (-1008.299) (-1009.726) -- 0:00:27
567500 -- (-1009.602) (-1008.854) [-1008.606] (-1010.865) * [-1007.226] (-1011.250) (-1012.448) (-1009.891) -- 0:00:27
568000 -- (-1010.538) (-1006.960) [-1009.236] (-1008.647) * (-1007.399) [-1007.838] (-1011.280) (-1009.371) -- 0:00:27
568500 -- (-1010.597) (-1006.819) [-1009.233] (-1009.388) * (-1008.502) [-1007.424] (-1008.484) (-1013.350) -- 0:00:27
569000 -- (-1009.426) [-1006.792] (-1010.290) (-1009.412) * (-1007.319) (-1008.706) (-1010.288) [-1009.994] -- 0:00:27
569500 -- (-1009.595) [-1006.647] (-1010.662) (-1008.944) * (-1008.392) (-1007.603) [-1006.703] (-1009.122) -- 0:00:27
570000 -- [-1008.716] (-1006.939) (-1008.871) (-1010.865) * (-1010.195) (-1008.223) (-1009.172) [-1009.456] -- 0:00:27
Average standard deviation of split frequencies: 0.013363
570500 -- (-1009.772) (-1009.602) (-1009.599) [-1008.331] * (-1011.631) (-1009.849) (-1010.456) [-1008.687] -- 0:00:27
571000 -- [-1014.925] (-1009.871) (-1008.684) (-1009.940) * (-1013.272) [-1010.277] (-1007.974) (-1010.217) -- 0:00:27
571500 -- (-1012.458) (-1007.088) (-1008.566) [-1008.906] * (-1010.531) (-1007.583) (-1006.974) [-1007.868] -- 0:00:26
572000 -- (-1008.530) [-1012.180] (-1009.329) (-1007.292) * [-1006.724] (-1008.592) (-1007.203) (-1007.616) -- 0:00:26
572500 -- [-1012.102] (-1007.925) (-1007.702) (-1009.428) * (-1006.432) (-1009.278) (-1007.670) [-1007.906] -- 0:00:26
573000 -- (-1012.853) [-1012.930] (-1007.184) (-1010.175) * (-1007.854) (-1006.726) (-1011.003) [-1008.543] -- 0:00:26
573500 -- (-1009.284) (-1008.501) [-1012.772] (-1008.307) * (-1008.421) (-1008.513) (-1009.322) [-1010.133] -- 0:00:26
574000 -- [-1007.834] (-1010.721) (-1009.930) (-1007.334) * (-1007.601) [-1010.757] (-1011.525) (-1008.719) -- 0:00:26
574500 -- [-1009.233] (-1013.636) (-1007.973) (-1007.774) * [-1008.045] (-1009.105) (-1008.882) (-1007.596) -- 0:00:26
575000 -- (-1008.932) (-1007.344) [-1007.874] (-1010.660) * (-1009.718) (-1014.332) [-1009.857] (-1006.964) -- 0:00:26
Average standard deviation of split frequencies: 0.012902
575500 -- (-1014.931) (-1007.480) [-1008.235] (-1009.782) * (-1006.948) [-1007.698] (-1009.794) (-1007.109) -- 0:00:26
576000 -- (-1008.950) [-1010.772] (-1009.683) (-1008.563) * [-1006.995] (-1008.846) (-1010.057) (-1008.237) -- 0:00:26
576500 -- [-1008.112] (-1008.078) (-1010.843) (-1007.837) * (-1006.546) (-1011.368) (-1009.064) [-1009.286] -- 0:00:26
577000 -- (-1008.475) (-1011.915) (-1010.385) [-1009.707] * (-1008.426) (-1009.132) (-1012.562) [-1008.199] -- 0:00:26
577500 -- [-1009.561] (-1009.301) (-1010.905) (-1009.229) * [-1009.319] (-1009.746) (-1008.713) (-1008.580) -- 0:00:26
578000 -- [-1007.599] (-1007.538) (-1017.715) (-1011.856) * (-1007.323) (-1010.888) (-1012.161) [-1007.511] -- 0:00:26
578500 -- (-1008.259) (-1008.057) [-1008.796] (-1009.312) * (-1007.111) (-1016.367) [-1008.495] (-1007.301) -- 0:00:26
579000 -- (-1009.027) (-1010.616) (-1007.781) [-1007.863] * (-1008.663) (-1011.440) [-1006.572] (-1009.348) -- 0:00:26
579500 -- (-1009.042) [-1008.493] (-1008.007) (-1006.934) * (-1008.446) (-1007.860) [-1007.652] (-1010.360) -- 0:00:26
580000 -- (-1009.318) [-1008.363] (-1007.591) (-1009.930) * (-1008.122) [-1008.630] (-1008.525) (-1012.069) -- 0:00:26
Average standard deviation of split frequencies: 0.012607
580500 -- (-1010.613) (-1011.920) [-1007.274] (-1009.408) * [-1009.361] (-1010.079) (-1007.597) (-1007.962) -- 0:00:26
581000 -- [-1013.467] (-1013.334) (-1007.646) (-1013.834) * [-1008.713] (-1006.882) (-1010.155) (-1011.957) -- 0:00:26
581500 -- (-1010.081) [-1010.788] (-1008.042) (-1008.166) * (-1008.925) [-1007.940] (-1013.867) (-1013.999) -- 0:00:26
582000 -- (-1007.073) (-1008.066) (-1007.280) [-1007.820] * (-1008.830) [-1008.897] (-1011.207) (-1014.507) -- 0:00:26
582500 -- [-1009.931] (-1008.205) (-1009.445) (-1009.682) * (-1011.310) (-1008.732) (-1012.850) [-1008.828] -- 0:00:26
583000 -- [-1008.199] (-1007.441) (-1011.912) (-1008.108) * [-1009.525] (-1008.776) (-1014.885) (-1010.034) -- 0:00:26
583500 -- [-1009.942] (-1008.364) (-1012.059) (-1010.268) * (-1007.545) (-1013.601) [-1008.076] (-1013.900) -- 0:00:26
584000 -- (-1009.218) [-1009.734] (-1011.790) (-1009.201) * (-1008.055) [-1012.061] (-1007.961) (-1010.416) -- 0:00:26
584500 -- (-1012.155) [-1011.410] (-1011.350) (-1008.019) * (-1008.859) [-1013.416] (-1007.881) (-1010.350) -- 0:00:26
585000 -- [-1010.107] (-1008.432) (-1007.825) (-1009.209) * [-1008.038] (-1014.508) (-1010.276) (-1007.380) -- 0:00:26
Average standard deviation of split frequencies: 0.013202
585500 -- (-1011.386) (-1009.316) (-1008.137) [-1009.862] * (-1010.112) (-1008.372) [-1009.700] (-1006.932) -- 0:00:26
586000 -- (-1007.394) (-1007.964) [-1007.308] (-1007.665) * [-1007.037] (-1010.522) (-1009.536) (-1009.224) -- 0:00:26
586500 -- (-1010.570) (-1009.260) [-1008.012] (-1009.397) * (-1008.206) (-1007.483) (-1011.498) [-1008.244] -- 0:00:26
587000 -- (-1007.033) (-1012.997) [-1011.219] (-1012.655) * (-1007.377) (-1006.929) (-1008.067) [-1008.244] -- 0:00:26
587500 -- [-1009.507] (-1008.287) (-1007.766) (-1011.967) * (-1008.954) (-1009.066) (-1008.664) [-1008.173] -- 0:00:25
588000 -- (-1008.053) (-1009.795) [-1009.917] (-1007.298) * (-1011.746) (-1008.336) (-1007.773) [-1010.083] -- 0:00:25
588500 -- [-1008.110] (-1007.796) (-1010.404) (-1007.282) * (-1007.811) [-1008.531] (-1012.050) (-1011.466) -- 0:00:25
589000 -- (-1007.865) (-1010.553) [-1010.161] (-1008.236) * (-1008.479) (-1008.809) (-1008.334) [-1007.899] -- 0:00:25
589500 -- (-1009.511) (-1008.054) [-1010.244] (-1009.117) * [-1009.653] (-1009.415) (-1009.106) (-1006.963) -- 0:00:25
590000 -- [-1009.340] (-1007.642) (-1010.571) (-1010.002) * [-1006.571] (-1010.842) (-1010.803) (-1006.838) -- 0:00:25
Average standard deviation of split frequencies: 0.013051
590500 -- [-1011.482] (-1009.647) (-1010.491) (-1008.517) * [-1009.624] (-1008.410) (-1008.935) (-1007.200) -- 0:00:25
591000 -- (-1009.227) [-1008.931] (-1007.815) (-1010.624) * (-1009.573) [-1007.856] (-1012.368) (-1009.828) -- 0:00:25
591500 -- (-1009.489) (-1010.670) [-1007.433] (-1009.834) * (-1008.736) (-1007.877) [-1009.148] (-1007.371) -- 0:00:25
592000 -- [-1006.906] (-1011.516) (-1013.639) (-1008.613) * (-1008.631) (-1009.854) [-1013.550] (-1013.089) -- 0:00:25
592500 -- [-1008.159] (-1013.177) (-1007.680) (-1008.868) * (-1009.659) (-1013.391) [-1008.350] (-1017.825) -- 0:00:25
593000 -- (-1009.306) (-1009.330) (-1007.632) [-1009.673] * (-1013.344) [-1008.787] (-1007.500) (-1012.439) -- 0:00:25
593500 -- (-1007.039) (-1009.866) [-1007.388] (-1011.455) * (-1012.540) (-1010.679) (-1007.097) [-1007.968] -- 0:00:25
594000 -- [-1007.968] (-1010.370) (-1007.910) (-1008.661) * (-1009.497) [-1007.593] (-1007.414) (-1010.992) -- 0:00:25
594500 -- [-1008.060] (-1014.489) (-1008.093) (-1007.523) * (-1007.413) (-1009.909) (-1009.395) [-1007.450] -- 0:00:25
595000 -- (-1007.952) [-1010.956] (-1008.409) (-1006.801) * (-1011.161) (-1007.199) [-1008.648] (-1009.476) -- 0:00:25
Average standard deviation of split frequencies: 0.012655
595500 -- (-1008.569) (-1008.726) (-1008.081) [-1007.059] * [-1007.648] (-1007.226) (-1010.796) (-1009.484) -- 0:00:25
596000 -- (-1009.165) [-1008.717] (-1008.600) (-1011.330) * [-1008.812] (-1008.841) (-1007.920) (-1008.104) -- 0:00:25
596500 -- [-1009.608] (-1009.442) (-1008.377) (-1009.090) * [-1009.356] (-1008.998) (-1008.005) (-1007.749) -- 0:00:25
597000 -- [-1008.192] (-1010.588) (-1008.999) (-1009.782) * (-1008.869) [-1009.244] (-1008.198) (-1007.250) -- 0:00:25
597500 -- (-1008.189) (-1014.739) (-1009.238) [-1009.546] * (-1012.139) (-1008.709) [-1008.247] (-1011.181) -- 0:00:25
598000 -- (-1008.786) (-1013.925) (-1008.036) [-1010.034] * (-1009.174) (-1007.135) (-1007.798) [-1007.378] -- 0:00:25
598500 -- [-1008.103] (-1007.038) (-1009.370) (-1009.889) * (-1010.974) (-1006.906) (-1009.963) [-1009.808] -- 0:00:25
599000 -- (-1009.894) [-1008.554] (-1007.722) (-1010.452) * (-1008.558) (-1007.576) (-1010.266) [-1011.206] -- 0:00:25
599500 -- (-1009.384) [-1007.058] (-1008.270) (-1010.758) * (-1008.794) (-1009.113) (-1008.197) [-1009.165] -- 0:00:25
600000 -- [-1009.908] (-1007.313) (-1007.749) (-1010.093) * [-1012.573] (-1007.936) (-1017.135) (-1011.537) -- 0:00:25
Average standard deviation of split frequencies: 0.012095
600500 -- (-1007.703) (-1012.763) [-1008.672] (-1012.207) * (-1013.713) (-1008.301) (-1010.562) [-1009.461] -- 0:00:25
601000 -- (-1010.620) (-1017.609) (-1010.250) [-1009.671] * (-1009.237) (-1007.058) [-1008.013] (-1009.462) -- 0:00:25
601500 -- (-1008.091) [-1007.885] (-1009.185) (-1008.049) * [-1007.740] (-1008.700) (-1007.979) (-1007.100) -- 0:00:25
602000 -- (-1007.540) [-1008.085] (-1011.097) (-1008.519) * (-1011.871) [-1008.828] (-1007.498) (-1008.237) -- 0:00:25
602500 -- [-1011.596] (-1010.180) (-1009.952) (-1007.593) * (-1009.162) (-1009.721) (-1008.097) [-1006.718] -- 0:00:25
603000 -- (-1011.545) (-1012.792) [-1014.179] (-1006.813) * [-1008.164] (-1008.629) (-1007.436) (-1010.076) -- 0:00:25
603500 -- (-1009.121) (-1012.890) [-1008.557] (-1008.137) * (-1009.497) [-1008.975] (-1008.283) (-1009.618) -- 0:00:24
604000 -- (-1007.637) [-1010.138] (-1009.335) (-1015.389) * (-1008.471) [-1006.655] (-1008.922) (-1010.109) -- 0:00:24
604500 -- (-1011.235) (-1012.869) (-1010.907) [-1007.825] * (-1012.519) (-1007.708) (-1009.253) [-1013.718] -- 0:00:24
605000 -- (-1008.943) [-1013.718] (-1011.155) (-1009.503) * (-1009.204) [-1009.327] (-1007.433) (-1009.662) -- 0:00:24
Average standard deviation of split frequencies: 0.011814
605500 -- (-1009.454) [-1009.345] (-1009.047) (-1008.527) * [-1008.556] (-1008.212) (-1009.042) (-1011.022) -- 0:00:24
606000 -- (-1008.018) [-1009.145] (-1009.359) (-1007.090) * [-1009.290] (-1009.886) (-1007.863) (-1009.805) -- 0:00:24
606500 -- [-1008.653] (-1007.204) (-1011.104) (-1009.426) * (-1007.521) (-1010.494) (-1009.625) [-1010.675] -- 0:00:24
607000 -- (-1007.874) (-1009.607) (-1011.473) [-1011.784] * [-1007.549] (-1007.703) (-1013.596) (-1007.811) -- 0:00:24
607500 -- [-1010.435] (-1008.583) (-1010.013) (-1010.353) * [-1012.498] (-1010.035) (-1008.045) (-1008.030) -- 0:00:24
608000 -- [-1007.346] (-1007.253) (-1008.198) (-1006.963) * (-1009.609) (-1008.866) [-1010.631] (-1011.882) -- 0:00:24
608500 -- (-1007.557) (-1007.210) [-1010.070] (-1008.144) * [-1008.239] (-1008.339) (-1010.050) (-1011.521) -- 0:00:24
609000 -- [-1009.356] (-1008.817) (-1007.891) (-1007.029) * (-1009.684) (-1008.870) (-1011.828) [-1010.023] -- 0:00:24
609500 -- (-1011.748) (-1007.141) (-1010.652) [-1007.886] * (-1009.227) (-1007.459) (-1007.963) [-1010.921] -- 0:00:24
610000 -- (-1008.321) (-1009.306) [-1007.434] (-1008.831) * (-1008.093) [-1007.437] (-1008.631) (-1011.602) -- 0:00:24
Average standard deviation of split frequencies: 0.011097
610500 -- (-1009.224) [-1008.328] (-1009.063) (-1012.992) * (-1009.095) (-1008.346) (-1014.560) [-1009.110] -- 0:00:24
611000 -- (-1011.150) (-1009.517) [-1007.343] (-1009.354) * (-1008.018) (-1009.235) (-1010.325) [-1006.732] -- 0:00:24
611500 -- (-1009.200) (-1007.519) (-1008.155) [-1006.505] * (-1010.502) [-1008.181] (-1007.679) (-1010.399) -- 0:00:24
612000 -- (-1007.314) (-1011.310) [-1008.229] (-1008.788) * (-1007.113) (-1009.592) (-1010.924) [-1010.468] -- 0:00:24
612500 -- (-1007.542) (-1008.670) [-1009.104] (-1008.794) * (-1008.027) (-1007.918) (-1009.042) [-1010.014] -- 0:00:24
613000 -- [-1007.250] (-1007.510) (-1009.834) (-1010.982) * (-1007.216) (-1007.190) [-1007.927] (-1007.469) -- 0:00:24
613500 -- (-1007.250) (-1009.491) (-1009.191) [-1011.405] * [-1009.104] (-1007.880) (-1009.098) (-1007.530) -- 0:00:24
614000 -- (-1010.038) (-1007.333) [-1008.681] (-1008.671) * (-1008.178) (-1013.105) (-1010.547) [-1008.735] -- 0:00:24
614500 -- (-1009.045) (-1008.028) [-1008.093] (-1010.689) * [-1008.690] (-1009.409) (-1009.812) (-1009.593) -- 0:00:24
615000 -- [-1009.658] (-1007.801) (-1007.370) (-1010.449) * (-1009.614) (-1007.855) [-1008.996] (-1013.247) -- 0:00:24
Average standard deviation of split frequencies: 0.011670
615500 -- (-1009.686) (-1007.984) [-1007.450] (-1011.529) * (-1007.406) [-1009.005] (-1013.958) (-1008.586) -- 0:00:24
616000 -- (-1009.365) [-1007.266] (-1006.994) (-1013.015) * (-1008.663) [-1007.890] (-1017.899) (-1009.009) -- 0:00:24
616500 -- [-1007.623] (-1008.580) (-1007.784) (-1007.080) * [-1007.254] (-1011.314) (-1007.048) (-1007.457) -- 0:00:24
617000 -- (-1011.769) (-1007.735) (-1009.854) [-1008.034] * (-1006.965) (-1011.540) [-1007.158] (-1013.414) -- 0:00:24
617500 -- (-1008.634) (-1010.891) [-1013.737] (-1007.985) * (-1007.274) (-1007.247) [-1006.854] (-1013.839) -- 0:00:24
618000 -- (-1008.329) [-1009.180] (-1008.053) (-1011.119) * [-1008.405] (-1010.867) (-1011.459) (-1009.550) -- 0:00:24
618500 -- (-1008.330) (-1007.523) [-1008.310] (-1011.834) * (-1008.181) (-1013.576) [-1009.156] (-1007.297) -- 0:00:24
619000 -- (-1006.971) [-1007.378] (-1008.697) (-1012.606) * (-1008.902) (-1012.663) (-1009.008) [-1006.940] -- 0:00:24
619500 -- (-1015.612) [-1008.524] (-1007.248) (-1011.601) * [-1007.458] (-1010.769) (-1012.267) (-1010.500) -- 0:00:23
620000 -- (-1016.496) (-1009.320) (-1010.454) [-1008.125] * (-1007.478) (-1009.807) [-1008.640] (-1008.551) -- 0:00:23
Average standard deviation of split frequencies: 0.012342
620500 -- [-1010.733] (-1011.171) (-1008.755) (-1007.841) * (-1008.763) (-1012.148) [-1008.321] (-1011.849) -- 0:00:23
621000 -- (-1008.636) [-1007.920] (-1009.153) (-1010.044) * (-1008.288) (-1010.111) (-1008.819) [-1010.740] -- 0:00:23
621500 -- (-1008.972) (-1014.074) [-1009.214] (-1008.782) * [-1010.385] (-1009.016) (-1009.999) (-1009.466) -- 0:00:23
622000 -- (-1008.345) (-1009.361) [-1008.486] (-1008.685) * [-1009.222] (-1013.241) (-1008.825) (-1007.640) -- 0:00:23
622500 -- (-1010.628) (-1008.125) [-1008.864] (-1008.400) * [-1008.525] (-1007.813) (-1008.466) (-1007.720) -- 0:00:23
623000 -- [-1012.156] (-1009.902) (-1008.860) (-1008.852) * [-1009.236] (-1012.587) (-1007.344) (-1011.628) -- 0:00:23
623500 -- (-1011.290) (-1008.403) (-1007.306) [-1008.333] * (-1011.268) [-1007.692] (-1012.435) (-1011.022) -- 0:00:23
624000 -- (-1009.092) (-1007.866) (-1008.974) [-1007.401] * (-1010.624) [-1011.663] (-1015.058) (-1008.180) -- 0:00:23
624500 -- (-1007.604) (-1008.934) (-1007.754) [-1008.659] * (-1009.997) [-1008.360] (-1011.341) (-1007.069) -- 0:00:23
625000 -- (-1009.685) (-1008.652) (-1009.414) [-1008.424] * (-1007.167) [-1006.827] (-1009.736) (-1006.866) -- 0:00:23
Average standard deviation of split frequencies: 0.012190
625500 -- [-1011.352] (-1008.455) (-1008.155) (-1008.368) * (-1010.126) (-1007.311) (-1011.321) [-1009.144] -- 0:00:23
626000 -- (-1011.117) [-1010.002] (-1008.276) (-1009.048) * (-1011.763) (-1010.589) (-1007.106) [-1006.738] -- 0:00:23
626500 -- (-1010.380) (-1012.054) (-1011.560) [-1008.588] * (-1015.456) (-1010.711) [-1009.041] (-1009.827) -- 0:00:23
627000 -- (-1009.543) (-1008.583) [-1009.390] (-1012.327) * (-1008.033) [-1007.686] (-1007.794) (-1008.280) -- 0:00:23
627500 -- (-1010.304) (-1010.535) [-1009.136] (-1009.050) * [-1007.839] (-1007.933) (-1007.340) (-1008.795) -- 0:00:23
628000 -- [-1006.982] (-1008.344) (-1007.527) (-1015.229) * (-1007.818) (-1010.498) (-1010.149) [-1008.899] -- 0:00:23
628500 -- (-1007.418) (-1008.672) [-1007.133] (-1008.642) * (-1008.783) (-1010.569) [-1008.211] (-1009.939) -- 0:00:23
629000 -- (-1008.560) [-1008.634] (-1008.526) (-1008.703) * (-1007.590) [-1006.594] (-1007.108) (-1008.414) -- 0:00:23
629500 -- (-1008.463) (-1007.861) [-1009.353] (-1006.891) * [-1008.893] (-1008.711) (-1008.627) (-1015.492) -- 0:00:23
630000 -- (-1007.187) (-1007.109) [-1008.969] (-1011.305) * (-1016.022) (-1007.133) (-1007.870) [-1010.356] -- 0:00:23
Average standard deviation of split frequencies: 0.011586
630500 -- [-1010.577] (-1007.265) (-1007.905) (-1008.794) * (-1008.820) [-1007.062] (-1014.945) (-1009.879) -- 0:00:23
631000 -- (-1011.236) (-1014.685) (-1008.289) [-1009.396] * (-1006.910) [-1009.880] (-1016.668) (-1013.304) -- 0:00:23
631500 -- (-1009.652) (-1015.408) (-1008.211) [-1009.644] * (-1008.654) (-1012.282) (-1011.140) [-1009.529] -- 0:00:23
632000 -- (-1010.212) (-1013.299) (-1009.555) [-1007.728] * (-1007.451) [-1008.411] (-1023.316) (-1009.498) -- 0:00:23
632500 -- (-1012.068) [-1008.568] (-1009.350) (-1008.348) * (-1007.404) [-1011.487] (-1019.081) (-1012.521) -- 0:00:23
633000 -- (-1008.499) (-1012.824) (-1010.187) [-1009.046] * [-1007.697] (-1009.489) (-1010.198) (-1011.275) -- 0:00:23
633500 -- (-1010.745) (-1009.192) [-1010.117] (-1007.834) * [-1007.381] (-1009.671) (-1010.980) (-1009.664) -- 0:00:23
634000 -- [-1011.112] (-1009.866) (-1012.128) (-1007.735) * (-1006.727) (-1008.300) (-1009.077) [-1008.578] -- 0:00:23
634500 -- (-1009.316) (-1006.538) (-1007.943) [-1006.767] * (-1008.078) (-1008.137) [-1007.094] (-1008.229) -- 0:00:23
635000 -- (-1007.671) [-1009.590] (-1007.163) (-1009.260) * (-1009.953) (-1008.508) (-1006.938) [-1007.196] -- 0:00:22
Average standard deviation of split frequencies: 0.011813
635500 -- (-1007.639) (-1009.583) [-1009.523] (-1007.707) * (-1010.324) (-1011.409) (-1007.163) [-1006.790] -- 0:00:22
636000 -- (-1010.579) [-1011.331] (-1008.470) (-1007.569) * (-1010.659) (-1009.743) [-1007.410] (-1007.466) -- 0:00:22
636500 -- [-1012.081] (-1008.807) (-1006.632) (-1008.464) * (-1007.111) (-1010.130) [-1009.259] (-1006.879) -- 0:00:22
637000 -- (-1013.237) (-1011.712) (-1007.905) [-1007.851] * (-1008.907) (-1009.130) (-1007.766) [-1007.191] -- 0:00:22
637500 -- (-1007.557) (-1015.281) [-1007.979] (-1007.878) * (-1008.874) (-1008.845) [-1007.835] (-1010.300) -- 0:00:22
638000 -- (-1007.884) (-1012.479) [-1009.537] (-1015.418) * (-1007.810) [-1007.474] (-1011.364) (-1009.303) -- 0:00:22
638500 -- (-1006.916) [-1008.092] (-1009.569) (-1009.144) * (-1008.038) [-1008.880] (-1011.876) (-1009.939) -- 0:00:22
639000 -- (-1007.496) (-1010.825) (-1007.664) [-1008.820] * [-1007.499] (-1008.388) (-1009.128) (-1010.963) -- 0:00:22
639500 -- [-1006.708] (-1009.312) (-1008.396) (-1012.022) * [-1007.994] (-1008.217) (-1007.660) (-1008.056) -- 0:00:22
640000 -- (-1008.501) [-1006.573] (-1007.721) (-1010.995) * [-1007.113] (-1011.822) (-1011.421) (-1007.182) -- 0:00:22
Average standard deviation of split frequencies: 0.011819
640500 -- (-1013.567) [-1008.419] (-1008.229) (-1011.246) * (-1009.070) (-1007.043) (-1008.342) [-1006.903] -- 0:00:22
641000 -- [-1010.293] (-1011.375) (-1007.041) (-1009.640) * (-1010.261) (-1007.193) [-1011.635] (-1007.161) -- 0:00:22
641500 -- (-1014.466) [-1012.943] (-1013.148) (-1009.122) * (-1009.776) (-1008.785) [-1009.759] (-1007.028) -- 0:00:22
642000 -- (-1010.358) (-1007.472) [-1009.264] (-1007.941) * [-1009.606] (-1007.843) (-1009.128) (-1008.360) -- 0:00:22
642500 -- (-1008.934) (-1011.035) (-1010.747) [-1008.474] * (-1008.309) (-1007.477) [-1010.162] (-1009.900) -- 0:00:22
643000 -- [-1008.908] (-1009.687) (-1008.186) (-1012.651) * (-1009.873) (-1011.810) (-1011.488) [-1010.142] -- 0:00:22
643500 -- (-1009.208) [-1009.947] (-1009.227) (-1011.535) * (-1012.093) (-1010.122) [-1007.530] (-1009.468) -- 0:00:22
644000 -- (-1007.319) (-1010.326) (-1008.459) [-1008.470] * [-1010.595] (-1007.714) (-1008.649) (-1010.461) -- 0:00:22
644500 -- [-1007.700] (-1011.483) (-1009.048) (-1008.337) * (-1011.982) (-1012.759) (-1009.694) [-1010.824] -- 0:00:22
645000 -- (-1008.067) (-1008.152) [-1008.570] (-1008.121) * (-1007.048) [-1008.493] (-1009.019) (-1008.357) -- 0:00:22
Average standard deviation of split frequencies: 0.011539
645500 -- [-1007.744] (-1007.807) (-1009.693) (-1009.337) * (-1007.378) [-1007.639] (-1007.333) (-1007.255) -- 0:00:22
646000 -- [-1008.322] (-1007.903) (-1010.037) (-1007.884) * (-1008.861) (-1007.932) [-1011.773] (-1017.618) -- 0:00:22
646500 -- (-1013.083) [-1007.438] (-1013.063) (-1008.565) * (-1009.369) (-1008.109) [-1011.157] (-1008.897) -- 0:00:22
647000 -- (-1009.488) (-1007.834) (-1011.451) [-1006.855] * (-1008.297) [-1009.483] (-1009.936) (-1008.744) -- 0:00:22
647500 -- (-1007.030) (-1009.755) [-1009.453] (-1011.968) * (-1007.917) [-1008.962] (-1011.360) (-1007.865) -- 0:00:22
648000 -- (-1008.535) [-1010.557] (-1007.164) (-1008.786) * [-1007.095] (-1007.765) (-1009.744) (-1008.550) -- 0:00:22
648500 -- (-1010.289) (-1007.201) (-1008.666) [-1010.599] * (-1008.564) (-1007.444) (-1010.246) [-1007.510] -- 0:00:22
649000 -- (-1008.257) [-1007.176] (-1008.768) (-1010.911) * (-1007.584) (-1009.641) (-1010.070) [-1007.346] -- 0:00:22
649500 -- (-1008.832) (-1011.031) [-1008.380] (-1010.929) * (-1007.529) (-1009.362) [-1008.246] (-1006.808) -- 0:00:22
650000 -- (-1010.384) (-1009.409) [-1008.481] (-1009.119) * [-1009.307] (-1011.393) (-1007.899) (-1010.267) -- 0:00:22
Average standard deviation of split frequencies: 0.011637
650500 -- [-1006.923] (-1009.818) (-1008.879) (-1008.155) * (-1007.842) [-1010.481] (-1009.181) (-1008.836) -- 0:00:22
651000 -- (-1008.353) (-1008.639) (-1013.021) [-1008.033] * [-1009.309] (-1009.755) (-1009.317) (-1013.549) -- 0:00:21
651500 -- (-1007.843) (-1007.288) [-1009.409] (-1015.457) * [-1008.353] (-1010.166) (-1010.698) (-1009.090) -- 0:00:21
652000 -- (-1007.995) (-1006.850) [-1008.423] (-1009.209) * [-1007.938] (-1007.348) (-1013.642) (-1008.152) -- 0:00:21
652500 -- (-1009.971) (-1010.235) (-1008.390) [-1008.251] * (-1014.223) [-1007.911] (-1022.182) (-1006.949) -- 0:00:21
653000 -- (-1006.765) (-1008.950) (-1008.152) [-1010.157] * (-1011.328) (-1008.200) [-1008.303] (-1011.828) -- 0:00:21
653500 -- (-1010.637) [-1011.317] (-1006.856) (-1006.639) * (-1008.354) (-1008.186) [-1007.843] (-1009.713) -- 0:00:21
654000 -- (-1007.681) (-1009.464) [-1007.893] (-1006.763) * (-1009.070) (-1008.490) (-1009.248) [-1007.454] -- 0:00:21
654500 -- (-1007.125) (-1007.442) (-1008.319) [-1010.118] * [-1008.832] (-1007.080) (-1010.489) (-1011.947) -- 0:00:21
655000 -- (-1008.733) [-1007.000] (-1008.225) (-1008.265) * [-1006.592] (-1007.526) (-1009.288) (-1007.428) -- 0:00:21
Average standard deviation of split frequencies: 0.011228
655500 -- (-1007.350) [-1008.982] (-1007.255) (-1011.286) * (-1008.621) (-1009.558) (-1009.425) [-1009.652] -- 0:00:21
656000 -- (-1009.401) (-1009.915) [-1007.439] (-1010.521) * (-1009.244) (-1008.992) [-1010.814] (-1009.202) -- 0:00:21
656500 -- (-1009.728) [-1009.489] (-1007.994) (-1009.121) * [-1008.060] (-1006.835) (-1012.279) (-1009.096) -- 0:00:21
657000 -- [-1008.484] (-1011.749) (-1008.512) (-1009.917) * [-1008.155] (-1008.620) (-1010.232) (-1009.580) -- 0:00:21
657500 -- [-1008.203] (-1009.826) (-1010.216) (-1009.942) * [-1015.365] (-1008.446) (-1008.233) (-1009.409) -- 0:00:21
658000 -- (-1006.788) (-1011.456) [-1013.615] (-1008.069) * (-1010.057) [-1010.355] (-1008.027) (-1007.900) -- 0:00:21
658500 -- (-1009.109) [-1007.972] (-1010.080) (-1013.205) * (-1011.559) (-1012.177) (-1008.641) [-1007.776] -- 0:00:21
659000 -- (-1007.885) (-1008.029) (-1012.826) [-1009.150] * [-1010.602] (-1010.171) (-1016.122) (-1008.433) -- 0:00:21
659500 -- (-1007.500) [-1007.572] (-1008.728) (-1010.522) * [-1008.564] (-1009.205) (-1006.983) (-1011.626) -- 0:00:21
660000 -- (-1009.926) (-1009.329) [-1009.728] (-1009.646) * [-1007.662] (-1007.966) (-1007.308) (-1009.159) -- 0:00:21
Average standard deviation of split frequencies: 0.010792
660500 -- (-1010.785) [-1007.505] (-1007.679) (-1008.232) * [-1007.628] (-1006.990) (-1009.456) (-1007.333) -- 0:00:21
661000 -- (-1008.068) (-1007.403) [-1013.794] (-1007.856) * (-1010.402) (-1007.019) [-1008.736] (-1007.116) -- 0:00:21
661500 -- [-1007.764] (-1012.475) (-1009.155) (-1007.085) * (-1012.338) (-1007.976) [-1008.387] (-1008.476) -- 0:00:21
662000 -- [-1006.959] (-1011.773) (-1007.941) (-1007.830) * (-1013.682) (-1007.025) [-1011.820] (-1009.574) -- 0:00:21
662500 -- (-1007.022) (-1008.768) [-1008.357] (-1006.768) * (-1009.505) (-1007.552) [-1009.842] (-1007.251) -- 0:00:21
663000 -- [-1009.521] (-1007.548) (-1012.255) (-1007.910) * (-1008.844) (-1009.854) [-1009.655] (-1009.015) -- 0:00:21
663500 -- [-1008.919] (-1008.120) (-1009.694) (-1007.660) * (-1007.908) [-1013.738] (-1008.031) (-1008.260) -- 0:00:21
664000 -- [-1008.963] (-1010.657) (-1013.777) (-1007.699) * (-1015.737) [-1009.497] (-1009.902) (-1011.036) -- 0:00:21
664500 -- (-1011.339) (-1012.518) (-1012.773) [-1007.495] * (-1007.964) [-1011.722] (-1011.733) (-1010.192) -- 0:00:21
665000 -- (-1007.434) (-1011.549) (-1008.367) [-1009.679] * (-1010.564) (-1010.829) (-1011.886) [-1009.055] -- 0:00:21
Average standard deviation of split frequencies: 0.010883
665500 -- (-1008.411) (-1009.981) [-1008.397] (-1008.277) * (-1008.656) (-1008.687) [-1006.999] (-1009.274) -- 0:00:21
666000 -- (-1007.613) (-1007.175) (-1009.702) [-1008.790] * [-1007.872] (-1007.412) (-1008.869) (-1008.747) -- 0:00:21
666500 -- (-1007.939) [-1007.607] (-1009.842) (-1008.808) * (-1011.851) (-1006.886) [-1009.769] (-1008.509) -- 0:00:21
667000 -- (-1009.937) [-1011.416] (-1007.095) (-1013.430) * (-1007.863) (-1007.525) [-1009.299] (-1010.097) -- 0:00:20
667500 -- [-1009.599] (-1008.602) (-1007.794) (-1008.033) * (-1008.363) [-1006.566] (-1008.743) (-1011.706) -- 0:00:20
668000 -- (-1008.797) (-1007.661) (-1008.731) [-1008.688] * (-1007.121) [-1006.809] (-1009.604) (-1010.344) -- 0:00:20
668500 -- (-1008.612) (-1007.529) [-1011.344] (-1008.551) * (-1007.130) [-1007.232] (-1008.897) (-1008.468) -- 0:00:20
669000 -- (-1009.997) (-1011.247) (-1008.945) [-1007.362] * (-1008.672) [-1007.750] (-1008.171) (-1009.960) -- 0:00:20
669500 -- (-1008.105) (-1007.036) (-1010.564) [-1008.813] * (-1008.957) (-1010.590) (-1007.216) [-1007.632] -- 0:00:20
670000 -- [-1008.362] (-1009.123) (-1009.877) (-1009.662) * (-1007.192) (-1010.239) (-1008.478) [-1008.266] -- 0:00:20
Average standard deviation of split frequencies: 0.011290
670500 -- [-1008.886] (-1011.180) (-1007.955) (-1010.587) * (-1007.605) (-1013.358) (-1007.893) [-1010.868] -- 0:00:20
671000 -- (-1009.939) [-1009.978] (-1009.373) (-1008.626) * (-1007.539) [-1008.778] (-1007.579) (-1007.974) -- 0:00:20
671500 -- (-1012.166) [-1008.782] (-1008.810) (-1008.158) * (-1009.527) (-1010.228) [-1007.893] (-1011.508) -- 0:00:20
672000 -- [-1006.848] (-1008.644) (-1011.263) (-1007.395) * [-1009.108] (-1009.481) (-1010.687) (-1008.807) -- 0:00:20
672500 -- (-1008.129) [-1008.757] (-1010.111) (-1007.368) * (-1010.441) (-1009.050) (-1010.225) [-1007.771] -- 0:00:20
673000 -- [-1008.298] (-1007.230) (-1008.375) (-1009.745) * (-1010.650) (-1007.874) [-1008.125] (-1012.894) -- 0:00:20
673500 -- [-1014.701] (-1009.157) (-1011.686) (-1011.428) * (-1008.932) (-1008.059) (-1008.138) [-1007.468] -- 0:00:20
674000 -- [-1011.951] (-1007.859) (-1008.992) (-1010.449) * [-1007.738] (-1007.865) (-1012.997) (-1013.034) -- 0:00:20
674500 -- (-1011.096) (-1010.719) (-1007.226) [-1007.558] * (-1006.739) (-1006.849) [-1014.172] (-1020.280) -- 0:00:20
675000 -- (-1008.944) (-1008.577) [-1009.207] (-1009.977) * [-1009.500] (-1010.192) (-1009.205) (-1006.981) -- 0:00:20
Average standard deviation of split frequencies: 0.011375
675500 -- (-1008.387) (-1012.082) (-1009.099) [-1008.901] * [-1008.368] (-1009.081) (-1016.959) (-1012.579) -- 0:00:20
676000 -- (-1011.892) [-1008.155] (-1008.309) (-1008.685) * (-1009.572) (-1010.533) [-1008.856] (-1008.606) -- 0:00:20
676500 -- (-1011.149) (-1007.429) (-1008.766) [-1012.775] * (-1011.164) [-1008.285] (-1007.729) (-1011.660) -- 0:00:20
677000 -- (-1009.923) [-1008.832] (-1008.672) (-1010.196) * [-1012.029] (-1008.320) (-1008.326) (-1011.922) -- 0:00:20
677500 -- [-1008.100] (-1007.526) (-1008.350) (-1010.512) * (-1011.240) (-1009.464) (-1007.937) [-1006.875] -- 0:00:20
678000 -- [-1009.451] (-1008.422) (-1009.819) (-1010.220) * (-1008.316) (-1006.963) [-1008.527] (-1010.353) -- 0:00:20
678500 -- (-1017.416) [-1012.244] (-1009.572) (-1007.567) * [-1010.093] (-1007.204) (-1008.674) (-1007.912) -- 0:00:20
679000 -- (-1010.806) [-1009.421] (-1010.619) (-1010.349) * (-1013.435) [-1014.454] (-1007.753) (-1009.648) -- 0:00:20
679500 -- (-1011.416) (-1011.071) [-1011.259] (-1013.458) * (-1010.686) (-1014.843) (-1008.145) [-1011.870] -- 0:00:20
680000 -- (-1011.194) [-1008.601] (-1012.307) (-1010.669) * (-1008.894) [-1009.416] (-1009.551) (-1010.747) -- 0:00:20
Average standard deviation of split frequencies: 0.011644
680500 -- (-1012.082) (-1009.339) [-1011.027] (-1011.079) * (-1008.316) (-1010.441) [-1007.763] (-1008.977) -- 0:00:20
681000 -- (-1011.150) [-1008.746] (-1011.056) (-1010.783) * (-1008.185) (-1006.766) (-1007.594) [-1008.426] -- 0:00:20
681500 -- (-1008.360) (-1009.110) [-1010.063] (-1008.767) * (-1006.962) (-1013.219) [-1010.474] (-1008.174) -- 0:00:20
682000 -- [-1007.775] (-1014.027) (-1009.505) (-1007.704) * (-1006.690) (-1009.156) [-1012.400] (-1014.033) -- 0:00:20
682500 -- [-1007.814] (-1010.264) (-1014.687) (-1008.390) * (-1007.349) (-1009.136) (-1008.205) [-1008.774] -- 0:00:20
683000 -- (-1008.089) (-1010.201) (-1006.919) [-1006.847] * (-1009.950) (-1007.028) [-1007.800] (-1009.900) -- 0:00:19
683500 -- (-1007.150) (-1008.496) [-1007.313] (-1007.302) * [-1007.647] (-1012.415) (-1007.135) (-1009.459) -- 0:00:19
684000 -- [-1009.160] (-1009.109) (-1009.281) (-1009.704) * (-1009.290) (-1007.982) (-1007.219) [-1007.989] -- 0:00:19
684500 -- (-1008.615) (-1008.393) [-1008.836] (-1008.776) * (-1010.356) (-1008.268) (-1007.881) [-1009.094] -- 0:00:19
685000 -- (-1009.068) [-1010.586] (-1007.817) (-1009.884) * (-1008.059) (-1014.045) (-1009.567) [-1007.825] -- 0:00:19
Average standard deviation of split frequencies: 0.011424
685500 -- [-1007.365] (-1008.444) (-1008.602) (-1009.916) * (-1006.901) [-1014.253] (-1009.243) (-1008.716) -- 0:00:19
686000 -- (-1007.463) (-1007.442) [-1010.229] (-1007.642) * (-1011.520) (-1013.465) [-1013.124] (-1008.759) -- 0:00:19
686500 -- (-1008.255) (-1007.642) (-1010.465) [-1008.213] * [-1010.766] (-1008.305) (-1013.394) (-1007.882) -- 0:00:19
687000 -- (-1012.858) (-1008.241) [-1006.654] (-1014.214) * (-1012.370) (-1010.873) (-1011.762) [-1008.455] -- 0:00:19
687500 -- (-1007.697) (-1009.044) [-1007.330] (-1008.207) * [-1011.842] (-1008.002) (-1009.714) (-1009.667) -- 0:00:19
688000 -- (-1008.282) (-1010.542) [-1007.567] (-1008.917) * (-1007.752) [-1007.704] (-1012.658) (-1012.020) -- 0:00:19
688500 -- (-1007.770) (-1012.249) [-1007.692] (-1011.938) * [-1008.051] (-1015.095) (-1009.735) (-1007.417) -- 0:00:19
689000 -- (-1008.924) (-1008.636) (-1009.934) [-1012.544] * (-1007.093) (-1012.077) [-1008.309] (-1007.506) -- 0:00:19
689500 -- (-1008.048) (-1007.703) (-1011.272) [-1008.323] * [-1010.880] (-1010.868) (-1008.416) (-1007.607) -- 0:00:19
690000 -- (-1008.259) (-1007.703) (-1014.246) [-1008.428] * (-1011.749) [-1012.478] (-1007.870) (-1010.925) -- 0:00:19
Average standard deviation of split frequencies: 0.011688
690500 -- (-1008.344) [-1008.414] (-1012.765) (-1012.009) * (-1014.613) [-1009.627] (-1007.567) (-1010.188) -- 0:00:19
691000 -- (-1008.509) (-1007.235) (-1010.629) [-1007.731] * (-1009.674) (-1006.827) [-1012.332] (-1012.284) -- 0:00:19
691500 -- (-1012.523) (-1007.868) (-1007.783) [-1007.373] * (-1012.608) (-1008.081) [-1007.503] (-1007.859) -- 0:00:19
692000 -- (-1009.248) [-1007.669] (-1009.558) (-1007.629) * (-1007.469) [-1008.622] (-1010.572) (-1012.954) -- 0:00:19
692500 -- [-1008.157] (-1011.241) (-1007.607) (-1007.715) * (-1008.333) (-1010.162) [-1007.106] (-1009.532) -- 0:00:19
693000 -- (-1008.136) (-1006.621) (-1009.577) [-1007.676] * (-1006.894) (-1007.976) (-1009.393) [-1009.373] -- 0:00:19
693500 -- [-1008.148] (-1009.251) (-1007.119) (-1007.360) * (-1006.856) [-1008.064] (-1009.015) (-1010.329) -- 0:00:19
694000 -- [-1008.206] (-1008.033) (-1007.490) (-1010.715) * (-1007.664) [-1010.384] (-1008.337) (-1007.825) -- 0:00:19
694500 -- (-1008.194) (-1014.375) (-1009.242) [-1007.526] * (-1007.478) (-1011.245) (-1010.153) [-1007.011] -- 0:00:19
695000 -- (-1008.137) (-1015.454) [-1011.262] (-1006.757) * (-1011.197) (-1007.792) (-1008.957) [-1008.379] -- 0:00:19
Average standard deviation of split frequencies: 0.011599
695500 -- [-1009.850] (-1010.228) (-1009.042) (-1013.789) * [-1009.502] (-1008.545) (-1009.839) (-1009.074) -- 0:00:19
696000 -- (-1012.913) [-1008.357] (-1006.931) (-1006.728) * (-1009.262) [-1008.479] (-1009.850) (-1008.531) -- 0:00:19
696500 -- (-1009.458) (-1008.512) [-1007.706] (-1009.160) * (-1011.130) [-1010.135] (-1013.357) (-1011.336) -- 0:00:19
697000 -- (-1013.712) (-1009.760) [-1008.679] (-1011.531) * (-1013.345) [-1008.922] (-1008.766) (-1011.807) -- 0:00:19
697500 -- (-1011.266) (-1013.823) (-1009.824) [-1007.528] * [-1011.479] (-1008.609) (-1007.487) (-1011.344) -- 0:00:19
698000 -- (-1009.182) (-1009.790) [-1008.134] (-1007.225) * (-1012.812) (-1008.190) [-1009.580] (-1009.964) -- 0:00:19
698500 -- [-1007.194] (-1008.674) (-1007.358) (-1009.663) * (-1012.075) (-1008.850) [-1008.671] (-1011.273) -- 0:00:18
699000 -- (-1006.923) (-1007.963) [-1007.947] (-1009.149) * (-1009.901) [-1008.544] (-1009.730) (-1007.474) -- 0:00:18
699500 -- (-1007.261) [-1008.082] (-1010.030) (-1008.363) * (-1012.785) (-1011.363) [-1008.108] (-1007.914) -- 0:00:18
700000 -- (-1011.358) (-1007.739) [-1009.129] (-1008.404) * (-1013.525) [-1007.925] (-1008.207) (-1008.768) -- 0:00:18
Average standard deviation of split frequencies: 0.011395
700500 -- (-1006.988) (-1010.253) [-1009.198] (-1008.627) * [-1011.422] (-1007.328) (-1008.476) (-1007.648) -- 0:00:18
701000 -- (-1007.724) [-1009.284] (-1008.914) (-1007.905) * (-1012.964) [-1008.894] (-1009.340) (-1007.692) -- 0:00:18
701500 -- (-1006.834) (-1009.331) [-1008.135] (-1008.305) * [-1009.783] (-1009.809) (-1009.441) (-1008.694) -- 0:00:18
702000 -- (-1007.685) [-1011.403] (-1008.460) (-1010.339) * (-1007.626) [-1007.634] (-1008.451) (-1008.851) -- 0:00:18
702500 -- [-1007.958] (-1008.737) (-1011.530) (-1007.107) * [-1008.685] (-1011.069) (-1006.642) (-1008.641) -- 0:00:18
703000 -- (-1008.449) (-1013.208) (-1010.935) [-1008.802] * [-1008.012] (-1007.575) (-1007.177) (-1007.485) -- 0:00:18
703500 -- [-1007.278] (-1008.551) (-1008.090) (-1010.587) * (-1009.639) [-1007.972] (-1007.560) (-1008.350) -- 0:00:18
704000 -- (-1010.188) [-1008.441] (-1008.208) (-1008.630) * (-1009.672) (-1008.626) (-1007.336) [-1009.351] -- 0:00:18
704500 -- (-1007.750) (-1007.842) [-1007.758] (-1010.400) * (-1012.000) (-1010.354) (-1008.056) [-1008.015] -- 0:00:18
705000 -- (-1008.894) (-1008.301) [-1013.185] (-1006.985) * (-1007.451) [-1008.303] (-1009.921) (-1008.997) -- 0:00:18
Average standard deviation of split frequencies: 0.010976
705500 -- [-1007.350] (-1008.155) (-1010.026) (-1007.206) * (-1008.840) (-1009.246) (-1013.894) [-1011.405] -- 0:00:18
706000 -- [-1007.664] (-1007.835) (-1013.878) (-1008.083) * (-1007.383) (-1011.710) [-1010.214] (-1007.560) -- 0:00:18
706500 -- (-1007.787) (-1009.664) (-1009.554) [-1011.111] * [-1008.632] (-1012.138) (-1008.702) (-1008.158) -- 0:00:18
707000 -- [-1006.455] (-1012.315) (-1011.165) (-1013.745) * (-1010.115) (-1009.982) [-1006.651] (-1007.257) -- 0:00:18
707500 -- [-1006.439] (-1010.526) (-1010.419) (-1011.030) * [-1012.092] (-1013.383) (-1009.475) (-1011.406) -- 0:00:18
708000 -- (-1008.414) [-1007.815] (-1009.804) (-1008.082) * (-1013.091) (-1010.342) [-1008.331] (-1007.529) -- 0:00:18
708500 -- (-1006.501) [-1008.960] (-1007.097) (-1009.222) * (-1007.733) (-1009.748) [-1008.194] (-1009.187) -- 0:00:18
709000 -- (-1008.082) [-1008.309] (-1008.700) (-1009.339) * (-1007.798) (-1008.394) (-1015.400) [-1009.917] -- 0:00:18
709500 -- (-1008.089) [-1009.242] (-1008.414) (-1008.030) * [-1008.528] (-1010.264) (-1009.240) (-1007.670) -- 0:00:18
710000 -- (-1008.221) [-1009.691] (-1009.173) (-1007.533) * (-1007.688) [-1008.820] (-1007.791) (-1009.377) -- 0:00:18
Average standard deviation of split frequencies: 0.010530
710500 -- [-1008.855] (-1008.928) (-1009.854) (-1006.950) * (-1007.593) [-1009.579] (-1007.635) (-1008.998) -- 0:00:18
711000 -- (-1008.946) (-1008.156) [-1009.902] (-1008.527) * (-1008.304) (-1009.650) [-1008.430] (-1010.230) -- 0:00:18
711500 -- (-1014.991) [-1007.918] (-1006.717) (-1010.519) * (-1008.274) [-1009.460] (-1011.088) (-1010.953) -- 0:00:18
712000 -- (-1009.516) [-1008.360] (-1008.867) (-1006.888) * [-1010.940] (-1011.508) (-1008.217) (-1010.297) -- 0:00:18
712500 -- [-1009.698] (-1010.316) (-1008.593) (-1008.914) * [-1007.390] (-1009.737) (-1009.642) (-1009.246) -- 0:00:18
713000 -- (-1010.040) (-1010.435) [-1008.013] (-1007.869) * (-1013.005) (-1009.448) [-1008.312] (-1008.612) -- 0:00:18
713500 -- (-1010.253) (-1009.038) (-1009.220) [-1008.042] * [-1013.813] (-1008.128) (-1007.884) (-1008.520) -- 0:00:18
714000 -- (-1012.187) [-1007.626] (-1008.002) (-1008.096) * [-1009.295] (-1008.703) (-1009.123) (-1010.146) -- 0:00:18
714500 -- [-1011.129] (-1006.812) (-1009.654) (-1008.741) * [-1008.519] (-1006.569) (-1008.787) (-1010.942) -- 0:00:17
715000 -- (-1007.604) [-1006.923] (-1007.290) (-1009.274) * (-1009.744) (-1012.876) (-1007.599) [-1008.486] -- 0:00:17
Average standard deviation of split frequencies: 0.010164
715500 -- [-1011.331] (-1009.515) (-1007.999) (-1011.771) * [-1007.515] (-1009.705) (-1006.620) (-1007.581) -- 0:00:17
716000 -- (-1011.394) (-1008.612) [-1010.000] (-1008.754) * [-1007.707] (-1012.041) (-1008.444) (-1008.304) -- 0:00:17
716500 -- [-1007.781] (-1009.333) (-1008.059) (-1010.498) * [-1008.378] (-1011.416) (-1013.050) (-1011.435) -- 0:00:17
717000 -- (-1006.652) [-1009.340] (-1008.744) (-1011.392) * (-1010.966) (-1010.913) [-1012.316] (-1009.555) -- 0:00:17
717500 -- (-1010.249) [-1008.728] (-1008.648) (-1009.430) * [-1007.783] (-1011.098) (-1007.556) (-1008.271) -- 0:00:17
718000 -- (-1008.196) [-1009.484] (-1008.722) (-1008.345) * [-1006.972] (-1014.178) (-1010.036) (-1007.853) -- 0:00:17
718500 -- [-1007.421] (-1010.302) (-1010.324) (-1009.138) * [-1006.760] (-1010.212) (-1013.001) (-1011.518) -- 0:00:17
719000 -- [-1010.295] (-1009.545) (-1010.455) (-1006.865) * (-1007.779) [-1007.088] (-1010.173) (-1008.449) -- 0:00:17
719500 -- [-1009.337] (-1007.698) (-1007.191) (-1007.549) * [-1009.843] (-1008.279) (-1013.708) (-1011.154) -- 0:00:17
720000 -- (-1007.700) (-1009.572) [-1007.318] (-1007.204) * (-1007.841) [-1010.208] (-1011.889) (-1010.338) -- 0:00:17
Average standard deviation of split frequencies: 0.010507
720500 -- [-1008.265] (-1013.608) (-1009.174) (-1007.134) * (-1007.576) (-1008.389) [-1010.618] (-1007.914) -- 0:00:17
721000 -- (-1008.459) [-1009.660] (-1013.757) (-1009.317) * (-1008.167) [-1011.079] (-1008.085) (-1009.641) -- 0:00:17
721500 -- (-1014.168) [-1007.164] (-1010.488) (-1007.746) * (-1007.593) [-1008.788] (-1007.287) (-1009.794) -- 0:00:17
722000 -- (-1010.340) (-1006.748) [-1009.733] (-1007.805) * [-1007.398] (-1007.924) (-1007.444) (-1011.201) -- 0:00:17
722500 -- [-1007.360] (-1010.986) (-1008.784) (-1007.599) * (-1008.801) (-1007.163) [-1008.704] (-1010.479) -- 0:00:17
723000 -- (-1007.537) [-1008.192] (-1014.333) (-1011.257) * (-1012.982) (-1010.186) [-1007.591] (-1009.306) -- 0:00:17
723500 -- [-1008.366] (-1007.196) (-1012.853) (-1012.369) * (-1008.968) (-1011.793) [-1007.185] (-1010.133) -- 0:00:17
724000 -- (-1008.503) (-1007.988) (-1013.581) [-1010.092] * (-1008.110) [-1010.319] (-1008.345) (-1008.431) -- 0:00:17
724500 -- (-1008.036) (-1008.036) [-1007.197] (-1011.454) * (-1012.828) (-1007.831) (-1009.831) [-1008.473] -- 0:00:17
725000 -- (-1007.836) (-1007.970) [-1009.013] (-1009.420) * (-1010.035) [-1008.727] (-1012.254) (-1007.064) -- 0:00:17
Average standard deviation of split frequencies: 0.010105
725500 -- (-1009.432) (-1006.759) [-1008.893] (-1010.414) * (-1009.674) [-1011.534] (-1013.766) (-1009.899) -- 0:00:17
726000 -- (-1007.241) (-1007.769) [-1007.740] (-1006.886) * (-1011.618) (-1010.973) [-1010.941] (-1008.409) -- 0:00:17
726500 -- (-1007.996) [-1010.278] (-1006.966) (-1008.004) * (-1008.272) (-1011.075) [-1008.011] (-1007.952) -- 0:00:17
727000 -- [-1012.356] (-1007.758) (-1007.761) (-1007.423) * [-1006.863] (-1008.115) (-1010.575) (-1010.392) -- 0:00:17
727500 -- (-1008.740) (-1012.974) (-1008.700) [-1006.843] * (-1006.846) (-1012.219) (-1011.146) [-1007.093] -- 0:00:17
728000 -- (-1007.576) (-1009.532) (-1009.167) [-1006.851] * [-1009.910] (-1010.667) (-1009.413) (-1009.477) -- 0:00:17
728500 -- (-1006.682) (-1008.309) (-1009.300) [-1007.635] * [-1009.111] (-1008.866) (-1007.859) (-1008.476) -- 0:00:17
729000 -- (-1006.779) (-1009.981) (-1009.284) [-1009.152] * (-1007.982) (-1010.819) (-1012.019) [-1011.269] -- 0:00:17
729500 -- (-1008.648) (-1009.164) [-1009.657] (-1009.539) * (-1013.149) (-1009.391) (-1008.475) [-1009.685] -- 0:00:17
730000 -- (-1013.249) (-1010.773) (-1008.132) [-1007.595] * (-1011.925) [-1008.280] (-1011.623) (-1009.528) -- 0:00:17
Average standard deviation of split frequencies: 0.010282
730500 -- [-1007.787] (-1007.418) (-1010.972) (-1008.979) * [-1009.037] (-1010.714) (-1007.688) (-1012.022) -- 0:00:16
731000 -- (-1008.306) (-1006.846) (-1008.954) [-1008.487] * (-1008.129) [-1008.765] (-1009.489) (-1011.225) -- 0:00:16
731500 -- (-1009.453) [-1008.231] (-1007.974) (-1008.396) * (-1008.588) (-1009.023) [-1010.908] (-1007.048) -- 0:00:16
732000 -- [-1007.480] (-1007.340) (-1008.271) (-1007.393) * (-1009.574) (-1011.119) (-1009.482) [-1012.405] -- 0:00:16
732500 -- (-1017.869) (-1010.288) [-1007.168] (-1008.548) * (-1010.545) [-1012.437] (-1011.804) (-1011.388) -- 0:00:16
733000 -- [-1009.423] (-1011.759) (-1007.057) (-1008.398) * (-1009.456) (-1009.775) (-1009.064) [-1009.069] -- 0:00:16
733500 -- (-1006.704) (-1007.124) (-1008.391) [-1008.598] * (-1013.126) (-1010.527) (-1011.427) [-1009.006] -- 0:00:16
734000 -- (-1006.754) [-1008.002] (-1007.380) (-1008.591) * (-1007.110) (-1008.704) (-1011.463) [-1008.585] -- 0:00:16
734500 -- (-1006.586) (-1008.488) (-1009.968) [-1007.446] * (-1007.422) (-1008.978) [-1008.149] (-1007.363) -- 0:00:16
735000 -- (-1009.186) (-1008.580) [-1009.074] (-1008.347) * (-1009.705) [-1008.662] (-1009.098) (-1007.408) -- 0:00:16
Average standard deviation of split frequencies: 0.009968
735500 -- (-1008.801) [-1009.402] (-1008.903) (-1011.452) * [-1007.735] (-1011.417) (-1006.997) (-1007.625) -- 0:00:16
736000 -- (-1007.519) [-1011.689] (-1008.167) (-1007.371) * [-1007.904] (-1011.554) (-1007.853) (-1010.259) -- 0:00:16
736500 -- [-1007.649] (-1007.770) (-1010.699) (-1009.340) * (-1010.008) (-1009.000) [-1012.854] (-1009.370) -- 0:00:16
737000 -- (-1008.788) (-1011.475) (-1011.653) [-1008.975] * [-1009.138] (-1010.072) (-1009.275) (-1008.987) -- 0:00:16
737500 -- (-1008.478) [-1009.709] (-1011.572) (-1008.003) * (-1010.567) (-1008.616) (-1007.805) [-1007.191] -- 0:00:16
738000 -- (-1009.448) [-1007.978] (-1009.204) (-1010.828) * [-1007.893] (-1006.745) (-1008.177) (-1007.610) -- 0:00:16
738500 -- (-1007.847) (-1007.519) [-1007.675] (-1016.342) * [-1007.096] (-1009.599) (-1008.227) (-1007.410) -- 0:00:16
739000 -- (-1008.714) (-1009.477) (-1007.655) [-1010.447] * (-1011.002) (-1013.415) [-1007.710] (-1008.232) -- 0:00:16
739500 -- (-1009.306) (-1007.429) [-1011.539] (-1007.957) * (-1007.418) (-1010.960) (-1007.552) [-1009.406] -- 0:00:16
740000 -- [-1007.902] (-1008.332) (-1008.816) (-1009.487) * [-1006.666] (-1007.977) (-1007.950) (-1009.147) -- 0:00:16
Average standard deviation of split frequencies: 0.009428
740500 -- (-1006.612) [-1007.746] (-1009.553) (-1007.896) * (-1007.540) (-1008.679) (-1009.171) [-1008.454] -- 0:00:16
741000 -- (-1007.848) (-1008.869) [-1011.443] (-1007.189) * (-1011.250) (-1009.644) [-1011.108] (-1008.003) -- 0:00:16
741500 -- [-1008.972] (-1011.103) (-1010.644) (-1010.792) * (-1010.065) (-1008.252) [-1008.388] (-1009.076) -- 0:00:16
742000 -- (-1008.519) (-1010.344) [-1009.448] (-1010.482) * (-1012.381) (-1013.601) [-1008.788] (-1009.988) -- 0:00:16
742500 -- (-1006.646) [-1010.145] (-1007.822) (-1010.060) * [-1009.094] (-1008.297) (-1008.679) (-1008.934) -- 0:00:16
743000 -- (-1007.579) (-1011.792) [-1007.565] (-1008.484) * (-1008.499) (-1008.410) [-1007.442] (-1009.489) -- 0:00:16
743500 -- [-1006.884] (-1014.391) (-1009.026) (-1007.542) * (-1011.338) [-1008.106] (-1010.608) (-1010.917) -- 0:00:16
744000 -- (-1008.583) [-1006.937] (-1017.085) (-1009.252) * [-1009.209] (-1009.696) (-1008.116) (-1010.487) -- 0:00:16
744500 -- (-1012.040) (-1009.014) (-1011.781) [-1009.252] * (-1013.903) [-1007.697] (-1008.747) (-1011.937) -- 0:00:16
745000 -- (-1010.760) (-1010.028) [-1009.697] (-1007.852) * (-1008.251) (-1007.090) [-1009.289] (-1011.634) -- 0:00:16
Average standard deviation of split frequencies: 0.009597
745500 -- (-1010.288) (-1008.283) (-1008.148) [-1008.550] * [-1008.198] (-1009.157) (-1007.497) (-1012.803) -- 0:00:16
746000 -- (-1012.866) (-1010.224) [-1010.155] (-1008.026) * [-1008.193] (-1009.764) (-1007.290) (-1012.058) -- 0:00:16
746500 -- (-1007.157) (-1011.047) (-1010.046) [-1008.241] * (-1006.992) (-1008.685) (-1011.410) [-1010.360] -- 0:00:15
747000 -- (-1010.064) (-1011.478) [-1011.275] (-1009.215) * (-1008.149) [-1008.271] (-1007.338) (-1013.342) -- 0:00:15
747500 -- [-1009.964] (-1007.352) (-1010.644) (-1008.981) * (-1011.191) (-1008.368) [-1010.365] (-1008.490) -- 0:00:15
748000 -- (-1012.508) [-1008.870] (-1009.597) (-1010.232) * (-1008.919) [-1007.304] (-1007.928) (-1008.296) -- 0:00:15
748500 -- (-1009.678) [-1008.093] (-1008.758) (-1007.326) * (-1009.099) (-1008.160) (-1008.650) [-1006.783] -- 0:00:15
749000 -- (-1009.087) (-1007.552) (-1006.786) [-1008.798] * [-1007.975] (-1014.917) (-1008.573) (-1007.949) -- 0:00:15
749500 -- [-1013.518] (-1012.443) (-1007.087) (-1018.703) * [-1008.900] (-1014.992) (-1011.688) (-1008.455) -- 0:00:15
750000 -- [-1010.943] (-1008.353) (-1008.465) (-1010.073) * (-1007.744) [-1007.054] (-1012.375) (-1007.089) -- 0:00:15
Average standard deviation of split frequencies: 0.009773
750500 -- (-1012.942) (-1009.952) (-1012.285) [-1011.388] * [-1008.599] (-1012.490) (-1009.748) (-1009.376) -- 0:00:15
751000 -- [-1011.431] (-1007.065) (-1015.645) (-1010.132) * [-1007.694] (-1010.708) (-1009.541) (-1006.895) -- 0:00:15
751500 -- [-1010.337] (-1007.699) (-1009.617) (-1007.460) * [-1008.218] (-1014.449) (-1008.510) (-1015.292) -- 0:00:15
752000 -- (-1007.604) [-1008.041] (-1007.503) (-1008.414) * (-1010.063) (-1010.671) [-1008.149] (-1011.526) -- 0:00:15
752500 -- [-1009.101] (-1011.470) (-1008.682) (-1011.294) * (-1012.587) (-1010.126) (-1013.039) [-1008.676] -- 0:00:15
753000 -- (-1009.752) (-1009.606) (-1007.280) [-1008.956] * [-1012.219] (-1011.347) (-1007.790) (-1010.259) -- 0:00:15
753500 -- [-1012.326] (-1008.440) (-1010.837) (-1007.344) * (-1008.197) (-1009.384) (-1011.864) [-1011.117] -- 0:00:15
754000 -- [-1008.916] (-1014.437) (-1009.685) (-1009.183) * (-1009.540) (-1007.588) (-1007.338) [-1007.505] -- 0:00:15
754500 -- (-1007.611) (-1007.726) [-1007.535] (-1010.586) * (-1008.050) (-1008.213) [-1009.982] (-1012.029) -- 0:00:15
755000 -- (-1008.058) (-1007.775) (-1010.401) [-1009.435] * (-1008.115) (-1008.061) (-1007.596) [-1007.488] -- 0:00:15
Average standard deviation of split frequencies: 0.009392
755500 -- (-1008.006) (-1007.807) (-1012.084) [-1008.961] * (-1014.368) (-1012.020) [-1012.492] (-1007.019) -- 0:00:15
756000 -- (-1008.463) (-1007.418) [-1009.006] (-1009.018) * (-1008.546) (-1008.130) [-1007.621] (-1006.709) -- 0:00:15
756500 -- [-1008.492] (-1010.399) (-1007.718) (-1008.114) * (-1009.686) [-1009.126] (-1009.529) (-1012.370) -- 0:00:15
757000 -- [-1008.393] (-1006.745) (-1010.423) (-1011.350) * (-1009.163) (-1010.588) (-1008.809) [-1009.105] -- 0:00:15
757500 -- (-1006.950) (-1006.977) (-1009.461) [-1011.120] * (-1010.043) (-1010.272) (-1012.224) [-1008.198] -- 0:00:15
758000 -- (-1009.359) [-1009.270] (-1010.344) (-1009.418) * (-1007.301) (-1014.107) [-1009.011] (-1010.025) -- 0:00:15
758500 -- (-1012.232) (-1009.586) [-1013.288] (-1010.316) * [-1009.955] (-1010.772) (-1008.092) (-1008.480) -- 0:00:15
759000 -- (-1008.862) [-1009.341] (-1011.418) (-1008.820) * (-1009.661) [-1008.255] (-1009.253) (-1007.980) -- 0:00:15
759500 -- (-1012.710) (-1009.225) [-1008.331] (-1011.488) * (-1008.753) (-1007.329) [-1009.270] (-1006.969) -- 0:00:15
760000 -- (-1008.505) (-1008.227) [-1008.680] (-1013.194) * (-1007.159) (-1010.724) (-1009.469) [-1008.975] -- 0:00:15
Average standard deviation of split frequencies: 0.009379
760500 -- (-1008.028) [-1008.324] (-1008.664) (-1009.703) * [-1007.234] (-1009.823) (-1010.838) (-1011.320) -- 0:00:15
761000 -- (-1010.969) (-1009.394) (-1009.668) [-1012.456] * (-1009.331) (-1013.193) (-1010.340) [-1008.606] -- 0:00:15
761500 -- [-1010.950] (-1009.050) (-1011.805) (-1012.519) * (-1007.039) [-1008.198] (-1010.258) (-1015.634) -- 0:00:15
762000 -- (-1008.746) (-1008.856) (-1007.062) [-1007.375] * (-1008.246) (-1009.395) (-1008.693) [-1010.492] -- 0:00:14
762500 -- (-1008.037) (-1008.388) (-1007.315) [-1011.285] * [-1007.029] (-1006.683) (-1007.227) (-1014.057) -- 0:00:14
763000 -- (-1008.543) (-1009.116) [-1013.676] (-1012.730) * (-1007.051) (-1009.256) (-1010.568) [-1007.807] -- 0:00:14
763500 -- (-1009.118) [-1009.945] (-1008.559) (-1006.699) * [-1006.970] (-1006.825) (-1007.321) (-1007.378) -- 0:00:14
764000 -- (-1009.134) [-1007.614] (-1008.745) (-1006.787) * (-1013.488) (-1011.108) [-1011.752] (-1008.738) -- 0:00:14
764500 -- [-1007.263] (-1009.020) (-1008.842) (-1007.190) * (-1011.871) [-1007.206] (-1008.090) (-1006.841) -- 0:00:14
765000 -- [-1008.551] (-1009.092) (-1008.373) (-1007.942) * (-1011.984) [-1008.025] (-1014.036) (-1008.476) -- 0:00:14
Average standard deviation of split frequencies: 0.009308
765500 -- (-1009.207) (-1008.851) (-1007.197) [-1008.435] * (-1007.830) (-1008.439) [-1009.850] (-1006.906) -- 0:00:14
766000 -- (-1007.030) [-1008.658] (-1007.197) (-1010.006) * [-1009.045] (-1008.641) (-1010.631) (-1007.063) -- 0:00:14
766500 -- (-1010.890) (-1013.354) [-1007.720] (-1010.244) * [-1008.064] (-1012.635) (-1009.265) (-1009.192) -- 0:00:14
767000 -- (-1011.955) (-1010.041) [-1008.551] (-1009.299) * (-1010.161) (-1008.246) [-1007.161] (-1011.356) -- 0:00:14
767500 -- (-1009.887) (-1010.438) [-1011.929] (-1010.509) * (-1010.355) (-1007.169) [-1007.884] (-1009.744) -- 0:00:14
768000 -- (-1008.837) [-1009.008] (-1018.572) (-1009.603) * (-1006.863) [-1007.910] (-1012.064) (-1012.425) -- 0:00:14
768500 -- [-1012.180] (-1008.240) (-1015.879) (-1009.545) * (-1010.556) [-1008.139] (-1013.213) (-1014.234) -- 0:00:14
769000 -- (-1009.959) (-1006.685) [-1008.872] (-1014.352) * (-1008.061) [-1009.044] (-1007.849) (-1010.903) -- 0:00:14
769500 -- (-1007.937) (-1007.647) (-1007.430) [-1007.514] * [-1007.455] (-1010.472) (-1013.182) (-1010.178) -- 0:00:14
770000 -- (-1011.115) (-1008.007) (-1007.205) [-1007.460] * [-1007.545] (-1015.580) (-1007.066) (-1008.629) -- 0:00:14
Average standard deviation of split frequencies: 0.009298
770500 -- (-1010.313) [-1008.869] (-1007.849) (-1008.935) * (-1009.776) (-1011.044) [-1006.976] (-1009.128) -- 0:00:14
771000 -- (-1009.511) (-1008.930) (-1007.731) [-1007.155] * (-1009.573) (-1008.943) [-1006.528] (-1010.547) -- 0:00:14
771500 -- [-1008.992] (-1008.442) (-1007.304) (-1008.032) * [-1009.097] (-1009.155) (-1008.899) (-1011.342) -- 0:00:14
772000 -- (-1008.675) (-1009.577) (-1007.108) [-1007.368] * (-1008.035) (-1008.633) (-1009.642) [-1009.451] -- 0:00:14
772500 -- (-1007.418) (-1009.826) (-1007.741) [-1007.334] * (-1007.371) (-1007.885) (-1010.318) [-1007.928] -- 0:00:14
773000 -- [-1006.700] (-1007.095) (-1009.726) (-1008.420) * (-1007.599) (-1008.536) (-1007.450) [-1010.807] -- 0:00:14
773500 -- (-1007.031) (-1007.215) (-1007.483) [-1007.657] * (-1010.064) [-1008.720] (-1007.329) (-1013.748) -- 0:00:14
774000 -- (-1011.090) (-1008.733) (-1009.286) [-1007.616] * (-1009.074) (-1007.053) [-1007.971] (-1007.902) -- 0:00:14
774500 -- (-1008.427) (-1007.669) [-1008.429] (-1008.613) * [-1006.961] (-1009.092) (-1008.568) (-1013.044) -- 0:00:14
775000 -- (-1008.153) (-1009.105) [-1006.919] (-1010.490) * (-1008.886) [-1007.305] (-1007.428) (-1008.581) -- 0:00:14
Average standard deviation of split frequencies: 0.009315
775500 -- [-1007.661] (-1015.974) (-1008.221) (-1008.259) * (-1008.029) (-1007.239) (-1008.695) [-1006.815] -- 0:00:14
776000 -- (-1007.709) (-1014.487) [-1007.507] (-1009.555) * (-1007.903) (-1007.745) [-1009.613] (-1015.742) -- 0:00:14
776500 -- (-1007.585) (-1014.307) (-1010.824) [-1007.652] * (-1006.967) (-1009.325) (-1008.518) [-1010.335] -- 0:00:14
777000 -- (-1007.706) (-1013.192) [-1008.707] (-1006.719) * [-1008.237] (-1011.348) (-1006.916) (-1007.361) -- 0:00:14
777500 -- (-1008.391) (-1009.758) (-1012.054) [-1006.677] * (-1008.686) (-1015.904) [-1007.240] (-1008.906) -- 0:00:14
778000 -- [-1008.176] (-1009.522) (-1011.673) (-1006.696) * [-1010.929] (-1011.917) (-1009.034) (-1008.291) -- 0:00:13
778500 -- (-1007.955) (-1010.253) [-1007.353] (-1007.880) * [-1006.602] (-1008.883) (-1007.841) (-1008.918) -- 0:00:13
779000 -- [-1007.596] (-1006.653) (-1008.477) (-1012.721) * (-1011.149) (-1013.560) (-1006.750) [-1008.195] -- 0:00:13
779500 -- [-1008.248] (-1007.634) (-1011.180) (-1009.435) * [-1011.676] (-1009.507) (-1007.670) (-1008.412) -- 0:00:13
780000 -- (-1008.532) (-1007.010) (-1010.195) [-1008.840] * [-1007.803] (-1014.269) (-1010.065) (-1008.293) -- 0:00:13
Average standard deviation of split frequencies: 0.009380
780500 -- (-1006.911) (-1007.602) [-1009.250] (-1008.668) * (-1009.985) (-1010.991) (-1010.315) [-1014.146] -- 0:00:13
781000 -- (-1006.911) (-1009.683) (-1010.966) [-1008.325] * (-1009.264) [-1009.371] (-1009.036) (-1010.958) -- 0:00:13
781500 -- (-1006.873) [-1008.073] (-1011.857) (-1009.911) * [-1007.992] (-1010.999) (-1010.767) (-1008.193) -- 0:00:13
782000 -- [-1006.862] (-1008.381) (-1009.010) (-1009.775) * (-1007.553) (-1009.210) (-1008.933) [-1009.823] -- 0:00:13
782500 -- (-1006.718) (-1009.180) [-1010.474] (-1012.556) * (-1007.837) [-1007.418] (-1008.284) (-1008.084) -- 0:00:13
783000 -- (-1007.600) [-1008.032] (-1008.847) (-1012.547) * (-1009.510) (-1007.867) [-1011.885] (-1011.737) -- 0:00:13
783500 -- (-1011.604) (-1008.280) (-1006.696) [-1007.686] * (-1010.295) (-1010.698) [-1011.329] (-1010.537) -- 0:00:13
784000 -- (-1013.055) [-1008.236] (-1010.134) (-1007.042) * (-1010.532) [-1009.484] (-1009.281) (-1007.889) -- 0:00:13
784500 -- (-1008.320) [-1008.036] (-1011.414) (-1008.764) * (-1013.242) [-1012.217] (-1008.163) (-1010.567) -- 0:00:13
785000 -- (-1007.582) (-1013.466) (-1008.989) [-1011.651] * (-1008.993) (-1015.194) [-1011.805] (-1007.689) -- 0:00:13
Average standard deviation of split frequencies: 0.009156
785500 -- (-1007.832) [-1008.530] (-1007.840) (-1009.147) * [-1007.431] (-1009.316) (-1010.319) (-1010.469) -- 0:00:13
786000 -- (-1008.163) (-1012.507) (-1009.457) [-1010.381] * (-1007.813) (-1012.453) [-1008.856] (-1006.912) -- 0:00:13
786500 -- [-1007.414] (-1010.808) (-1010.481) (-1009.210) * [-1008.634] (-1009.808) (-1009.587) (-1007.957) -- 0:00:13
787000 -- (-1007.686) (-1009.468) [-1009.485] (-1011.600) * (-1008.291) (-1008.395) (-1009.849) [-1008.254] -- 0:00:13
787500 -- [-1011.201] (-1007.870) (-1009.249) (-1017.267) * [-1007.608] (-1007.618) (-1009.688) (-1008.781) -- 0:00:13
788000 -- (-1012.956) (-1009.383) [-1009.423] (-1008.125) * [-1009.004] (-1007.107) (-1008.257) (-1007.502) -- 0:00:13
788500 -- (-1018.266) (-1012.830) (-1015.940) [-1008.050] * [-1007.369] (-1008.644) (-1010.666) (-1008.253) -- 0:00:13
789000 -- (-1007.828) (-1009.916) (-1007.286) [-1009.834] * (-1006.677) (-1010.289) [-1010.171] (-1009.862) -- 0:00:13
789500 -- [-1008.591] (-1009.662) (-1008.915) (-1009.930) * (-1006.871) [-1007.558] (-1007.551) (-1008.658) -- 0:00:13
790000 -- (-1008.050) [-1007.538] (-1008.986) (-1007.367) * (-1008.448) (-1009.959) (-1007.857) [-1009.437] -- 0:00:13
Average standard deviation of split frequencies: 0.009062
790500 -- (-1011.202) [-1010.869] (-1008.873) (-1007.270) * (-1008.516) [-1007.722] (-1009.013) (-1012.868) -- 0:00:12
791000 -- (-1008.836) (-1009.317) (-1009.970) [-1008.609] * [-1008.793] (-1011.198) (-1011.732) (-1007.718) -- 0:00:13
791500 -- [-1008.294] (-1008.200) (-1009.057) (-1008.508) * (-1009.292) (-1009.346) (-1014.569) [-1007.421] -- 0:00:13
792000 -- (-1010.309) (-1008.553) [-1008.276] (-1011.941) * (-1010.620) [-1007.834] (-1012.689) (-1010.100) -- 0:00:13
792500 -- (-1009.800) [-1008.646] (-1010.785) (-1009.659) * (-1007.915) [-1009.911] (-1010.903) (-1009.303) -- 0:00:13
793000 -- (-1011.674) [-1007.051] (-1011.376) (-1012.250) * (-1010.082) (-1007.837) (-1009.480) [-1008.992] -- 0:00:13
793500 -- (-1010.947) (-1008.420) (-1012.165) [-1008.044] * [-1014.534] (-1008.517) (-1010.746) (-1010.640) -- 0:00:13
794000 -- (-1008.644) [-1008.091] (-1011.269) (-1008.056) * (-1010.961) (-1009.297) (-1011.981) [-1013.318] -- 0:00:12
794500 -- (-1007.773) [-1008.042] (-1010.235) (-1007.704) * (-1009.734) [-1010.854] (-1007.894) (-1012.740) -- 0:00:12
795000 -- (-1011.593) [-1009.173] (-1009.261) (-1006.933) * [-1010.874] (-1009.078) (-1009.669) (-1013.270) -- 0:00:12
Average standard deviation of split frequencies: 0.009278
795500 -- (-1008.901) [-1008.947] (-1011.391) (-1007.638) * (-1013.002) [-1007.384] (-1010.669) (-1011.345) -- 0:00:12
796000 -- (-1009.320) (-1009.365) [-1008.116] (-1006.753) * (-1006.920) (-1013.093) [-1007.533] (-1011.959) -- 0:00:12
796500 -- (-1009.299) (-1011.954) [-1009.331] (-1006.990) * [-1007.494] (-1013.303) (-1009.619) (-1010.617) -- 0:00:12
797000 -- (-1015.841) (-1011.021) (-1007.112) [-1013.787] * (-1009.706) [-1007.361] (-1014.274) (-1010.278) -- 0:00:12
797500 -- (-1008.665) (-1010.540) [-1007.308] (-1009.822) * (-1013.350) (-1006.823) (-1008.716) [-1006.809] -- 0:00:12
798000 -- [-1008.445] (-1009.176) (-1013.820) (-1012.906) * (-1009.026) [-1007.257] (-1010.693) (-1006.716) -- 0:00:12
798500 -- (-1012.279) (-1011.492) (-1014.079) [-1007.574] * (-1012.319) [-1008.784] (-1006.941) (-1008.518) -- 0:00:12
799000 -- [-1008.051] (-1009.113) (-1010.800) (-1008.473) * [-1011.065] (-1011.326) (-1013.157) (-1007.867) -- 0:00:12
799500 -- (-1008.873) (-1014.842) [-1008.642] (-1008.348) * [-1008.184] (-1007.931) (-1009.150) (-1007.614) -- 0:00:12
800000 -- (-1010.584) (-1013.059) (-1008.456) [-1007.861] * (-1008.717) [-1007.638] (-1009.464) (-1007.818) -- 0:00:12
Average standard deviation of split frequencies: 0.009145
800500 -- (-1011.222) [-1008.858] (-1010.856) (-1009.022) * (-1007.536) (-1008.482) [-1009.382] (-1011.201) -- 0:00:12
801000 -- [-1010.895] (-1010.284) (-1007.289) (-1014.420) * [-1007.900] (-1009.446) (-1009.629) (-1011.888) -- 0:00:12
801500 -- (-1008.445) (-1009.512) [-1008.137] (-1008.909) * [-1009.111] (-1009.161) (-1012.142) (-1008.819) -- 0:00:12
802000 -- (-1009.155) [-1011.704] (-1009.400) (-1008.844) * (-1007.078) [-1009.481] (-1007.015) (-1010.324) -- 0:00:12
802500 -- (-1007.783) (-1006.791) [-1010.488] (-1014.377) * (-1009.028) (-1012.842) [-1007.130] (-1009.675) -- 0:00:12
803000 -- (-1010.876) (-1009.257) [-1008.304] (-1008.625) * (-1011.871) (-1006.749) [-1009.437] (-1008.114) -- 0:00:12
803500 -- (-1012.989) (-1010.546) [-1008.244] (-1010.213) * (-1008.801) (-1006.868) [-1016.767] (-1011.430) -- 0:00:12
804000 -- (-1014.785) [-1007.579] (-1008.701) (-1010.653) * (-1008.932) (-1012.679) (-1008.196) [-1009.769] -- 0:00:12
804500 -- (-1013.648) (-1011.938) [-1007.857] (-1013.054) * (-1010.966) [-1011.141] (-1008.272) (-1007.798) -- 0:00:12
805000 -- [-1011.849] (-1010.611) (-1009.901) (-1011.413) * (-1009.121) (-1009.001) (-1013.350) [-1008.046] -- 0:00:12
Average standard deviation of split frequencies: 0.009124
805500 -- (-1012.973) (-1013.371) (-1006.717) [-1007.247] * (-1009.875) (-1007.538) [-1010.102] (-1007.971) -- 0:00:12
806000 -- (-1009.017) (-1011.215) (-1011.610) [-1006.669] * (-1008.453) (-1009.510) [-1008.431] (-1007.707) -- 0:00:12
806500 -- (-1010.411) (-1009.248) [-1010.209] (-1008.249) * (-1009.097) (-1007.799) (-1015.619) [-1007.871] -- 0:00:11
807000 -- (-1009.765) [-1009.524] (-1008.746) (-1008.785) * (-1008.482) (-1009.739) [-1009.104] (-1014.633) -- 0:00:12
807500 -- (-1011.719) (-1007.428) (-1010.527) [-1007.878] * (-1008.756) (-1010.341) (-1008.131) [-1009.358] -- 0:00:12
808000 -- (-1010.484) (-1010.425) [-1007.906] (-1010.021) * (-1008.056) [-1009.935] (-1007.228) (-1014.391) -- 0:00:12
808500 -- [-1006.705] (-1011.549) (-1007.967) (-1008.191) * [-1008.027] (-1010.269) (-1006.516) (-1010.807) -- 0:00:12
809000 -- (-1006.705) [-1009.687] (-1009.810) (-1007.404) * [-1008.383] (-1011.450) (-1007.988) (-1009.583) -- 0:00:12
809500 -- (-1007.680) (-1010.312) (-1009.144) [-1008.324] * [-1008.534] (-1007.987) (-1008.567) (-1009.759) -- 0:00:12
810000 -- (-1007.452) [-1008.751] (-1009.162) (-1012.076) * (-1011.184) (-1008.329) [-1008.235] (-1010.341) -- 0:00:11
Average standard deviation of split frequencies: 0.009343
810500 -- [-1007.396] (-1010.422) (-1008.172) (-1009.930) * (-1011.127) (-1007.479) [-1009.029] (-1010.537) -- 0:00:11
811000 -- (-1009.743) (-1009.165) [-1006.690] (-1008.621) * [-1007.886] (-1010.571) (-1009.020) (-1009.144) -- 0:00:11
811500 -- [-1010.319] (-1011.052) (-1007.575) (-1007.534) * (-1008.078) (-1010.234) [-1009.877] (-1009.019) -- 0:00:11
812000 -- (-1009.958) [-1007.690] (-1007.114) (-1007.224) * (-1007.782) (-1010.017) [-1007.306] (-1011.597) -- 0:00:11
812500 -- (-1011.233) [-1008.173] (-1010.826) (-1009.935) * (-1008.583) (-1007.779) (-1007.271) [-1007.853] -- 0:00:11
813000 -- (-1008.166) (-1008.793) (-1010.704) [-1006.964] * [-1009.202] (-1008.773) (-1007.646) (-1007.508) -- 0:00:11
813500 -- (-1006.649) (-1007.558) (-1010.709) [-1010.513] * [-1007.012] (-1007.930) (-1009.259) (-1006.978) -- 0:00:11
814000 -- (-1006.859) [-1011.196] (-1009.930) (-1009.228) * [-1007.003] (-1006.873) (-1010.013) (-1017.249) -- 0:00:11
814500 -- (-1008.124) [-1007.707] (-1010.002) (-1007.744) * [-1007.069] (-1007.220) (-1012.307) (-1011.125) -- 0:00:11
815000 -- (-1009.105) (-1008.070) [-1008.127] (-1007.616) * (-1008.622) (-1008.200) (-1008.819) [-1009.059] -- 0:00:11
Average standard deviation of split frequencies: 0.009513
815500 -- [-1009.176] (-1013.183) (-1009.899) (-1008.377) * (-1009.592) (-1007.522) (-1009.205) [-1008.454] -- 0:00:11
816000 -- [-1008.515] (-1011.769) (-1011.705) (-1008.221) * (-1009.986) [-1008.034] (-1011.034) (-1010.257) -- 0:00:11
816500 -- (-1007.629) [-1009.141] (-1011.519) (-1008.698) * (-1009.775) (-1008.875) [-1008.295] (-1008.872) -- 0:00:11
817000 -- (-1006.905) [-1009.481] (-1008.209) (-1009.994) * [-1011.088] (-1010.476) (-1008.542) (-1009.506) -- 0:00:11
817500 -- (-1007.883) (-1007.690) (-1010.178) [-1012.317] * (-1008.516) (-1008.379) (-1008.080) [-1009.081] -- 0:00:11
818000 -- [-1008.166] (-1007.869) (-1010.719) (-1012.382) * [-1007.872] (-1007.680) (-1008.461) (-1009.553) -- 0:00:11
818500 -- (-1011.547) (-1008.179) (-1012.019) [-1007.126] * [-1010.287] (-1007.881) (-1007.961) (-1012.993) -- 0:00:11
819000 -- (-1010.801) (-1007.448) (-1008.402) [-1007.787] * (-1006.985) (-1010.273) [-1008.598] (-1009.844) -- 0:00:11
819500 -- (-1014.419) [-1007.413] (-1009.646) (-1009.180) * (-1008.724) [-1015.932] (-1007.794) (-1010.373) -- 0:00:11
820000 -- (-1010.487) (-1008.787) (-1007.408) [-1007.670] * (-1010.367) (-1009.038) [-1008.310] (-1009.238) -- 0:00:11
Average standard deviation of split frequencies: 0.009344
820500 -- (-1009.526) [-1008.653] (-1007.997) (-1010.571) * [-1009.097] (-1009.765) (-1007.835) (-1008.282) -- 0:00:11
821000 -- (-1007.830) [-1008.037] (-1014.248) (-1009.443) * (-1008.715) (-1010.278) (-1010.222) [-1007.126] -- 0:00:11
821500 -- (-1007.450) [-1010.284] (-1012.700) (-1011.037) * (-1010.705) (-1010.409) (-1011.567) [-1010.226] -- 0:00:11
822000 -- (-1008.387) (-1010.236) [-1008.221] (-1010.184) * [-1010.096] (-1011.274) (-1008.860) (-1012.672) -- 0:00:11
822500 -- [-1009.676] (-1010.725) (-1010.148) (-1011.361) * (-1010.520) (-1009.293) (-1011.386) [-1009.515] -- 0:00:11
823000 -- (-1010.036) (-1008.867) (-1008.065) [-1009.039] * [-1007.684] (-1008.468) (-1009.207) (-1008.526) -- 0:00:10
823500 -- (-1008.607) [-1013.508] (-1010.506) (-1010.154) * (-1009.572) (-1008.667) (-1009.888) [-1008.769] -- 0:00:11
824000 -- (-1008.734) (-1011.578) [-1009.592] (-1009.434) * (-1007.602) [-1007.690] (-1009.888) (-1007.400) -- 0:00:11
824500 -- (-1010.358) (-1009.839) (-1007.159) [-1008.567] * (-1008.940) [-1008.590] (-1012.973) (-1011.590) -- 0:00:11
825000 -- (-1011.234) (-1011.769) (-1012.793) [-1008.871] * (-1009.599) (-1011.760) [-1010.451] (-1007.494) -- 0:00:11
Average standard deviation of split frequencies: 0.009550
825500 -- (-1010.202) (-1010.450) [-1009.188] (-1014.317) * (-1009.602) (-1012.216) [-1008.140] (-1008.159) -- 0:00:10
826000 -- (-1010.305) (-1012.589) [-1007.277] (-1012.108) * [-1010.217] (-1008.463) (-1009.056) (-1007.100) -- 0:00:10
826500 -- (-1008.245) [-1007.674] (-1007.163) (-1009.431) * (-1007.840) (-1009.107) (-1010.888) [-1007.169] -- 0:00:10
827000 -- (-1007.404) [-1014.340] (-1009.221) (-1010.186) * (-1008.352) [-1008.636] (-1007.477) (-1006.704) -- 0:00:10
827500 -- (-1009.763) (-1011.025) [-1014.652] (-1009.698) * (-1007.720) [-1009.024] (-1010.646) (-1006.687) -- 0:00:10
828000 -- (-1013.946) (-1009.164) (-1010.618) [-1009.193] * (-1010.073) (-1007.933) [-1010.540] (-1010.575) -- 0:00:10
828500 -- (-1010.186) (-1009.256) (-1007.037) [-1008.942] * [-1008.072] (-1009.532) (-1009.893) (-1008.728) -- 0:00:10
829000 -- (-1008.951) (-1008.158) (-1010.823) [-1008.484] * [-1007.445] (-1008.171) (-1010.455) (-1007.873) -- 0:00:10
829500 -- (-1010.382) [-1008.216] (-1007.594) (-1007.623) * (-1010.211) (-1010.561) (-1009.157) [-1008.041] -- 0:00:10
830000 -- (-1011.018) (-1012.199) [-1007.374] (-1007.742) * (-1010.437) (-1007.413) (-1011.528) [-1007.065] -- 0:00:10
Average standard deviation of split frequencies: 0.009648
830500 -- (-1008.817) (-1011.296) (-1011.081) [-1008.313] * [-1007.944] (-1006.740) (-1007.936) (-1007.111) -- 0:00:10
831000 -- (-1010.896) (-1007.338) [-1008.293] (-1006.991) * (-1007.946) [-1007.471] (-1006.956) (-1007.657) -- 0:00:10
831500 -- (-1010.603) [-1009.312] (-1008.477) (-1009.889) * [-1008.349] (-1009.633) (-1008.156) (-1009.295) -- 0:00:10
832000 -- (-1007.543) (-1010.541) [-1007.246] (-1010.753) * [-1008.692] (-1009.305) (-1006.940) (-1008.692) -- 0:00:10
832500 -- [-1008.184] (-1007.945) (-1007.017) (-1011.627) * [-1010.245] (-1008.325) (-1009.387) (-1011.044) -- 0:00:10
833000 -- (-1007.432) [-1007.632] (-1009.082) (-1010.122) * (-1012.427) (-1007.923) [-1008.950] (-1010.985) -- 0:00:10
833500 -- (-1007.827) (-1006.613) [-1008.454] (-1008.106) * (-1008.449) [-1008.741] (-1009.626) (-1007.504) -- 0:00:10
834000 -- [-1008.031] (-1008.266) (-1009.786) (-1008.393) * (-1011.486) (-1012.116) [-1015.135] (-1008.717) -- 0:00:10
834500 -- [-1008.460] (-1007.913) (-1011.710) (-1009.330) * [-1007.961] (-1008.162) (-1012.063) (-1009.604) -- 0:00:10
835000 -- [-1007.040] (-1007.568) (-1014.272) (-1012.555) * (-1011.908) (-1009.362) [-1012.899] (-1009.074) -- 0:00:10
Average standard deviation of split frequencies: 0.009887
835500 -- (-1008.630) (-1008.977) [-1008.010] (-1011.713) * (-1015.227) (-1007.825) [-1008.648] (-1008.128) -- 0:00:10
836000 -- (-1009.514) (-1006.970) (-1010.034) [-1011.331] * (-1007.335) (-1007.819) (-1007.237) [-1008.773] -- 0:00:10
836500 -- [-1008.899] (-1007.357) (-1010.877) (-1007.222) * (-1007.909) (-1009.219) (-1007.866) [-1007.765] -- 0:00:10
837000 -- [-1008.289] (-1009.316) (-1011.860) (-1009.916) * (-1010.100) [-1006.675] (-1009.766) (-1007.932) -- 0:00:10
837500 -- [-1010.185] (-1009.071) (-1008.426) (-1008.051) * (-1008.954) (-1007.084) (-1010.887) [-1007.252] -- 0:00:10
838000 -- [-1009.025] (-1007.101) (-1009.993) (-1007.116) * [-1007.999] (-1008.028) (-1012.942) (-1007.134) -- 0:00:10
838500 -- (-1010.107) [-1008.726] (-1008.450) (-1006.597) * [-1008.065] (-1010.294) (-1008.026) (-1007.134) -- 0:00:10
839000 -- (-1009.702) [-1007.309] (-1007.091) (-1008.400) * (-1008.001) (-1009.565) (-1008.274) [-1009.931] -- 0:00:09
839500 -- (-1007.463) (-1008.500) [-1007.279] (-1010.894) * (-1006.897) (-1009.238) [-1009.646] (-1008.206) -- 0:00:09
840000 -- (-1006.946) (-1007.839) [-1007.312] (-1007.753) * (-1010.973) (-1008.820) [-1008.556] (-1007.793) -- 0:00:10
Average standard deviation of split frequencies: 0.009421
840500 -- (-1007.118) [-1008.322] (-1008.345) (-1008.715) * [-1009.405] (-1007.612) (-1008.456) (-1007.381) -- 0:00:10
841000 -- (-1008.404) [-1007.881] (-1009.871) (-1013.263) * (-1007.360) [-1007.889] (-1011.430) (-1007.113) -- 0:00:10
841500 -- (-1010.428) (-1010.169) (-1012.869) [-1008.756] * (-1007.187) (-1008.965) (-1009.404) [-1008.804] -- 0:00:09
842000 -- (-1008.930) [-1011.191] (-1009.492) (-1009.721) * (-1012.482) (-1008.070) (-1009.951) [-1010.950] -- 0:00:09
842500 -- [-1007.056] (-1008.854) (-1008.374) (-1008.880) * (-1010.078) (-1007.618) (-1011.067) [-1013.561] -- 0:00:09
843000 -- (-1008.913) (-1011.451) (-1011.593) [-1008.938] * (-1011.715) [-1011.973] (-1014.290) (-1012.441) -- 0:00:09
843500 -- (-1007.260) (-1012.376) (-1007.654) [-1008.184] * (-1012.587) (-1009.068) (-1009.629) [-1007.700] -- 0:00:09
844000 -- (-1009.337) [-1009.349] (-1010.939) (-1010.805) * (-1009.436) (-1010.690) (-1008.666) [-1007.652] -- 0:00:09
844500 -- (-1016.359) (-1007.791) (-1010.331) [-1012.733] * (-1009.089) (-1010.186) [-1008.459] (-1010.077) -- 0:00:09
845000 -- [-1013.301] (-1007.389) (-1008.692) (-1010.611) * (-1015.103) (-1015.080) [-1007.722] (-1015.190) -- 0:00:09
Average standard deviation of split frequencies: 0.010030
845500 -- (-1008.585) (-1008.295) [-1009.609] (-1010.587) * (-1017.914) (-1011.920) [-1009.518] (-1009.462) -- 0:00:09
846000 -- (-1009.400) (-1011.948) (-1009.225) [-1010.129] * (-1011.872) (-1008.549) (-1007.865) [-1009.344] -- 0:00:09
846500 -- [-1009.703] (-1007.858) (-1010.243) (-1008.286) * (-1010.119) (-1008.449) [-1007.317] (-1009.740) -- 0:00:09
847000 -- (-1007.847) (-1007.239) (-1009.677) [-1006.775] * (-1007.343) [-1008.270] (-1008.942) (-1007.803) -- 0:00:09
847500 -- (-1012.344) (-1008.434) (-1013.952) [-1008.197] * (-1008.275) (-1008.054) (-1007.428) [-1012.421] -- 0:00:09
848000 -- [-1007.998] (-1010.926) (-1007.358) (-1008.443) * [-1007.887] (-1009.562) (-1007.360) (-1007.719) -- 0:00:09
848500 -- (-1010.832) (-1009.214) (-1010.010) [-1008.705] * (-1007.995) [-1007.005] (-1008.237) (-1006.558) -- 0:00:09
849000 -- [-1007.693] (-1008.744) (-1009.954) (-1011.483) * [-1008.283] (-1006.998) (-1008.424) (-1007.780) -- 0:00:09
849500 -- (-1009.029) (-1009.845) [-1009.364] (-1009.731) * (-1007.380) [-1007.650] (-1015.795) (-1009.121) -- 0:00:09
850000 -- (-1008.416) (-1009.386) (-1009.260) [-1008.913] * (-1009.264) [-1008.996] (-1007.859) (-1009.126) -- 0:00:09
Average standard deviation of split frequencies: 0.010233
850500 -- (-1012.255) (-1011.063) [-1008.583] (-1008.684) * (-1009.736) (-1009.049) [-1007.453] (-1009.113) -- 0:00:09
851000 -- (-1013.971) (-1010.995) [-1010.726] (-1013.497) * (-1009.350) [-1009.208] (-1007.908) (-1008.258) -- 0:00:09
851500 -- [-1007.228] (-1009.021) (-1010.580) (-1008.883) * (-1008.213) (-1008.704) (-1007.116) [-1009.611] -- 0:00:09
852000 -- [-1008.920] (-1008.495) (-1007.654) (-1007.703) * (-1006.994) [-1008.529] (-1009.902) (-1007.851) -- 0:00:09
852500 -- (-1012.414) (-1007.490) (-1011.675) [-1011.765] * (-1009.192) [-1009.503] (-1008.332) (-1012.703) -- 0:00:09
853000 -- (-1009.252) [-1007.021] (-1011.611) (-1008.455) * [-1011.706] (-1015.414) (-1010.298) (-1011.954) -- 0:00:09
853500 -- (-1008.841) (-1008.019) [-1009.388] (-1008.543) * (-1010.087) (-1012.949) (-1008.747) [-1010.577] -- 0:00:09
854000 -- [-1008.989] (-1009.277) (-1007.543) (-1011.863) * [-1008.701] (-1007.231) (-1008.099) (-1007.031) -- 0:00:09
854500 -- (-1011.772) (-1010.960) (-1007.475) [-1006.993] * (-1013.456) (-1008.743) [-1008.644] (-1010.790) -- 0:00:09
855000 -- (-1008.109) [-1007.379] (-1007.443) (-1009.986) * (-1007.989) (-1008.678) [-1008.947] (-1009.211) -- 0:00:08
Average standard deviation of split frequencies: 0.010133
855500 -- [-1007.259] (-1008.319) (-1007.352) (-1007.501) * (-1012.149) (-1008.212) [-1008.507] (-1009.804) -- 0:00:08
856000 -- [-1007.954] (-1008.152) (-1007.183) (-1011.735) * (-1008.875) (-1008.117) [-1010.612] (-1009.231) -- 0:00:09
856500 -- (-1007.310) (-1010.213) (-1010.783) [-1012.137] * (-1007.664) (-1007.958) [-1007.810] (-1013.254) -- 0:00:09
857000 -- (-1008.567) (-1009.188) (-1007.258) [-1010.095] * (-1009.337) [-1007.498] (-1007.780) (-1012.124) -- 0:00:09
857500 -- [-1010.167] (-1008.809) (-1007.211) (-1008.116) * (-1006.911) (-1008.619) (-1008.732) [-1010.019] -- 0:00:08
858000 -- (-1008.325) [-1007.620] (-1009.601) (-1009.244) * [-1009.731] (-1011.778) (-1010.589) (-1007.331) -- 0:00:08
858500 -- (-1008.439) (-1007.186) (-1007.822) [-1007.585] * (-1010.129) (-1008.914) (-1009.777) [-1010.329] -- 0:00:08
859000 -- [-1008.504] (-1008.516) (-1010.015) (-1011.992) * (-1012.393) (-1012.902) (-1006.701) [-1015.378] -- 0:00:08
859500 -- (-1010.827) (-1013.101) [-1009.286] (-1012.684) * (-1011.738) (-1019.206) [-1009.537] (-1012.634) -- 0:00:08
860000 -- (-1007.346) [-1007.672] (-1010.854) (-1009.045) * (-1017.426) [-1007.975] (-1008.302) (-1008.165) -- 0:00:08
Average standard deviation of split frequencies: 0.009603
860500 -- (-1007.648) (-1007.116) [-1007.827] (-1008.685) * [-1015.898] (-1010.350) (-1007.989) (-1010.475) -- 0:00:08
861000 -- (-1007.152) (-1007.214) (-1008.061) [-1007.174] * [-1011.768] (-1008.721) (-1007.765) (-1009.529) -- 0:00:08
861500 -- (-1008.353) [-1006.648] (-1006.777) (-1007.157) * (-1012.359) (-1012.105) [-1007.698] (-1009.960) -- 0:00:08
862000 -- (-1008.804) (-1007.052) [-1008.548] (-1007.851) * (-1008.133) (-1011.577) [-1009.504] (-1009.421) -- 0:00:08
862500 -- [-1007.228] (-1010.386) (-1007.855) (-1009.550) * (-1010.382) (-1011.068) [-1010.653] (-1007.894) -- 0:00:08
863000 -- [-1009.080] (-1011.131) (-1010.819) (-1008.357) * (-1007.214) [-1007.957] (-1007.697) (-1007.098) -- 0:00:08
863500 -- [-1008.785] (-1013.439) (-1011.353) (-1009.967) * (-1011.718) (-1009.123) (-1017.156) [-1007.208] -- 0:00:08
864000 -- (-1008.523) (-1009.257) [-1008.299] (-1008.355) * [-1010.429] (-1007.966) (-1007.322) (-1007.705) -- 0:00:08
864500 -- (-1010.111) (-1008.041) (-1007.323) [-1008.699] * (-1010.960) (-1009.630) [-1007.521] (-1006.809) -- 0:00:08
865000 -- (-1009.725) (-1008.176) [-1008.238] (-1007.312) * (-1009.175) [-1007.788] (-1011.492) (-1008.072) -- 0:00:08
Average standard deviation of split frequencies: 0.009726
865500 -- (-1010.309) [-1010.139] (-1009.564) (-1010.501) * (-1011.502) [-1007.316] (-1006.934) (-1007.939) -- 0:00:08
866000 -- [-1007.177] (-1008.490) (-1007.849) (-1011.589) * (-1010.829) (-1008.944) (-1007.011) [-1008.788] -- 0:00:08
866500 -- (-1007.996) [-1007.877] (-1008.901) (-1012.368) * [-1009.726] (-1008.374) (-1010.686) (-1009.996) -- 0:00:08
867000 -- (-1006.724) (-1009.914) (-1013.023) [-1008.240] * (-1007.536) (-1011.620) [-1011.714] (-1011.417) -- 0:00:08
867500 -- (-1011.025) [-1010.076] (-1010.149) (-1007.840) * (-1007.005) (-1010.419) [-1009.413] (-1007.786) -- 0:00:08
868000 -- (-1010.246) (-1010.236) (-1008.176) [-1008.481] * (-1010.129) (-1010.369) (-1009.629) [-1007.115] -- 0:00:08
868500 -- (-1011.403) (-1009.843) (-1008.406) [-1007.277] * [-1008.729] (-1009.132) (-1007.506) (-1008.834) -- 0:00:08
869000 -- (-1014.373) [-1010.551] (-1013.080) (-1010.377) * (-1007.785) (-1007.648) [-1009.005] (-1006.802) -- 0:00:08
869500 -- (-1010.450) (-1010.143) (-1009.773) [-1008.470] * (-1008.395) (-1007.252) [-1008.392] (-1008.570) -- 0:00:08
870000 -- (-1008.978) [-1009.713] (-1008.601) (-1007.296) * [-1012.535] (-1009.560) (-1007.928) (-1010.609) -- 0:00:08
Average standard deviation of split frequencies: 0.009890
870500 -- [-1011.210] (-1009.540) (-1012.485) (-1007.580) * (-1007.420) (-1010.025) (-1009.143) [-1007.849] -- 0:00:08
871000 -- [-1011.326] (-1009.095) (-1010.014) (-1011.498) * (-1008.350) [-1008.006] (-1011.103) (-1008.665) -- 0:00:07
871500 -- (-1009.358) [-1009.757] (-1013.245) (-1012.023) * (-1009.345) (-1010.167) (-1009.218) [-1009.869] -- 0:00:07
872000 -- [-1006.541] (-1008.907) (-1008.342) (-1011.734) * (-1007.363) [-1008.405] (-1011.079) (-1007.096) -- 0:00:07
872500 -- (-1011.349) (-1011.443) [-1007.240] (-1009.859) * (-1007.454) [-1008.664] (-1009.230) (-1008.250) -- 0:00:08
873000 -- (-1008.027) [-1009.021] (-1010.349) (-1008.278) * [-1007.630] (-1007.730) (-1009.219) (-1007.235) -- 0:00:08
873500 -- (-1010.856) (-1013.234) (-1012.605) [-1008.199] * (-1008.429) (-1008.563) [-1014.572] (-1008.064) -- 0:00:07
874000 -- (-1012.898) (-1009.748) (-1009.095) [-1009.639] * (-1009.844) (-1008.182) [-1013.364] (-1008.561) -- 0:00:07
874500 -- [-1008.835] (-1007.279) (-1015.335) (-1008.848) * (-1008.066) (-1010.736) (-1018.955) [-1007.988] -- 0:00:07
875000 -- (-1009.046) [-1009.043] (-1014.750) (-1009.838) * [-1008.854] (-1007.016) (-1009.735) (-1009.196) -- 0:00:07
Average standard deviation of split frequencies: 0.009830
875500 -- [-1009.007] (-1007.288) (-1010.577) (-1009.084) * (-1007.940) (-1007.889) (-1009.874) [-1008.184] -- 0:00:07
876000 -- (-1011.470) [-1007.916] (-1009.343) (-1010.456) * (-1009.862) [-1009.523] (-1008.581) (-1015.463) -- 0:00:07
876500 -- (-1009.071) [-1007.000] (-1009.780) (-1007.196) * (-1007.434) [-1009.741] (-1011.617) (-1010.628) -- 0:00:07
877000 -- (-1008.051) (-1011.642) (-1009.358) [-1007.967] * (-1011.371) (-1009.507) [-1007.446] (-1010.371) -- 0:00:07
877500 -- (-1007.537) (-1010.170) (-1008.584) [-1009.015] * (-1010.853) (-1007.604) (-1007.410) [-1007.049] -- 0:00:07
878000 -- (-1006.810) (-1011.849) (-1008.396) [-1008.506] * [-1008.814] (-1011.341) (-1007.701) (-1008.554) -- 0:00:07
878500 -- [-1008.007] (-1010.584) (-1009.527) (-1007.142) * (-1006.939) (-1008.145) (-1009.451) [-1008.709] -- 0:00:07
879000 -- (-1011.888) (-1008.525) [-1010.091] (-1009.985) * [-1008.849] (-1012.080) (-1011.203) (-1009.221) -- 0:00:07
879500 -- (-1008.321) (-1007.209) [-1008.019] (-1009.093) * [-1007.263] (-1008.522) (-1016.646) (-1008.803) -- 0:00:07
880000 -- (-1012.763) [-1011.712] (-1011.042) (-1011.666) * [-1007.787] (-1008.833) (-1012.363) (-1010.204) -- 0:00:07
Average standard deviation of split frequencies: 0.009457
880500 -- (-1015.146) [-1011.854] (-1010.648) (-1009.015) * (-1008.641) (-1008.177) (-1007.269) [-1008.279] -- 0:00:07
881000 -- (-1009.407) (-1006.559) (-1009.245) [-1008.799] * (-1009.485) [-1008.418] (-1007.598) (-1007.141) -- 0:00:07
881500 -- (-1010.671) [-1008.614] (-1010.397) (-1010.431) * (-1009.238) (-1011.317) [-1007.558] (-1010.390) -- 0:00:07
882000 -- (-1011.150) (-1009.327) (-1013.614) [-1008.179] * (-1010.582) (-1011.769) (-1011.473) [-1009.997] -- 0:00:07
882500 -- [-1007.013] (-1007.647) (-1010.353) (-1008.388) * (-1010.128) (-1011.457) [-1009.101] (-1012.941) -- 0:00:07
883000 -- (-1009.474) (-1009.800) (-1009.644) [-1009.159] * [-1009.622] (-1008.668) (-1011.897) (-1013.311) -- 0:00:07
883500 -- (-1008.798) (-1009.040) [-1008.897] (-1012.595) * (-1010.616) (-1009.233) (-1010.356) [-1007.221] -- 0:00:07
884000 -- [-1007.286] (-1007.391) (-1011.548) (-1011.312) * (-1012.265) (-1007.778) (-1008.952) [-1006.940] -- 0:00:07
884500 -- (-1012.364) [-1007.116] (-1008.270) (-1009.078) * (-1016.218) [-1010.990] (-1007.548) (-1009.149) -- 0:00:07
885000 -- (-1018.958) (-1007.438) [-1007.776] (-1011.243) * (-1007.570) (-1007.637) [-1007.691] (-1007.912) -- 0:00:07
Average standard deviation of split frequencies: 0.009683
885500 -- (-1018.004) (-1007.027) (-1008.226) [-1008.067] * (-1011.030) (-1007.091) [-1009.832] (-1009.342) -- 0:00:07
886000 -- [-1010.076] (-1011.799) (-1012.570) (-1008.580) * [-1013.605] (-1007.990) (-1007.111) (-1011.148) -- 0:00:07
886500 -- [-1008.220] (-1007.797) (-1010.158) (-1010.293) * (-1009.382) (-1008.348) (-1008.985) [-1010.579] -- 0:00:07
887000 -- (-1011.489) [-1009.387] (-1009.673) (-1008.739) * [-1007.060] (-1008.199) (-1009.018) (-1012.255) -- 0:00:07
887500 -- (-1007.702) (-1011.379) [-1009.522] (-1013.335) * [-1010.026] (-1008.757) (-1008.134) (-1010.112) -- 0:00:06
888000 -- (-1010.248) [-1008.902] (-1007.627) (-1020.117) * (-1007.279) (-1010.319) [-1008.039] (-1013.664) -- 0:00:06
888500 -- (-1008.650) (-1008.268) (-1008.079) [-1008.867] * (-1009.021) (-1010.844) [-1007.004] (-1007.997) -- 0:00:06
889000 -- (-1010.271) [-1009.320] (-1009.444) (-1009.849) * [-1009.900] (-1008.523) (-1011.475) (-1010.996) -- 0:00:06
889500 -- (-1010.948) (-1007.075) (-1006.935) [-1007.253] * (-1009.228) [-1007.619] (-1008.347) (-1009.294) -- 0:00:06
890000 -- (-1008.315) (-1007.055) [-1009.560] (-1007.374) * (-1008.810) (-1009.554) (-1007.587) [-1007.290] -- 0:00:06
Average standard deviation of split frequencies: 0.009668
890500 -- (-1007.118) (-1007.907) [-1010.384] (-1006.668) * (-1007.688) (-1010.929) (-1010.458) [-1007.038] -- 0:00:06
891000 -- [-1007.057] (-1008.226) (-1012.936) (-1009.230) * (-1007.601) (-1007.463) (-1010.007) [-1008.842] -- 0:00:06
891500 -- (-1008.066) (-1012.516) [-1007.092] (-1012.695) * (-1012.341) (-1008.676) [-1008.157] (-1008.174) -- 0:00:06
892000 -- (-1009.083) (-1009.620) [-1007.136] (-1013.765) * [-1008.117] (-1008.450) (-1010.261) (-1011.848) -- 0:00:06
892500 -- (-1007.511) (-1008.607) [-1010.177] (-1007.886) * (-1010.103) [-1008.378] (-1013.006) (-1007.985) -- 0:00:06
893000 -- (-1007.996) [-1008.786] (-1008.315) (-1008.992) * (-1009.697) (-1011.751) [-1010.487] (-1009.559) -- 0:00:06
893500 -- (-1006.703) [-1008.668] (-1009.250) (-1008.206) * (-1008.570) [-1008.095] (-1007.428) (-1009.853) -- 0:00:06
894000 -- (-1007.569) (-1009.627) (-1015.797) [-1006.475] * [-1007.277] (-1006.921) (-1008.754) (-1008.385) -- 0:00:06
894500 -- (-1010.659) (-1009.405) (-1012.547) [-1008.881] * (-1010.763) (-1008.524) [-1008.557] (-1011.945) -- 0:00:06
895000 -- [-1009.988] (-1008.644) (-1007.681) (-1009.158) * [-1009.183] (-1008.932) (-1008.775) (-1008.947) -- 0:00:06
Average standard deviation of split frequencies: 0.009435
895500 -- [-1009.065] (-1009.377) (-1010.594) (-1008.979) * [-1008.387] (-1007.646) (-1007.314) (-1010.123) -- 0:00:06
896000 -- [-1009.189] (-1009.256) (-1008.281) (-1008.444) * (-1013.118) (-1010.170) [-1009.916] (-1014.344) -- 0:00:06
896500 -- (-1006.817) (-1008.913) (-1009.051) [-1008.686] * (-1010.137) (-1011.015) [-1007.025] (-1009.040) -- 0:00:06
897000 -- (-1009.153) (-1008.546) (-1010.314) [-1007.509] * (-1009.708) (-1012.249) [-1008.717] (-1011.164) -- 0:00:06
897500 -- (-1011.659) (-1009.607) [-1010.433] (-1007.969) * [-1007.008] (-1009.266) (-1009.048) (-1009.198) -- 0:00:06
898000 -- (-1008.832) (-1010.918) [-1009.517] (-1011.245) * (-1009.323) (-1009.893) (-1007.999) [-1007.421] -- 0:00:06
898500 -- [-1009.037] (-1008.090) (-1011.457) (-1013.655) * (-1010.327) (-1010.027) (-1008.953) [-1007.601] -- 0:00:06
899000 -- [-1010.490] (-1007.981) (-1007.680) (-1009.405) * (-1012.458) (-1007.778) (-1008.552) [-1007.138] -- 0:00:06
899500 -- (-1010.046) [-1008.454] (-1007.649) (-1009.467) * [-1008.615] (-1009.012) (-1007.371) (-1007.321) -- 0:00:06
900000 -- (-1011.170) [-1011.654] (-1007.987) (-1008.041) * (-1009.087) (-1007.270) [-1011.813] (-1007.796) -- 0:00:06
Average standard deviation of split frequencies: 0.009247
900500 -- (-1007.250) (-1007.269) [-1009.413] (-1007.907) * (-1011.885) (-1007.210) [-1010.914] (-1007.023) -- 0:00:06
901000 -- [-1006.953] (-1008.336) (-1009.261) (-1008.550) * (-1012.201) (-1008.805) [-1010.862] (-1008.847) -- 0:00:06
901500 -- (-1008.822) (-1007.738) (-1009.987) [-1009.432] * [-1006.971] (-1011.343) (-1010.491) (-1010.014) -- 0:00:06
902000 -- (-1009.265) (-1006.978) [-1008.660] (-1010.171) * [-1010.040] (-1010.538) (-1011.132) (-1008.816) -- 0:00:06
902500 -- (-1009.992) [-1006.763] (-1007.787) (-1010.508) * [-1009.609] (-1008.532) (-1009.738) (-1007.556) -- 0:00:06
903000 -- (-1007.599) (-1007.926) [-1008.482] (-1007.513) * (-1011.421) (-1009.526) (-1008.081) [-1007.438] -- 0:00:06
903500 -- (-1008.085) (-1007.131) (-1007.222) [-1009.285] * (-1011.273) (-1008.053) (-1007.663) [-1009.760] -- 0:00:05
904000 -- (-1007.601) (-1007.212) (-1007.368) [-1008.338] * (-1007.754) [-1008.864] (-1008.473) (-1008.106) -- 0:00:05
904500 -- (-1008.057) [-1007.481] (-1007.920) (-1009.045) * (-1010.787) (-1007.858) (-1007.880) [-1008.004] -- 0:00:05
905000 -- (-1007.379) (-1007.137) [-1007.856] (-1008.010) * (-1011.978) (-1009.646) [-1010.181] (-1009.708) -- 0:00:05
Average standard deviation of split frequencies: 0.009262
905500 -- (-1006.792) (-1010.167) (-1009.920) [-1008.123] * (-1008.494) (-1008.534) (-1010.446) [-1016.927] -- 0:00:05
906000 -- (-1006.947) [-1011.023] (-1007.372) (-1012.085) * (-1007.967) (-1008.345) [-1007.962] (-1013.383) -- 0:00:05
906500 -- (-1012.700) (-1010.663) (-1006.983) [-1009.901] * (-1007.949) (-1011.515) [-1010.913] (-1010.347) -- 0:00:05
907000 -- [-1009.057] (-1010.150) (-1007.256) (-1007.994) * (-1007.454) (-1006.800) (-1007.246) [-1007.283] -- 0:00:05
907500 -- (-1012.081) (-1008.797) (-1010.205) [-1010.814] * (-1007.729) [-1008.390] (-1007.154) (-1008.996) -- 0:00:05
908000 -- (-1009.522) (-1008.381) (-1014.819) [-1008.909] * (-1007.360) (-1009.451) (-1009.002) [-1009.526] -- 0:00:05
908500 -- (-1006.980) (-1007.927) (-1006.966) [-1007.889] * (-1007.319) [-1007.469] (-1009.025) (-1009.575) -- 0:00:05
909000 -- (-1015.892) (-1016.749) [-1008.197] (-1009.485) * (-1007.434) [-1011.518] (-1015.030) (-1008.565) -- 0:00:05
909500 -- (-1009.297) (-1008.439) (-1007.947) [-1007.974] * [-1009.801] (-1007.045) (-1010.084) (-1007.359) -- 0:00:05
910000 -- (-1007.604) (-1010.533) (-1007.612) [-1010.021] * (-1008.075) (-1006.818) [-1006.935] (-1007.424) -- 0:00:05
Average standard deviation of split frequencies: 0.009559
910500 -- (-1007.333) (-1007.700) [-1008.583] (-1009.162) * (-1009.160) [-1007.050] (-1008.555) (-1010.885) -- 0:00:05
911000 -- (-1007.191) (-1009.666) [-1012.466] (-1008.402) * (-1013.346) [-1006.695] (-1007.892) (-1010.835) -- 0:00:05
911500 -- (-1011.462) [-1009.524] (-1008.692) (-1008.469) * (-1012.129) (-1010.988) [-1007.177] (-1008.443) -- 0:00:05
912000 -- (-1008.277) [-1011.111] (-1008.430) (-1008.025) * (-1011.015) (-1010.349) (-1007.591) [-1008.011] -- 0:00:05
912500 -- (-1010.177) [-1010.689] (-1011.841) (-1012.646) * (-1013.602) (-1007.211) (-1007.303) [-1008.503] -- 0:00:05
913000 -- [-1009.585] (-1007.379) (-1010.100) (-1009.832) * [-1012.842] (-1007.937) (-1012.935) (-1009.253) -- 0:00:05
913500 -- [-1008.953] (-1008.183) (-1008.246) (-1011.229) * (-1014.093) [-1006.995] (-1009.276) (-1007.621) -- 0:00:05
914000 -- (-1007.462) [-1010.137] (-1011.853) (-1009.217) * (-1008.158) [-1008.243] (-1007.402) (-1008.297) -- 0:00:05
914500 -- [-1007.575] (-1009.740) (-1007.432) (-1010.910) * [-1007.801] (-1007.813) (-1007.531) (-1007.261) -- 0:00:05
915000 -- (-1007.509) [-1007.946] (-1012.310) (-1008.315) * (-1011.689) (-1011.924) [-1009.808] (-1007.584) -- 0:00:05
Average standard deviation of split frequencies: 0.009847
915500 -- [-1007.578] (-1008.787) (-1007.791) (-1009.999) * [-1009.480] (-1008.980) (-1008.819) (-1012.991) -- 0:00:05
916000 -- [-1008.219] (-1009.453) (-1009.207) (-1007.482) * (-1007.615) [-1009.140] (-1013.636) (-1008.362) -- 0:00:05
916500 -- (-1008.515) [-1010.461] (-1012.055) (-1007.604) * [-1007.525] (-1008.350) (-1009.281) (-1008.945) -- 0:00:05
917000 -- (-1009.530) (-1010.692) [-1009.956] (-1008.795) * [-1010.987] (-1008.772) (-1007.842) (-1011.487) -- 0:00:05
917500 -- (-1008.307) [-1007.257] (-1010.212) (-1012.404) * (-1010.575) (-1010.825) (-1012.983) [-1012.872] -- 0:00:05
918000 -- (-1007.298) [-1010.419] (-1009.769) (-1016.293) * (-1009.604) (-1006.944) (-1011.389) [-1008.344] -- 0:00:05
918500 -- [-1009.996] (-1008.547) (-1009.332) (-1015.017) * (-1009.042) (-1007.078) (-1008.143) [-1008.056] -- 0:00:05
919000 -- (-1013.264) (-1009.807) [-1008.045] (-1014.599) * (-1008.781) (-1007.578) (-1008.931) [-1008.603] -- 0:00:05
919500 -- [-1007.642] (-1009.394) (-1008.160) (-1010.974) * [-1015.649] (-1010.478) (-1007.416) (-1010.456) -- 0:00:04
920000 -- [-1008.831] (-1007.817) (-1009.201) (-1008.564) * (-1008.422) (-1006.816) (-1009.755) [-1008.402] -- 0:00:04
Average standard deviation of split frequencies: 0.009490
920500 -- (-1008.136) (-1008.728) (-1008.344) [-1009.885] * (-1009.528) (-1008.418) (-1008.218) [-1009.046] -- 0:00:04
921000 -- (-1011.847) (-1011.989) [-1008.696] (-1013.089) * (-1008.372) [-1010.471] (-1007.341) (-1010.130) -- 0:00:04
921500 -- (-1010.108) (-1009.843) [-1006.879] (-1009.557) * (-1008.986) (-1009.652) (-1007.981) [-1010.451] -- 0:00:04
922000 -- [-1008.914] (-1009.114) (-1012.458) (-1015.145) * (-1007.037) (-1010.270) (-1008.336) [-1007.051] -- 0:00:04
922500 -- (-1007.846) [-1008.366] (-1009.374) (-1009.606) * [-1008.388] (-1009.074) (-1008.748) (-1010.013) -- 0:00:04
923000 -- [-1007.794] (-1007.412) (-1009.824) (-1013.513) * [-1007.043] (-1011.198) (-1007.258) (-1011.456) -- 0:00:04
923500 -- (-1008.753) (-1008.439) (-1011.643) [-1007.802] * [-1007.881] (-1010.846) (-1006.835) (-1013.400) -- 0:00:04
924000 -- (-1006.821) (-1012.489) [-1008.336] (-1009.630) * (-1010.927) (-1012.880) [-1008.657] (-1010.577) -- 0:00:04
924500 -- [-1007.008] (-1013.387) (-1008.518) (-1009.893) * (-1010.749) [-1007.004] (-1018.464) (-1010.101) -- 0:00:04
925000 -- (-1010.228) [-1008.405] (-1007.812) (-1009.478) * (-1007.801) (-1008.011) [-1008.130] (-1010.315) -- 0:00:04
Average standard deviation of split frequencies: 0.009163
925500 -- (-1008.465) [-1007.917] (-1007.952) (-1008.968) * (-1008.323) (-1008.080) (-1008.617) [-1007.135] -- 0:00:04
926000 -- (-1009.501) (-1009.317) [-1011.445] (-1009.074) * (-1008.510) [-1008.266] (-1007.954) (-1011.459) -- 0:00:04
926500 -- (-1009.295) [-1011.761] (-1008.159) (-1008.730) * (-1008.878) [-1009.034] (-1010.369) (-1008.399) -- 0:00:04
927000 -- (-1009.363) (-1008.771) [-1008.150] (-1008.937) * [-1009.164] (-1010.005) (-1009.355) (-1007.138) -- 0:00:04
927500 -- (-1008.188) (-1008.855) [-1009.069] (-1008.945) * (-1007.330) [-1011.492] (-1007.224) (-1007.738) -- 0:00:04
928000 -- (-1008.500) (-1008.017) [-1010.150] (-1015.257) * (-1008.550) (-1010.754) [-1009.492] (-1007.754) -- 0:00:04
928500 -- (-1008.047) (-1009.538) [-1008.017] (-1015.531) * [-1009.362] (-1011.399) (-1009.537) (-1007.508) -- 0:00:04
929000 -- (-1007.226) (-1008.687) [-1007.564] (-1008.690) * (-1009.566) (-1007.836) [-1010.004] (-1007.856) -- 0:00:04
929500 -- (-1007.590) [-1008.578] (-1010.235) (-1010.601) * (-1007.944) (-1010.600) [-1008.223] (-1008.594) -- 0:00:04
930000 -- (-1013.309) [-1008.839] (-1009.063) (-1008.350) * (-1009.176) (-1010.038) [-1008.812] (-1008.953) -- 0:00:04
Average standard deviation of split frequencies: 0.009421
930500 -- (-1008.276) (-1009.421) (-1009.165) [-1008.623] * (-1010.046) (-1007.327) [-1008.163] (-1007.818) -- 0:00:04
931000 -- [-1007.183] (-1007.600) (-1009.184) (-1008.987) * (-1008.389) (-1009.271) (-1008.081) [-1007.625] -- 0:00:04
931500 -- (-1011.962) [-1009.248] (-1008.535) (-1008.239) * (-1007.276) (-1009.663) [-1006.533] (-1011.551) -- 0:00:04
932000 -- (-1009.020) [-1009.076] (-1011.585) (-1009.175) * (-1010.277) [-1008.968] (-1012.523) (-1010.737) -- 0:00:04
932500 -- (-1011.492) [-1007.935] (-1008.285) (-1008.266) * (-1010.695) (-1010.079) [-1008.101] (-1008.070) -- 0:00:04
933000 -- (-1008.356) [-1007.189] (-1008.011) (-1008.834) * (-1007.393) (-1010.463) [-1007.534] (-1008.057) -- 0:00:04
933500 -- (-1008.725) [-1008.439] (-1011.023) (-1008.249) * [-1008.428] (-1007.773) (-1008.657) (-1013.741) -- 0:00:04
934000 -- (-1008.690) (-1010.316) [-1008.584] (-1007.773) * [-1011.714] (-1011.141) (-1007.924) (-1009.596) -- 0:00:04
934500 -- (-1014.080) (-1008.110) (-1006.766) [-1007.992] * (-1011.471) (-1009.074) (-1009.366) [-1008.532] -- 0:00:04
935000 -- (-1010.802) [-1006.819] (-1012.728) (-1007.911) * (-1009.215) (-1007.713) (-1012.168) [-1010.101] -- 0:00:04
Average standard deviation of split frequencies: 0.009233
935500 -- (-1009.605) [-1006.676] (-1011.041) (-1010.461) * (-1011.063) [-1008.265] (-1012.251) (-1009.523) -- 0:00:03
936000 -- (-1007.482) (-1011.316) [-1009.705] (-1008.068) * [-1007.649] (-1010.370) (-1007.915) (-1008.641) -- 0:00:03
936500 -- (-1007.673) [-1013.604] (-1009.626) (-1009.201) * (-1010.686) (-1007.562) [-1007.030] (-1010.237) -- 0:00:03
937000 -- [-1008.398] (-1008.446) (-1008.451) (-1007.340) * (-1012.855) (-1011.721) (-1008.555) [-1009.269] -- 0:00:03
937500 -- (-1007.063) (-1008.214) [-1007.807] (-1008.654) * [-1008.204] (-1009.132) (-1007.805) (-1009.810) -- 0:00:03
938000 -- (-1008.521) (-1007.948) [-1008.391] (-1008.714) * (-1007.724) [-1009.031] (-1009.772) (-1008.115) -- 0:00:03
938500 -- [-1008.870] (-1007.664) (-1008.749) (-1007.625) * (-1007.922) [-1009.041] (-1011.815) (-1008.250) -- 0:00:03
939000 -- (-1007.887) (-1007.562) (-1006.961) [-1009.434] * [-1008.735] (-1007.274) (-1007.785) (-1006.606) -- 0:00:03
939500 -- (-1011.132) [-1007.521] (-1010.882) (-1008.156) * (-1010.104) (-1007.543) (-1006.882) [-1007.806] -- 0:00:03
940000 -- (-1007.573) (-1011.212) [-1011.481] (-1008.350) * (-1011.114) (-1007.480) (-1010.470) [-1008.389] -- 0:00:03
Average standard deviation of split frequencies: 0.009321
940500 -- (-1008.210) (-1007.585) (-1009.579) [-1007.357] * (-1011.937) [-1007.141] (-1011.960) (-1007.654) -- 0:00:03
941000 -- (-1009.876) [-1007.428] (-1009.146) (-1009.585) * (-1007.687) [-1006.522] (-1008.466) (-1007.883) -- 0:00:03
941500 -- [-1008.480] (-1010.234) (-1009.205) (-1008.124) * (-1009.340) [-1007.017] (-1007.407) (-1007.805) -- 0:00:03
942000 -- (-1008.801) (-1011.910) (-1010.517) [-1008.258] * (-1010.234) (-1009.949) [-1008.357] (-1007.968) -- 0:00:03
942500 -- (-1009.807) [-1009.780] (-1011.462) (-1007.883) * (-1015.689) (-1008.037) (-1011.645) [-1011.389] -- 0:00:03
943000 -- [-1008.078] (-1007.626) (-1010.989) (-1008.103) * [-1008.684] (-1009.082) (-1010.014) (-1008.736) -- 0:00:03
943500 -- (-1008.930) [-1008.447] (-1012.939) (-1007.492) * [-1008.300] (-1008.750) (-1009.356) (-1007.773) -- 0:00:03
944000 -- (-1007.025) (-1008.824) (-1007.335) [-1008.203] * [-1009.219] (-1008.337) (-1013.009) (-1010.778) -- 0:00:03
944500 -- (-1009.995) [-1009.864] (-1007.307) (-1010.422) * (-1010.083) [-1010.491] (-1007.350) (-1011.456) -- 0:00:03
945000 -- [-1009.124] (-1009.006) (-1008.138) (-1009.576) * [-1007.294] (-1008.330) (-1007.338) (-1011.113) -- 0:00:03
Average standard deviation of split frequencies: 0.009103
945500 -- [-1008.013] (-1008.040) (-1009.766) (-1007.654) * [-1008.109] (-1009.310) (-1008.199) (-1008.079) -- 0:00:03
946000 -- (-1007.792) [-1008.563] (-1008.698) (-1008.284) * (-1010.509) (-1011.362) [-1008.813] (-1009.719) -- 0:00:03
946500 -- (-1007.512) [-1007.738] (-1009.893) (-1008.053) * (-1012.418) (-1008.137) [-1010.401] (-1008.453) -- 0:00:03
947000 -- (-1012.738) (-1009.792) (-1012.632) [-1008.513] * (-1009.247) [-1008.803] (-1007.440) (-1008.926) -- 0:00:03
947500 -- (-1010.127) (-1008.340) (-1008.583) [-1008.054] * (-1009.206) (-1008.679) (-1008.608) [-1008.061] -- 0:00:03
948000 -- (-1007.424) (-1011.354) [-1012.498] (-1008.571) * (-1008.203) (-1011.691) [-1008.167] (-1007.631) -- 0:00:03
948500 -- (-1010.794) (-1006.731) [-1010.337] (-1010.962) * (-1008.028) (-1009.519) [-1008.443] (-1008.343) -- 0:00:03
949000 -- (-1010.833) [-1007.307] (-1007.887) (-1009.237) * (-1008.971) (-1011.107) [-1007.782] (-1006.622) -- 0:00:03
949500 -- (-1009.276) (-1011.525) [-1009.359] (-1011.747) * (-1011.058) (-1008.659) (-1007.012) [-1007.444] -- 0:00:03
950000 -- [-1008.216] (-1009.444) (-1013.434) (-1010.060) * (-1008.171) [-1008.612] (-1007.001) (-1007.262) -- 0:00:03
Average standard deviation of split frequencies: 0.008992
950500 -- (-1008.014) (-1010.746) (-1009.659) [-1009.045] * (-1011.594) (-1011.490) [-1007.082] (-1011.400) -- 0:00:03
951000 -- (-1009.024) [-1009.199] (-1009.256) (-1016.942) * (-1010.167) (-1011.536) (-1009.739) [-1009.691] -- 0:00:03
951500 -- (-1009.428) (-1008.826) [-1008.876] (-1010.860) * [-1009.659] (-1008.665) (-1010.160) (-1008.093) -- 0:00:03
952000 -- (-1011.520) (-1011.421) [-1010.581] (-1007.949) * [-1009.764] (-1010.401) (-1008.118) (-1010.429) -- 0:00:02
952500 -- (-1011.228) (-1009.345) [-1010.249] (-1007.912) * [-1007.632] (-1008.562) (-1009.007) (-1007.740) -- 0:00:02
953000 -- [-1011.342] (-1008.005) (-1008.170) (-1012.661) * (-1008.401) (-1007.958) (-1009.532) [-1007.689] -- 0:00:02
953500 -- (-1010.201) (-1007.105) (-1008.816) [-1007.456] * [-1011.746] (-1012.106) (-1010.358) (-1008.557) -- 0:00:02
954000 -- (-1010.820) (-1008.205) (-1008.027) [-1008.932] * (-1011.800) (-1012.459) (-1011.170) [-1008.074] -- 0:00:02
954500 -- (-1009.762) (-1008.696) [-1008.470] (-1007.271) * [-1008.833] (-1007.952) (-1009.731) (-1008.177) -- 0:00:02
955000 -- (-1009.864) [-1009.709] (-1010.534) (-1007.229) * [-1009.885] (-1011.262) (-1009.006) (-1011.248) -- 0:00:02
Average standard deviation of split frequencies: 0.008974
955500 -- (-1007.705) [-1007.630] (-1011.317) (-1012.317) * (-1009.657) (-1010.037) (-1007.808) [-1008.731] -- 0:00:02
956000 -- (-1008.931) (-1008.420) (-1009.418) [-1008.862] * [-1010.195] (-1009.833) (-1013.053) (-1007.963) -- 0:00:02
956500 -- [-1011.504] (-1008.056) (-1008.449) (-1009.506) * (-1011.160) [-1008.943] (-1012.606) (-1006.887) -- 0:00:02
957000 -- (-1007.758) [-1006.657] (-1006.998) (-1009.389) * [-1007.860] (-1007.925) (-1011.320) (-1007.218) -- 0:00:02
957500 -- [-1008.286] (-1007.500) (-1007.797) (-1013.116) * [-1010.876] (-1008.080) (-1012.574) (-1007.216) -- 0:00:02
958000 -- [-1007.609] (-1009.705) (-1009.785) (-1009.140) * (-1008.463) (-1007.452) [-1007.230] (-1009.503) -- 0:00:02
958500 -- [-1007.609] (-1010.266) (-1007.941) (-1007.304) * (-1007.595) (-1011.576) (-1008.297) [-1011.063] -- 0:00:02
959000 -- [-1011.096] (-1007.970) (-1006.953) (-1008.369) * (-1007.606) [-1010.990] (-1007.835) (-1010.716) -- 0:00:02
959500 -- (-1009.251) (-1008.238) (-1007.239) [-1013.739] * (-1009.362) (-1008.825) [-1007.627] (-1009.575) -- 0:00:02
960000 -- (-1008.548) [-1009.359] (-1006.814) (-1008.103) * (-1009.939) (-1011.772) (-1012.815) [-1008.172] -- 0:00:02
Average standard deviation of split frequencies: 0.008767
960500 -- [-1007.040] (-1009.714) (-1009.872) (-1009.567) * (-1008.124) (-1007.968) [-1007.871] (-1007.729) -- 0:00:02
961000 -- (-1007.996) (-1007.799) (-1013.689) [-1008.977] * [-1008.280] (-1007.263) (-1011.853) (-1009.709) -- 0:00:02
961500 -- (-1010.453) (-1008.191) [-1008.654] (-1009.609) * (-1011.270) (-1007.263) (-1014.146) [-1007.217] -- 0:00:02
962000 -- [-1008.656] (-1007.910) (-1010.386) (-1007.471) * (-1011.863) (-1008.672) (-1009.335) [-1007.106] -- 0:00:02
962500 -- [-1009.609] (-1008.716) (-1012.602) (-1006.802) * (-1014.341) [-1008.700] (-1009.701) (-1008.022) -- 0:00:02
963000 -- (-1007.252) [-1009.797] (-1011.739) (-1008.090) * [-1008.694] (-1008.872) (-1007.890) (-1008.220) -- 0:00:02
963500 -- [-1008.980] (-1009.305) (-1008.908) (-1007.410) * (-1009.229) [-1010.331] (-1008.659) (-1009.342) -- 0:00:02
964000 -- (-1008.985) (-1008.275) [-1009.214] (-1007.124) * [-1009.902] (-1007.322) (-1009.697) (-1008.915) -- 0:00:02
964500 -- (-1007.223) [-1007.057] (-1010.152) (-1007.342) * [-1008.383] (-1007.550) (-1009.273) (-1008.414) -- 0:00:02
965000 -- (-1014.923) (-1014.454) [-1008.083] (-1007.214) * (-1008.403) [-1007.191] (-1007.695) (-1007.304) -- 0:00:02
Average standard deviation of split frequencies: 0.008589
965500 -- [-1010.768] (-1007.325) (-1009.310) (-1009.959) * (-1008.034) (-1007.649) (-1009.304) [-1007.623] -- 0:00:02
966000 -- (-1008.638) (-1007.127) (-1012.058) [-1012.434] * (-1009.096) (-1008.313) (-1008.765) [-1008.649] -- 0:00:02
966500 -- (-1011.936) [-1007.074] (-1007.236) (-1015.908) * [-1008.486] (-1010.385) (-1008.639) (-1008.651) -- 0:00:02
967000 -- (-1008.392) [-1007.863] (-1007.623) (-1009.333) * [-1009.925] (-1009.629) (-1008.065) (-1010.973) -- 0:00:02
967500 -- (-1012.421) [-1006.773] (-1008.233) (-1009.267) * [-1008.150] (-1008.234) (-1007.365) (-1011.683) -- 0:00:02
968000 -- (-1011.814) [-1007.113] (-1008.808) (-1010.378) * [-1009.554] (-1007.760) (-1013.284) (-1008.482) -- 0:00:01
968500 -- (-1012.256) (-1008.352) [-1006.812] (-1007.778) * (-1006.820) (-1009.076) (-1010.059) [-1008.326] -- 0:00:01
969000 -- (-1007.765) (-1009.876) (-1011.844) [-1008.038] * [-1008.258] (-1009.851) (-1011.121) (-1008.034) -- 0:00:01
969500 -- (-1010.390) (-1010.903) (-1010.642) [-1008.571] * (-1007.963) (-1010.299) (-1013.790) [-1010.752] -- 0:00:01
970000 -- [-1012.835] (-1011.847) (-1009.408) (-1011.537) * [-1007.088] (-1008.934) (-1011.619) (-1007.673) -- 0:00:01
Average standard deviation of split frequencies: 0.008677
970500 -- (-1007.143) (-1007.727) [-1007.293] (-1009.989) * (-1007.606) (-1010.150) (-1007.765) [-1007.600] -- 0:00:01
971000 -- (-1008.896) (-1008.116) [-1007.087] (-1011.713) * [-1008.335] (-1010.088) (-1016.543) (-1011.972) -- 0:00:01
971500 -- [-1009.034] (-1010.852) (-1009.756) (-1007.763) * [-1009.496] (-1013.250) (-1013.065) (-1012.099) -- 0:00:01
972000 -- (-1007.117) (-1010.394) (-1012.004) [-1014.262] * (-1009.829) [-1009.534] (-1011.119) (-1008.653) -- 0:00:01
972500 -- [-1012.264] (-1009.826) (-1010.039) (-1010.043) * (-1009.621) (-1008.883) [-1010.836] (-1007.409) -- 0:00:01
973000 -- [-1008.056] (-1008.481) (-1010.883) (-1007.335) * (-1009.794) [-1010.159] (-1007.397) (-1007.901) -- 0:00:01
973500 -- (-1008.599) [-1007.067] (-1009.155) (-1008.608) * (-1010.475) (-1015.472) (-1008.113) [-1010.336] -- 0:00:01
974000 -- (-1009.522) (-1010.407) (-1011.049) [-1012.598] * (-1009.245) [-1010.008] (-1012.893) (-1007.376) -- 0:00:01
974500 -- (-1007.487) (-1007.931) (-1012.685) [-1011.208] * (-1008.489) (-1009.391) (-1009.712) [-1009.067] -- 0:00:01
975000 -- (-1006.580) [-1007.447] (-1006.899) (-1009.233) * (-1008.281) [-1008.012] (-1013.816) (-1007.887) -- 0:00:01
Average standard deviation of split frequencies: 0.008726
975500 -- (-1008.316) (-1010.268) (-1009.179) [-1010.421] * (-1007.960) [-1009.484] (-1017.445) (-1009.347) -- 0:00:01
976000 -- (-1011.777) (-1016.606) (-1006.988) [-1010.053] * (-1008.265) [-1007.138] (-1017.720) (-1009.073) -- 0:00:01
976500 -- (-1007.277) (-1009.263) [-1008.450] (-1014.570) * (-1007.765) [-1009.295] (-1011.142) (-1008.238) -- 0:00:01
977000 -- [-1007.413] (-1007.898) (-1008.822) (-1009.035) * (-1007.159) [-1007.602] (-1011.723) (-1009.084) -- 0:00:01
977500 -- (-1008.637) (-1008.827) [-1006.854] (-1008.512) * (-1008.528) (-1007.418) [-1008.647] (-1008.160) -- 0:00:01
978000 -- (-1012.289) (-1012.895) [-1007.191] (-1007.730) * (-1006.873) (-1009.134) [-1007.700] (-1007.907) -- 0:00:01
978500 -- (-1007.532) (-1010.276) [-1009.671] (-1008.078) * (-1009.289) [-1008.149] (-1011.846) (-1009.554) -- 0:00:01
979000 -- [-1010.909] (-1007.732) (-1009.543) (-1010.278) * (-1010.966) (-1009.030) (-1007.638) [-1008.895] -- 0:00:01
979500 -- (-1008.844) (-1009.596) (-1008.346) [-1006.533] * [-1008.764] (-1009.514) (-1007.485) (-1008.913) -- 0:00:01
980000 -- (-1014.612) [-1007.513] (-1010.754) (-1010.695) * (-1009.151) [-1010.099] (-1009.299) (-1009.231) -- 0:00:01
Average standard deviation of split frequencies: 0.008588
980500 -- (-1009.247) [-1007.229] (-1007.875) (-1007.510) * (-1006.682) [-1009.330] (-1010.414) (-1009.262) -- 0:00:01
981000 -- (-1010.337) [-1007.250] (-1007.493) (-1014.853) * (-1007.310) (-1007.675) (-1007.391) [-1008.469] -- 0:00:01
981500 -- (-1012.573) (-1008.301) [-1009.746] (-1010.859) * [-1009.731] (-1008.049) (-1012.581) (-1009.030) -- 0:00:01
982000 -- (-1012.242) (-1009.256) [-1012.485] (-1009.531) * (-1010.468) (-1007.709) (-1014.481) [-1007.339] -- 0:00:01
982500 -- [-1007.170] (-1008.808) (-1012.490) (-1015.463) * (-1011.040) (-1013.853) (-1010.539) [-1007.341] -- 0:00:01
983000 -- [-1007.852] (-1009.029) (-1010.596) (-1008.903) * (-1008.547) (-1012.251) (-1016.661) [-1006.528] -- 0:00:01
983500 -- [-1006.930] (-1007.924) (-1008.768) (-1007.903) * (-1007.595) [-1009.608] (-1015.664) (-1007.888) -- 0:00:01
984000 -- [-1006.869] (-1009.267) (-1007.250) (-1009.666) * (-1009.299) (-1009.546) [-1009.836] (-1008.075) -- 0:00:01
984500 -- (-1008.175) (-1007.928) [-1007.330] (-1008.892) * (-1009.084) (-1010.555) (-1009.960) [-1009.030] -- 0:00:00
985000 -- [-1009.492] (-1008.444) (-1009.460) (-1008.499) * (-1007.913) (-1009.273) (-1007.948) [-1008.355] -- 0:00:00
Average standard deviation of split frequencies: 0.008829
985500 -- (-1009.311) [-1008.415] (-1007.604) (-1010.283) * (-1009.232) [-1007.154] (-1007.952) (-1008.314) -- 0:00:00
986000 -- (-1009.843) [-1008.444] (-1010.265) (-1007.733) * (-1009.196) (-1007.424) [-1008.214] (-1008.272) -- 0:00:00
986500 -- (-1011.950) (-1009.797) (-1011.616) [-1008.077] * (-1008.215) (-1010.167) [-1007.122] (-1007.472) -- 0:00:00
987000 -- (-1008.575) (-1008.940) (-1011.759) [-1007.443] * (-1007.796) (-1009.376) [-1008.809] (-1008.182) -- 0:00:00
987500 -- [-1009.765] (-1008.980) (-1007.096) (-1006.929) * (-1009.675) [-1007.118] (-1011.126) (-1008.618) -- 0:00:00
988000 -- (-1009.683) (-1012.022) (-1007.097) [-1007.139] * [-1007.535] (-1008.405) (-1008.851) (-1010.750) -- 0:00:00
988500 -- [-1006.577] (-1008.482) (-1009.436) (-1010.695) * [-1007.669] (-1010.459) (-1008.646) (-1010.286) -- 0:00:00
989000 -- (-1008.515) (-1008.679) [-1008.187] (-1010.390) * [-1008.892] (-1008.094) (-1008.589) (-1009.564) -- 0:00:00
989500 -- (-1007.296) (-1008.206) (-1007.552) [-1012.756] * [-1008.519] (-1009.755) (-1009.168) (-1010.878) -- 0:00:00
990000 -- (-1007.749) (-1010.328) (-1009.901) [-1007.146] * [-1009.623] (-1009.912) (-1006.935) (-1013.196) -- 0:00:00
Average standard deviation of split frequencies: 0.009073
990500 -- (-1009.029) (-1012.542) [-1007.068] (-1007.653) * [-1007.630] (-1009.039) (-1007.696) (-1011.978) -- 0:00:00
991000 -- [-1007.618] (-1008.973) (-1007.529) (-1008.505) * [-1007.350] (-1011.306) (-1009.809) (-1012.195) -- 0:00:00
991500 -- (-1006.853) (-1007.155) (-1008.854) [-1006.969] * (-1008.749) (-1011.229) (-1009.153) [-1007.783] -- 0:00:00
992000 -- (-1013.662) [-1007.249] (-1012.443) (-1008.097) * (-1008.253) (-1007.965) [-1008.288] (-1011.391) -- 0:00:00
992500 -- [-1011.344] (-1008.407) (-1011.830) (-1006.823) * (-1013.564) (-1007.895) (-1008.131) [-1007.818] -- 0:00:00
993000 -- [-1011.748] (-1011.745) (-1010.049) (-1007.138) * (-1007.864) (-1010.067) [-1007.482] (-1008.061) -- 0:00:00
993500 -- (-1008.547) [-1008.843] (-1009.493) (-1008.959) * (-1010.676) (-1007.205) [-1008.488] (-1007.857) -- 0:00:00
994000 -- (-1008.122) (-1009.845) [-1008.808] (-1015.416) * (-1010.485) [-1009.668] (-1009.464) (-1007.342) -- 0:00:00
994500 -- (-1008.494) (-1009.521) [-1010.586] (-1009.931) * (-1007.173) (-1012.891) [-1010.226] (-1007.944) -- 0:00:00
995000 -- [-1007.286] (-1009.566) (-1007.474) (-1010.126) * [-1007.913] (-1012.134) (-1009.256) (-1008.325) -- 0:00:00
Average standard deviation of split frequencies: 0.008803
995500 -- (-1007.339) [-1011.649] (-1007.556) (-1008.981) * (-1010.288) [-1009.834] (-1008.455) (-1012.449) -- 0:00:00
996000 -- (-1008.869) (-1010.695) [-1007.652] (-1009.027) * (-1013.037) [-1015.068] (-1009.605) (-1008.846) -- 0:00:00
996500 -- (-1007.667) [-1008.960] (-1008.061) (-1009.137) * (-1009.350) [-1007.857] (-1009.044) (-1011.800) -- 0:00:00
997000 -- (-1008.909) (-1007.496) (-1007.980) [-1007.833] * (-1009.723) (-1007.105) (-1007.185) [-1007.774] -- 0:00:00
997500 -- (-1011.679) (-1008.357) [-1010.164] (-1011.152) * (-1009.001) [-1008.432] (-1007.605) (-1007.094) -- 0:00:00
998000 -- (-1011.759) (-1011.766) (-1012.149) [-1009.082] * [-1009.247] (-1007.356) (-1006.885) (-1008.583) -- 0:00:00
998500 -- (-1012.460) (-1006.856) [-1008.581] (-1008.708) * (-1009.561) (-1009.300) (-1006.746) [-1008.338] -- 0:00:00
999000 -- (-1011.708) (-1006.815) [-1009.132] (-1008.877) * (-1013.525) (-1009.753) [-1007.360] (-1009.849) -- 0:00:00
999500 -- (-1013.699) (-1009.268) [-1008.334] (-1007.802) * [-1010.516] (-1008.456) (-1007.256) (-1011.158) -- 0:00:00
1000000 -- (-1011.446) (-1007.582) (-1008.878) [-1010.045] * [-1009.978] (-1008.159) (-1008.059) (-1008.747) -- 0:00:00
Average standard deviation of split frequencies: 0.009359
Analysis completed in 1 mins 3 seconds
Analysis used 61.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1006.44
Likelihood of best state for "cold" chain of run 2 was -1006.44
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 62 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
27.1 % ( 21 %) Dirichlet(Pi{all})
29.4 % ( 24 %) Slider(Pi{all})
78.6 % ( 46 %) Multiplier(Alpha{1,2})
78.2 % ( 59 %) Multiplier(Alpha{3})
20.7 % ( 19 %) Slider(Pinvar{all})
98.7 % ( 96 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.5 % ( 29 %) Dirichlet(Pi{all})
30.1 % ( 22 %) Slider(Pi{all})
78.8 % ( 60 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
20.4 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.7 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166806 0.82 0.67
3 | 166635 166607 0.84
4 | 166470 166610 166872
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166081 0.82 0.67
3 | 166679 166884 0.84
4 | 166432 166679 167245
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1008.21
| 2 1 21 2 1 |
| 1 2 2 |
| 2 111 2 |
| 112 1 1 1 1 22 1 1 |
| 2 1 2 2 1 11 1 1 1 121 2|
| 2 1 22 2 2 2 * 1 2 2 1 121 1 2 1|
|2 2 2 12 2 2 2** |
| 1 1 * 2 1 21 2 1 2 |
| 11 2 11 2 2 12 11 |
| 1 2 1 1 1 * 1 2 1 2 2 |
|12 2 * 2 |
| 2 2 2 1 2 |
| |
| 1 2 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1009.86
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1008.14 -1011.08
2 -1008.15 -1011.64
--------------------------------------
TOTAL -1008.15 -1011.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000
r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003
r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000
r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008
r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000
r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010
r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002
pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001
pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001
pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000
pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000
alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000
alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000
pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ...*.*
9 -- ..*.*.
10 -- .*..*.
11 -- ..*..*
12 -- .*...*
13 -- .**.**
14 -- ....**
15 -- .*.*..
16 -- ...**.
17 -- .***.*
18 -- ..**..
19 -- .*.***
20 -- .**...
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 468 0.155896 0.010364 0.148568 0.163225 2
8 464 0.154564 0.000000 0.154564 0.154564 2
9 462 0.153897 0.014133 0.143904 0.163891 2
10 448 0.149234 0.021670 0.133911 0.164557 2
11 436 0.145237 0.015075 0.134577 0.155896 2
12 432 0.143904 0.015075 0.133245 0.154564 2
13 431 0.143571 0.002355 0.141905 0.145237 2
14 427 0.142239 0.006124 0.137908 0.146569 2
15 423 0.140906 0.004240 0.137908 0.143904 2
16 423 0.140906 0.002355 0.139241 0.142572 2
17 415 0.138241 0.008951 0.131912 0.144570 2
18 413 0.137575 0.010835 0.129913 0.145237 2
19 410 0.136576 0.005653 0.132578 0.140573 2
20 410 0.136576 0.016959 0.124584 0.148568 2
21 386 0.128581 0.006595 0.123917 0.133245 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097549 0.009487 0.000045 0.300630 0.068225 1.000 2
length{all}[2] 0.098930 0.010254 0.000004 0.305026 0.067871 1.000 2
length{all}[3] 0.098104 0.010017 0.000032 0.294744 0.066033 1.000 2
length{all}[4] 0.100910 0.010623 0.000086 0.306993 0.068170 1.000 2
length{all}[5] 0.100304 0.009838 0.000036 0.309264 0.068138 1.000 2
length{all}[6] 0.101686 0.010543 0.000071 0.308534 0.070414 1.000 2
length{all}[7] 0.097394 0.008597 0.000286 0.281807 0.070656 1.002 2
length{all}[8] 0.103212 0.011865 0.000144 0.320664 0.063165 1.000 2
length{all}[9] 0.088549 0.008695 0.000059 0.283778 0.061761 1.003 2
length{all}[10] 0.103926 0.010937 0.000721 0.344535 0.069789 0.998 2
length{all}[11] 0.100597 0.011735 0.000600 0.292328 0.070720 1.005 2
length{all}[12] 0.107074 0.012664 0.000269 0.322183 0.074984 0.998 2
length{all}[13] 0.100873 0.011262 0.000080 0.313296 0.068023 0.999 2
length{all}[14] 0.100156 0.011401 0.000360 0.309129 0.070983 1.001 2
length{all}[15] 0.104215 0.010384 0.001497 0.306389 0.073102 0.998 2
length{all}[16] 0.091368 0.008774 0.000338 0.282669 0.057493 0.998 2
length{all}[17] 0.096033 0.009393 0.000200 0.265243 0.068987 0.999 2
length{all}[18] 0.097267 0.009693 0.000311 0.301371 0.067064 1.005 2
length{all}[19] 0.090093 0.009613 0.000927 0.289612 0.057334 0.998 2
length{all}[20] 0.099672 0.009728 0.000002 0.297403 0.067012 0.998 2
length{all}[21] 0.102579 0.010989 0.000370 0.312010 0.071625 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009359
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 741
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 247 / 247 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 247 / 247 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089666 0.080017 0.101542 0.100546 0.026829 0.068319 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1071.308972
Iterating by ming2
Initial: fx= 1071.308972
x= 0.08967 0.08002 0.10154 0.10055 0.02683 0.06832 0.30000 1.30000
1 h-m-p 0.0000 0.0001 591.3795 ++ 1032.749861 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0045 79.6168 ++ 1030.518502 m 0.0045 24 | 2/8
3 h-m-p 0.0018 0.0092 28.7183 ------------.. | 2/8
4 h-m-p 0.0000 0.0001 538.7676 ++ 987.651514 m 0.0001 56 | 3/8
5 h-m-p 0.0012 0.0182 60.3637 -----------.. | 3/8
6 h-m-p 0.0000 0.0001 485.4299 ++ 973.506411 m 0.0001 87 | 4/8
7 h-m-p 0.0005 0.0222 49.6612 -----------.. | 4/8
8 h-m-p 0.0000 0.0000 421.3535 ++ 964.718243 m 0.0000 118 | 5/8
9 h-m-p 0.0005 0.0292 37.6989 -----------.. | 5/8
10 h-m-p 0.0000 0.0001 344.6558 ++ 958.084704 m 0.0001 149 | 6/8
11 h-m-p 0.0005 0.0433 25.4467 -----------.. | 6/8
12 h-m-p 0.0000 0.0000 244.4910 ++ 957.779970 m 0.0000 180 | 7/8
13 h-m-p 1.6000 8.0000 0.0000 C 957.779970 0 1.6000 191 | 7/8
14 h-m-p 0.0160 8.0000 0.0000 +Y 957.779970 0 0.0640 204
Out..
lnL = -957.779970
205 lfun, 205 eigenQcodon, 1230 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014816 0.048499 0.107652 0.026552 0.014078 0.090203 0.000100 0.551063 0.214986
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.329429
np = 9
lnL0 = -1026.615281
Iterating by ming2
Initial: fx= 1026.615281
x= 0.01482 0.04850 0.10765 0.02655 0.01408 0.09020 0.00011 0.55106 0.21499
1 h-m-p 0.0000 0.0000 531.9234 ++ 1026.143236 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 332.8226 +++ 1006.991847 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 173.1982 ++ 1006.366967 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0003 133.9985 +++ 999.301887 m 0.0003 52 | 4/9
5 h-m-p 0.0000 0.0002 209.9735 ++ 989.168629 m 0.0002 64 | 5/9
6 h-m-p 0.0000 0.0001 1580.1884 ++ 969.464140 m 0.0001 76 | 6/9
7 h-m-p 0.0000 0.0002 494.9600 ++ 957.779769 m 0.0002 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0002 ++ 957.779768 m 8.0000 100 | 7/9
9 h-m-p 0.0001 0.0221 10.6060 ++++ 957.779669 m 0.0221 116 | 8/9
10 h-m-p 0.1264 0.6322 0.1817 ++ 957.779453 m 0.6322 128 | 9/9
11 h-m-p 0.0160 8.0000 0.0000 C 957.779453 0 0.0160 141
Out..
lnL = -957.779453
142 lfun, 426 eigenQcodon, 1704 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102703 0.015812 0.067286 0.083532 0.025924 0.078525 0.000100 1.008683 0.371649 0.125248 1.224430
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.114352
np = 11
lnL0 = -1039.601247
Iterating by ming2
Initial: fx= 1039.601247
x= 0.10270 0.01581 0.06729 0.08353 0.02592 0.07852 0.00011 1.00868 0.37165 0.12525 1.22443
1 h-m-p 0.0000 0.0000 487.8335 ++ 1039.343392 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 358.5258 +++ 1018.737144 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 159.1225 ++ 1010.299060 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0008 87.9311 ++ 999.210173 m 0.0008 59 | 4/11
5 h-m-p 0.0002 0.0011 141.2818 ++ 985.462510 m 0.0011 73 | 5/11
6 h-m-p 0.0001 0.0003 570.1439 ++ 981.223563 m 0.0003 87 | 6/11
7 h-m-p 0.0000 0.0002 376.0659 ++ 972.601059 m 0.0002 101 | 7/11
8 h-m-p 0.0001 0.0011 909.4326 ++ 957.779792 m 0.0011 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 957.779792 m 8.0000 129 | 8/11
10 h-m-p 0.0160 8.0000 0.7295 +++++ 957.779457 m 8.0000 149 | 8/11
11 h-m-p 1.6000 8.0000 0.1577 ++ 957.779454 m 8.0000 166 | 8/11
12 h-m-p 1.6000 8.0000 0.5881 ++ 957.779453 m 8.0000 183 | 8/11
13 h-m-p 1.6000 8.0000 0.0661 ++ 957.779453 m 8.0000 200 | 8/11
14 h-m-p 0.5775 8.0000 0.9151 ++ 957.779453 m 8.0000 217 | 8/11
15 h-m-p 1.6000 8.0000 0.0000 C 957.779453 0 1.6000 234 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 Y 957.779453 0 0.0160 251
Out..
lnL = -957.779453
252 lfun, 1008 eigenQcodon, 4536 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -957.848389 S = -957.780854 -0.026205
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:02
did 20 / 51 patterns 0:02
did 30 / 51 patterns 0:02
did 40 / 51 patterns 0:02
did 50 / 51 patterns 0:02
did 51 / 51 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040406 0.090083 0.047355 0.107557 0.085044 0.093697 0.000100 0.223387 1.335580
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 27.252902
np = 9
lnL0 = -1054.517061
Iterating by ming2
Initial: fx= 1054.517061
x= 0.04041 0.09008 0.04736 0.10756 0.08504 0.09370 0.00011 0.22339 1.33558
1 h-m-p 0.0000 0.0000 462.9890 ++ 1054.440580 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0050 54.5210 +++++ 1045.276816 m 0.0050 29 | 2/9
3 h-m-p 0.0001 0.0006 910.2748 ++ 1008.605699 m 0.0006 41 | 3/9
4 h-m-p 0.0008 0.0038 193.0642 ++ 980.138645 m 0.0038 53 | 4/9
5 h-m-p 0.0000 0.0001 233.5969 ++ 979.700350 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0001 743.7401 ++ 977.363966 m 0.0001 77 | 6/9
7 h-m-p 0.0004 0.0019 74.6797 ++ 975.010833 m 0.0019 89 | 7/9
8 h-m-p 0.0570 8.0000 2.2853 --------------.. | 7/9
9 h-m-p 0.0000 0.0004 200.1196 +++ 957.779453 m 0.0004 126 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 957.779453 0 1.6000 138 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 Y 957.779453 0 0.0160 151
Out..
lnL = -957.779453
152 lfun, 1672 eigenQcodon, 9120 P(t)
Time used: 0:04
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028212 0.028386 0.020697 0.050443 0.086356 0.018100 0.000100 0.900000 0.890410 1.898365 1.101388
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.803406
np = 11
lnL0 = -1010.807554
Iterating by ming2
Initial: fx= 1010.807554
x= 0.02821 0.02839 0.02070 0.05044 0.08636 0.01810 0.00011 0.90000 0.89041 1.89837 1.10139
1 h-m-p 0.0000 0.0000 536.2466 ++ 1010.277886 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0048 83.1419 +++++ 980.907721 m 0.0048 33 | 2/11
3 h-m-p 0.0000 0.0000 7816.9360 ++ 978.004486 m 0.0000 47 | 3/11
4 h-m-p 0.0002 0.0011 81.7986 ++ 975.788286 m 0.0011 61 | 4/11
5 h-m-p 0.0000 0.0000 70901.4968 ++ 975.760047 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0001 1337.9059 ++ 972.419266 m 0.0001 89 | 6/11
7 h-m-p 0.0000 0.0000 44082.9014 ++ 966.259169 m 0.0000 103 | 7/11
8 h-m-p 0.0018 0.0091 51.2802 ++ 961.645660 m 0.0091 117 | 8/11
9 h-m-p 0.0073 0.0365 38.5506 -------------.. | 8/11
10 h-m-p 0.0000 0.0001 238.4151 ++ 957.779867 m 0.0001 156 | 9/11
11 h-m-p 1.0109 8.0000 0.0000 ++ 957.779867 m 8.0000 170 | 9/11
12 h-m-p 0.1167 8.0000 0.0003 ++++ 957.779867 m 8.0000 188 | 9/11
13 h-m-p 0.0160 8.0000 0.8771 +++++ 957.779861 m 8.0000 207 | 9/11
14 h-m-p 1.6000 8.0000 0.4202 ++ 957.779861 m 8.0000 223 | 9/11
15 h-m-p 0.8536 8.0000 3.9379 ++ 957.779860 m 8.0000 239 | 9/11
16 h-m-p 0.3099 1.5495 49.6482 ++ 957.779860 m 1.5495 253 | 10/11
17 h-m-p 0.2240 1.1198 26.2708 ------------Y 957.779860 0 0.0000 279 | 10/11
18 h-m-p 0.0160 8.0000 0.0000 ------------N 957.779860 0 0.0000 305
Out..
lnL = -957.779860
306 lfun, 3672 eigenQcodon, 20196 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -957.806690 S = -957.776399 -0.013357
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:10
did 20 / 51 patterns 0:10
did 30 / 51 patterns 0:10
did 40 / 51 patterns 0:10
did 50 / 51 patterns 0:10
did 51 / 51 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NC_002677_1_NP_302142_1_1014_ML1661 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
**************************************************
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NC_002677_1_NP_302142_1_1014_ML1661 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
**************************************************
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NC_002677_1_NP_302142_1_1014_ML1661 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
**************************************************
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NC_002677_1_NP_302142_1_1014_ML1661 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
**************************************************
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NC_002677_1_NP_302142_1_1014_ML1661 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
***********************************************
>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NC_002677_1_NP_302142_1_1014_ML1661 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NC_002677_1_NP_302142_1_1014_ML1661 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
#NEXUS
[ID: 5597914545]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908463_1_1764_MLBR_RS08360
NC_002677_1_NP_302142_1_1014_ML1661
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908463_1_1764_MLBR_RS08360,
2 NC_002677_1_NP_302142_1_1014_ML1661,
3 NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965,
4 NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680,
5 NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125,
6 NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1008.14 -1011.08
2 -1008.15 -1011.64
--------------------------------------
TOTAL -1008.15 -1011.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000
r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003
r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000
r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008
r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000
r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010
r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002
pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001
pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001
pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000
pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000
alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000
alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000
pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1661/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 247
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 5 5 5 5 5 5 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 7 7 7 7 7 7 | CCC 0 0 0 0 0 0 | CAC 5 5 5 5 5 5 | CGC 9 9 9 9 9 9
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2
CTG 6 6 6 6 6 6 | CCG 2 2 2 2 2 2 | CAG 6 6 6 6 6 6 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 11 11 11 11 11 11 | ACC 3 3 3 3 3 3 | AAC 8 8 8 8 8 8 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 13 13 13 13 13 13 | Gly GGT 4 4 4 4 4 4
GTC 3 3 3 3 3 3 | GCC 12 12 12 12 12 12 | GAC 9 9 9 9 9 9 | GGC 8 8 8 8 8 8
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 9 9 9 9 9 9 | GGA 0 0 0 0 0 0
GTG 9 9 9 9 9 9 | GCG 16 16 16 16 16 16 | GAG 18 18 18 18 18 18 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
#2: NC_002677_1_NP_302142_1_1014_ML1661
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
#3: NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
#4: NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
#5: NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
#6: NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 6 | TCC 30 | TAC 24 | TGC 12
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 30
CTC 42 | CCC 0 | CAC 30 | CGC 54
CTA 0 | CCA 0 | Gln Q CAA 24 | CGA 12
CTG 36 | CCG 12 | CAG 36 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 12
ATC 66 | ACC 18 | AAC 48 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 36 | ACG 24 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 78 | Gly G GGT 24
GTC 18 | GCC 72 | GAC 54 | GGC 48
GTA 18 | GCA 6 | Glu E GAA 54 | GGA 0
GTG 54 | GCG 96 | GAG 108 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749
position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409
position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437
Average T:0.17679 C:0.27665 A:0.21457 G:0.33198
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -957.779970 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.101388
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.10139
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
7..2 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
7..3 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
7..4 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
7..5 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
7..6 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -957.779453 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -957.779453 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 2.931380
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 2.93138
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -957.779453 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.513254
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.51325
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -957.779860 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 69.581196 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 69.58120 q = 99.00000
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.35113 0.37348 0.38697 0.39782 0.40763 0.41718 0.42708 0.43815 0.45206 0.47554 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
7..2 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
7..3 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
7..4 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
7..5 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
7..6 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:10
Model 1: NearlyNeutral -957.779453 Model 2: PositiveSelection -957.779453 Model 0: one-ratio -957.77997 Model 7: beta -957.779453 Model 8: beta&w>1 -957.77986 Model 0 vs 1 0.001034000000117885 Model 2 vs 1 0.0 Model 8 vs 7 8.139999999912106E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
