--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:15:36 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1661/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1008.14 -1011.08 2 -1008.15 -1011.64 -------------------------------------- TOTAL -1008.15 -1011.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000 r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003 r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000 r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008 r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000 r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010 r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002 pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001 pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001 pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000 pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000 alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000 alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000 pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -957.779453 Model 2: PositiveSelection -957.779453 Model 0: one-ratio -957.77997 Model 7: beta -957.779453 Model 8: beta&w>1 -957.77986 Model 0 vs 1 0.001034000000117885 Model 2 vs 1 0.0 Model 8 vs 7 8.139999999912106E-4
>C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247 C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE ************************************************** C1 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C2 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C3 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C4 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C5 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C6 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD ************************************************** C1 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C2 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C3 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C4 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C5 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C6 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD ************************************************** C1 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C2 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C3 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C4 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C5 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C6 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD ************************************************** C1 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C2 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C3 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C4 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C5 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C6 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR *********************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7410] Library Relaxation: Multi_proc [96] Relaxation Summary: [7410]--->[7410] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.799 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE ************************************************** C1 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C2 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C3 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C4 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C5 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD C6 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD ************************************************** C1 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C2 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C3 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C4 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C5 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD C6 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD ************************************************** C1 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C2 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C3 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C4 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C5 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD C6 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD ************************************************** C1 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C2 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C3 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C4 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C5 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR C6 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR *********************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT C2 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT C3 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT C4 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT C5 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT C6 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT ************************************************** C1 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG C2 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG C3 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG C4 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG C5 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG C6 CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG ************************************************** C1 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG C2 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG C3 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG C4 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG C5 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG C6 GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG ************************************************** C1 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA C2 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA C3 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA C4 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA C5 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA C6 TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA ************************************************** C1 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG C2 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG C3 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG C4 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG C5 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG C6 CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG ************************************************** C1 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC C2 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC C3 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC C4 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC C5 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC C6 AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC ************************************************** C1 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA C2 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA C3 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA C4 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA C5 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA C6 GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA ************************************************** C1 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG C2 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG C3 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG C4 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG C5 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG C6 GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG ************************************************** C1 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC C2 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC C3 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC C4 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC C5 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC C6 CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC ************************************************** C1 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG C2 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG C3 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG C4 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG C5 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG C6 CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG ************************************************** C1 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG C2 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG C3 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG C4 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG C5 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG C6 CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG ************************************************** C1 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC C2 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC C3 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC C4 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC C5 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC C6 CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC ************************************************** C1 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT C2 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT C3 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT C4 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT C5 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT C6 CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT ************************************************** C1 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC C2 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC C3 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC C4 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC C5 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC C6 CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC ************************************************** C1 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC C2 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC C3 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC C4 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC C5 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC C6 AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC ***************************************** >C1 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C2 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C3 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C4 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C5 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C6 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >C1 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C2 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C3 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C4 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C5 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >C6 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 741 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579857260 Setting output file names to "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 353694223 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5597914545 Seed = 1215641637 Swapseed = 1579857260 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1658.393524 -- -24.965149 Chain 2 -- -1658.393271 -- -24.965149 Chain 3 -- -1658.393524 -- -24.965149 Chain 4 -- -1658.393524 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1658.393524 -- -24.965149 Chain 2 -- -1658.393524 -- -24.965149 Chain 3 -- -1658.393524 -- -24.965149 Chain 4 -- -1658.393429 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1658.394] (-1658.393) (-1658.394) (-1658.394) * [-1658.394] (-1658.394) (-1658.394) (-1658.393) 500 -- (-1031.861) (-1017.553) (-1025.933) [-1013.843] * (-1022.038) (-1021.999) [-1017.748] (-1027.858) -- 0:00:00 1000 -- (-1019.737) [-1016.194] (-1019.724) (-1012.420) * (-1029.613) (-1017.330) [-1013.435] (-1022.888) -- 0:00:00 1500 -- (-1025.184) (-1022.315) (-1020.040) [-1021.493] * (-1022.802) (-1019.389) [-1016.565] (-1013.781) -- 0:00:00 2000 -- (-1027.832) (-1018.352) (-1024.480) [-1014.107] * (-1015.329) (-1016.346) [-1014.961] (-1010.985) -- 0:00:00 2500 -- (-1018.776) (-1019.959) (-1017.666) [-1017.948] * (-1014.853) (-1013.984) (-1017.008) [-1019.922] -- 0:00:00 3000 -- (-1017.807) (-1025.490) [-1014.280] (-1013.657) * (-1022.261) (-1019.883) (-1016.423) [-1021.552] -- 0:00:00 3500 -- (-1018.671) (-1013.350) (-1020.242) [-1012.357] * (-1028.295) (-1014.668) (-1021.011) [-1020.194] -- 0:00:00 4000 -- (-1020.892) [-1012.713] (-1016.832) (-1015.869) * (-1015.899) [-1016.925] (-1020.170) (-1019.248) -- 0:00:00 4500 -- (-1011.620) [-1018.927] (-1017.010) (-1019.621) * (-1019.297) (-1013.783) (-1016.549) [-1016.172] -- 0:00:00 5000 -- [-1016.318] (-1022.782) (-1026.994) (-1022.346) * (-1023.831) [-1010.181] (-1027.321) (-1014.945) -- 0:00:00 Average standard deviation of split frequencies: 0.097274 5500 -- (-1019.949) (-1021.553) [-1020.528] (-1019.217) * (-1014.935) (-1013.217) [-1020.748] (-1021.085) -- 0:00:00 6000 -- (-1019.063) (-1017.075) [-1014.233] (-1022.006) * (-1019.914) (-1017.922) (-1018.926) [-1013.429] -- 0:00:00 6500 -- (-1025.149) (-1012.710) (-1018.378) [-1017.860] * (-1022.149) [-1017.596] (-1020.942) (-1015.168) -- 0:00:00 7000 -- [-1016.425] (-1022.237) (-1026.932) (-1026.760) * (-1016.963) (-1021.418) (-1019.391) [-1016.441] -- 0:00:00 7500 -- (-1021.756) (-1020.507) (-1024.448) [-1010.243] * (-1013.651) (-1019.309) (-1024.956) [-1028.414] -- 0:00:00 8000 -- (-1018.441) (-1017.572) [-1017.059] (-1017.054) * (-1021.656) (-1024.954) [-1014.236] (-1017.150) -- 0:00:00 8500 -- (-1020.397) [-1020.814] (-1012.471) (-1016.754) * (-1023.180) (-1015.967) [-1016.897] (-1017.890) -- 0:00:00 9000 -- (-1025.020) (-1016.627) [-1012.223] (-1020.792) * (-1026.815) (-1026.963) [-1013.462] (-1021.280) -- 0:00:00 9500 -- (-1016.701) (-1024.922) (-1014.247) [-1013.569] * (-1019.400) (-1015.321) (-1016.743) [-1018.525] -- 0:01:44 10000 -- (-1020.103) (-1020.865) (-1024.254) [-1019.817] * (-1015.924) (-1023.496) (-1013.020) [-1020.605] -- 0:01:39 Average standard deviation of split frequencies: 0.062608 10500 -- (-1015.403) (-1018.021) (-1014.188) [-1015.321] * (-1024.615) [-1016.872] (-1018.019) (-1018.565) -- 0:01:34 11000 -- (-1019.308) (-1019.419) (-1017.915) [-1015.713] * [-1013.412] (-1015.330) (-1023.291) (-1020.454) -- 0:01:29 11500 -- (-1015.677) (-1015.992) (-1015.457) [-1015.048] * (-1015.943) [-1016.058] (-1024.149) (-1018.433) -- 0:01:25 12000 -- (-1025.918) (-1024.227) [-1010.495] (-1021.220) * (-1010.667) [-1019.708] (-1026.373) (-1014.577) -- 0:01:22 12500 -- (-1019.380) (-1020.666) [-1019.156] (-1018.510) * (-1022.868) (-1017.359) [-1023.035] (-1021.873) -- 0:01:19 13000 -- [-1020.284] (-1031.878) (-1019.499) (-1017.966) * (-1024.703) (-1014.961) (-1021.300) [-1013.739] -- 0:01:15 13500 -- (-1013.822) (-1013.497) [-1017.896] (-1019.307) * (-1016.322) (-1020.403) (-1019.432) [-1022.382] -- 0:01:13 14000 -- (-1027.269) (-1014.949) [-1018.670] (-1020.396) * (-1024.602) [-1018.802] (-1015.483) (-1017.588) -- 0:01:10 14500 -- (-1018.774) [-1014.301] (-1023.402) (-1024.182) * [-1015.710] (-1024.996) (-1018.031) (-1020.127) -- 0:01:07 15000 -- (-1014.604) [-1017.488] (-1020.045) (-1017.770) * (-1023.144) [-1015.507] (-1017.007) (-1028.564) -- 0:01:05 Average standard deviation of split frequencies: 0.054274 15500 -- [-1010.958] (-1024.317) (-1026.460) (-1014.537) * (-1017.261) (-1019.779) (-1015.869) [-1010.046] -- 0:01:03 16000 -- (-1021.103) (-1015.456) (-1018.549) [-1017.040] * [-1016.505] (-1024.767) (-1012.719) (-1009.743) -- 0:01:01 16500 -- (-1012.912) (-1014.180) [-1015.243] (-1024.702) * (-1025.080) (-1017.237) (-1017.276) [-1008.671] -- 0:00:59 17000 -- [-1017.222] (-1013.087) (-1021.754) (-1018.880) * (-1020.544) (-1012.055) (-1021.385) [-1007.714] -- 0:00:57 17500 -- (-1017.089) (-1021.846) (-1016.802) [-1016.323] * (-1019.105) [-1019.290] (-1030.213) (-1010.170) -- 0:00:56 18000 -- (-1014.532) (-1018.071) (-1018.617) [-1010.704] * [-1020.211] (-1018.705) (-1019.793) (-1008.401) -- 0:00:54 18500 -- (-1019.106) (-1017.435) (-1011.775) [-1018.658] * [-1013.868] (-1020.951) (-1027.657) (-1008.385) -- 0:00:53 19000 -- (-1017.945) (-1019.031) [-1013.193] (-1021.436) * (-1014.480) (-1020.622) (-1023.178) [-1007.840] -- 0:00:51 19500 -- [-1019.527] (-1017.754) (-1028.765) (-1016.455) * (-1019.604) (-1014.548) (-1012.619) [-1007.981] -- 0:00:50 20000 -- (-1020.527) (-1015.087) (-1024.939) [-1019.945] * [-1013.947] (-1021.395) (-1008.903) (-1010.173) -- 0:00:49 Average standard deviation of split frequencies: 0.051702 20500 -- (-1021.857) [-1016.933] (-1021.689) (-1023.742) * (-1018.680) [-1020.149] (-1007.968) (-1009.291) -- 0:00:47 21000 -- [-1018.744] (-1025.668) (-1020.450) (-1012.751) * (-1026.848) [-1018.905] (-1007.478) (-1008.307) -- 0:00:46 21500 -- (-1025.876) [-1021.314] (-1018.060) (-1018.627) * (-1018.364) (-1015.794) [-1007.978] (-1008.741) -- 0:00:45 22000 -- [-1017.946] (-1022.415) (-1027.012) (-1026.642) * (-1022.658) (-1020.022) (-1012.391) [-1009.357] -- 0:00:44 22500 -- (-1026.391) (-1015.935) (-1017.011) [-1019.717] * (-1019.089) [-1015.796] (-1008.996) (-1010.553) -- 0:00:43 23000 -- (-1024.010) [-1016.029] (-1036.604) (-1015.092) * [-1010.772] (-1012.482) (-1007.775) (-1009.276) -- 0:00:42 23500 -- [-1013.441] (-1021.722) (-1009.163) (-1020.431) * (-1022.763) (-1028.709) [-1013.179] (-1007.053) -- 0:00:41 24000 -- (-1011.740) [-1018.208] (-1013.471) (-1020.758) * (-1017.957) (-1014.711) (-1009.673) [-1009.398] -- 0:00:40 24500 -- (-1010.689) [-1013.584] (-1010.198) (-1016.070) * [-1018.323] (-1010.096) (-1007.505) (-1006.965) -- 0:00:39 25000 -- (-1007.720) [-1019.436] (-1012.522) (-1015.760) * (-1014.766) (-1008.879) (-1008.415) [-1007.321] -- 0:01:18 Average standard deviation of split frequencies: 0.048624 25500 -- (-1007.807) [-1018.732] (-1007.989) (-1026.984) * (-1023.115) (-1008.676) (-1009.225) [-1007.675] -- 0:01:16 26000 -- (-1008.794) [-1017.736] (-1007.661) (-1019.309) * (-1013.203) [-1007.258] (-1008.394) (-1009.794) -- 0:01:14 26500 -- [-1008.742] (-1024.023) (-1007.084) (-1017.714) * [-1016.403] (-1008.653) (-1013.414) (-1007.889) -- 0:01:13 27000 -- [-1010.395] (-1014.579) (-1007.237) (-1015.577) * [-1014.643] (-1009.876) (-1009.148) (-1008.221) -- 0:01:12 27500 -- (-1010.161) [-1014.885] (-1010.075) (-1018.387) * [-1018.831] (-1007.844) (-1008.125) (-1008.018) -- 0:01:10 28000 -- (-1013.767) (-1014.352) (-1007.977) [-1016.860] * (-1022.134) (-1007.460) [-1008.018] (-1008.303) -- 0:01:09 28500 -- (-1014.306) (-1017.202) [-1007.923] (-1019.918) * (-1014.168) [-1008.021] (-1008.858) (-1009.343) -- 0:01:08 29000 -- [-1007.711] (-1017.352) (-1008.924) (-1018.298) * (-1025.199) (-1010.124) (-1011.215) [-1009.822] -- 0:01:06 29500 -- (-1007.236) [-1020.813] (-1009.014) (-1012.674) * (-1011.414) [-1008.238] (-1008.709) (-1009.030) -- 0:01:05 30000 -- (-1008.612) [-1018.921] (-1007.880) (-1013.853) * [-1020.252] (-1008.327) (-1008.092) (-1010.489) -- 0:01:04 Average standard deviation of split frequencies: 0.042456 30500 -- [-1007.820] (-1018.489) (-1006.895) (-1013.301) * (-1019.785) (-1008.825) [-1007.672] (-1011.919) -- 0:01:03 31000 -- (-1007.775) (-1014.691) (-1008.654) [-1017.303] * (-1019.908) [-1008.311] (-1007.677) (-1007.668) -- 0:01:02 31500 -- (-1007.030) (-1021.808) [-1010.122] (-1017.594) * (-1033.510) (-1007.396) (-1009.906) [-1008.116] -- 0:01:01 32000 -- (-1006.999) (-1016.170) [-1009.283] (-1021.348) * (-1011.710) [-1007.428] (-1008.239) (-1008.242) -- 0:01:00 32500 -- [-1007.464] (-1019.016) (-1009.671) (-1015.294) * (-1024.891) (-1011.209) (-1008.652) [-1008.291] -- 0:00:59 33000 -- [-1007.936] (-1019.039) (-1008.592) (-1018.387) * [-1009.279] (-1008.746) (-1008.880) (-1007.366) -- 0:00:58 33500 -- (-1007.326) (-1015.007) [-1007.789] (-1026.175) * (-1009.125) (-1010.352) [-1008.839] (-1008.013) -- 0:00:57 34000 -- (-1010.456) (-1018.484) (-1007.983) [-1016.035] * (-1007.602) (-1010.254) (-1007.851) [-1007.538] -- 0:00:56 34500 -- (-1009.524) (-1014.794) [-1008.978] (-1016.914) * [-1007.005] (-1012.338) (-1008.075) (-1010.755) -- 0:00:55 35000 -- (-1011.129) (-1012.454) (-1008.471) [-1014.966] * (-1007.057) (-1010.178) [-1007.068] (-1014.092) -- 0:00:55 Average standard deviation of split frequencies: 0.036166 35500 -- (-1008.582) (-1014.762) (-1006.842) [-1013.330] * (-1011.612) (-1012.033) (-1010.429) [-1012.498] -- 0:00:54 36000 -- (-1009.119) (-1020.794) (-1010.190) [-1014.151] * (-1010.479) (-1010.073) (-1008.260) [-1011.444] -- 0:00:53 36500 -- [-1009.389] (-1016.776) (-1008.112) (-1020.449) * (-1009.109) [-1009.609] (-1009.158) (-1009.507) -- 0:00:52 37000 -- [-1008.039] (-1016.966) (-1009.420) (-1021.153) * (-1008.092) (-1008.065) [-1013.153] (-1008.441) -- 0:00:52 37500 -- [-1007.986] (-1017.007) (-1007.278) (-1008.241) * (-1009.320) (-1010.407) (-1008.650) [-1008.165] -- 0:00:51 38000 -- (-1013.090) (-1031.439) (-1008.838) [-1008.607] * (-1008.512) (-1008.430) (-1009.199) [-1008.309] -- 0:00:50 38500 -- (-1009.041) (-1020.147) (-1009.293) [-1007.971] * (-1007.759) (-1013.058) (-1008.592) [-1007.892] -- 0:00:49 39000 -- [-1009.120] (-1013.157) (-1008.294) (-1010.516) * (-1016.217) (-1011.030) (-1009.028) [-1010.607] -- 0:00:49 39500 -- (-1007.537) (-1020.001) [-1009.410] (-1008.469) * (-1012.653) (-1010.360) (-1016.394) [-1009.112] -- 0:00:48 40000 -- (-1008.241) (-1015.849) [-1008.393] (-1007.361) * [-1007.682] (-1010.764) (-1013.721) (-1007.852) -- 0:00:48 Average standard deviation of split frequencies: 0.032335 40500 -- (-1007.793) (-1017.324) (-1010.521) [-1007.630] * [-1007.057] (-1013.695) (-1015.351) (-1006.821) -- 0:00:47 41000 -- (-1008.990) (-1018.523) [-1007.520] (-1007.784) * (-1008.561) [-1014.687] (-1010.401) (-1007.487) -- 0:01:10 41500 -- [-1009.661] (-1018.412) (-1008.192) (-1008.156) * (-1010.960) [-1014.729] (-1007.480) (-1008.281) -- 0:01:09 42000 -- (-1008.799) (-1013.881) [-1007.278] (-1008.682) * (-1008.297) [-1011.797] (-1007.282) (-1009.304) -- 0:01:08 42500 -- (-1009.935) (-1019.699) (-1008.059) [-1006.888] * (-1007.936) [-1007.876] (-1008.155) (-1010.213) -- 0:01:07 43000 -- (-1014.065) (-1015.868) (-1008.334) [-1009.036] * [-1008.023] (-1007.655) (-1008.176) (-1009.568) -- 0:01:06 43500 -- (-1012.864) (-1014.045) (-1008.727) [-1009.428] * (-1009.412) [-1010.490] (-1007.328) (-1008.204) -- 0:01:05 44000 -- (-1011.761) (-1018.226) (-1007.558) [-1008.133] * (-1009.858) (-1013.945) [-1008.050] (-1007.627) -- 0:01:05 44500 -- [-1011.764] (-1028.974) (-1009.912) (-1009.111) * (-1007.921) [-1010.428] (-1007.685) (-1007.070) -- 0:01:04 45000 -- (-1011.028) (-1017.909) (-1007.306) [-1008.664] * (-1008.277) [-1008.777] (-1008.001) (-1007.629) -- 0:01:03 Average standard deviation of split frequencies: 0.029768 45500 -- (-1011.795) (-1013.680) [-1008.325] (-1008.083) * [-1009.430] (-1009.041) (-1009.963) (-1007.539) -- 0:01:02 46000 -- (-1010.717) (-1020.771) [-1007.567] (-1007.935) * (-1008.118) (-1011.540) (-1010.960) [-1007.622] -- 0:01:02 46500 -- (-1011.656) (-1017.346) (-1008.902) [-1007.354] * (-1007.903) (-1009.582) (-1009.263) [-1008.416] -- 0:01:01 47000 -- (-1009.516) (-1017.957) [-1007.244] (-1009.850) * (-1008.426) (-1011.135) (-1007.953) [-1008.870] -- 0:01:00 47500 -- (-1010.602) (-1020.084) [-1009.138] (-1010.782) * (-1007.913) (-1008.120) (-1009.402) [-1010.933] -- 0:01:00 48000 -- (-1008.736) (-1012.583) [-1009.490] (-1010.458) * (-1007.915) (-1008.762) [-1010.090] (-1008.674) -- 0:00:59 48500 -- (-1009.181) (-1017.381) (-1008.061) [-1009.707] * (-1007.981) (-1012.702) (-1008.544) [-1011.904] -- 0:00:58 49000 -- (-1011.744) (-1024.465) [-1008.165] (-1009.622) * (-1007.340) (-1010.216) (-1010.348) [-1009.288] -- 0:00:58 49500 -- (-1010.135) (-1023.564) (-1008.950) [-1009.538] * (-1010.723) (-1011.836) (-1008.480) [-1008.111] -- 0:00:57 50000 -- [-1011.968] (-1014.907) (-1008.910) (-1012.070) * (-1011.500) (-1009.179) (-1009.057) [-1009.236] -- 0:00:57 Average standard deviation of split frequencies: 0.029463 50500 -- (-1009.355) (-1018.760) (-1008.276) [-1015.263] * (-1008.391) (-1008.172) (-1008.587) [-1008.450] -- 0:00:56 51000 -- [-1010.615] (-1017.342) (-1009.057) (-1010.416) * (-1007.897) (-1008.780) (-1009.734) [-1009.003] -- 0:00:55 51500 -- (-1012.779) [-1016.569] (-1009.495) (-1015.267) * [-1008.344] (-1007.052) (-1009.538) (-1007.583) -- 0:00:55 52000 -- [-1012.241] (-1023.591) (-1010.371) (-1010.332) * (-1008.198) (-1007.392) (-1009.922) [-1009.973] -- 0:00:54 52500 -- (-1009.046) (-1019.673) (-1013.605) [-1010.039] * (-1008.126) (-1010.352) (-1011.275) [-1009.343] -- 0:00:54 53000 -- (-1011.340) [-1016.466] (-1015.856) (-1008.081) * (-1008.255) (-1011.626) [-1008.492] (-1008.043) -- 0:00:53 53500 -- [-1008.144] (-1016.008) (-1010.436) (-1011.396) * (-1009.826) (-1011.891) (-1010.246) [-1010.068] -- 0:00:53 54000 -- (-1009.098) [-1013.735] (-1008.085) (-1012.057) * [-1009.561] (-1011.196) (-1011.862) (-1010.075) -- 0:00:52 54500 -- (-1007.637) (-1014.571) (-1009.180) [-1008.089] * (-1011.423) (-1008.643) (-1012.173) [-1014.235] -- 0:00:52 55000 -- [-1007.753] (-1012.455) (-1009.501) (-1007.983) * (-1008.466) (-1007.097) (-1010.487) [-1009.654] -- 0:00:51 Average standard deviation of split frequencies: 0.030398 55500 -- (-1007.377) (-1020.988) (-1012.481) [-1008.853] * [-1010.613] (-1008.755) (-1011.446) (-1009.289) -- 0:00:51 56000 -- (-1007.379) (-1029.476) (-1012.494) [-1010.693] * (-1008.013) [-1007.773] (-1008.482) (-1008.262) -- 0:00:50 56500 -- (-1009.787) (-1013.576) (-1010.260) [-1008.231] * (-1009.346) [-1008.033] (-1008.043) (-1010.406) -- 0:00:50 57000 -- (-1012.251) (-1020.332) [-1008.849] (-1007.389) * (-1008.638) [-1010.357] (-1009.657) (-1009.561) -- 0:01:06 57500 -- (-1011.361) [-1023.089] (-1011.705) (-1008.944) * (-1011.835) (-1011.213) (-1012.970) [-1009.052] -- 0:01:05 58000 -- (-1009.209) (-1022.272) [-1009.594] (-1008.514) * (-1012.752) (-1009.414) [-1012.525] (-1010.037) -- 0:01:04 58500 -- (-1010.808) [-1021.209] (-1008.380) (-1008.501) * (-1010.184) (-1015.029) (-1014.101) [-1008.686] -- 0:01:04 59000 -- (-1014.705) (-1012.486) [-1011.832] (-1012.586) * (-1008.227) [-1008.301] (-1007.092) (-1011.742) -- 0:01:03 59500 -- (-1009.377) (-1014.303) [-1008.466] (-1012.336) * (-1007.817) (-1007.385) [-1009.039] (-1009.344) -- 0:01:03 60000 -- (-1014.889) (-1018.685) (-1007.783) [-1011.554] * (-1009.028) (-1006.986) [-1010.411] (-1007.928) -- 0:01:02 Average standard deviation of split frequencies: 0.030693 60500 -- (-1008.406) [-1016.411] (-1007.562) (-1009.860) * (-1007.921) (-1008.163) [-1009.640] (-1008.100) -- 0:01:02 61000 -- (-1009.555) (-1025.413) [-1006.982] (-1010.913) * (-1006.648) (-1008.306) (-1011.244) [-1010.163] -- 0:01:01 61500 -- [-1008.694] (-1028.024) (-1007.110) (-1009.370) * (-1008.386) [-1008.073] (-1008.153) (-1011.027) -- 0:01:01 62000 -- (-1008.043) (-1020.295) [-1008.377] (-1007.886) * [-1007.329] (-1007.223) (-1009.635) (-1011.482) -- 0:01:00 62500 -- (-1009.014) (-1007.934) (-1007.437) [-1007.354] * [-1007.563] (-1007.840) (-1011.386) (-1011.765) -- 0:01:00 63000 -- (-1008.445) (-1007.569) (-1008.045) [-1007.002] * [-1008.327] (-1008.461) (-1007.386) (-1007.775) -- 0:00:59 63500 -- (-1009.068) [-1007.770] (-1008.174) (-1006.794) * (-1009.996) [-1007.415] (-1008.224) (-1007.096) -- 0:00:58 64000 -- [-1012.269] (-1010.212) (-1007.812) (-1006.843) * (-1011.213) [-1009.110] (-1006.516) (-1012.797) -- 0:00:58 64500 -- (-1009.227) (-1007.564) (-1007.585) [-1006.766] * (-1009.851) (-1011.846) (-1006.877) [-1009.354] -- 0:00:58 65000 -- (-1010.153) (-1010.704) (-1007.857) [-1007.085] * (-1011.278) [-1011.569] (-1008.787) (-1010.119) -- 0:00:57 Average standard deviation of split frequencies: 0.028570 65500 -- (-1009.567) [-1006.531] (-1007.231) (-1009.485) * (-1012.020) (-1013.356) [-1011.132] (-1008.787) -- 0:00:57 66000 -- (-1012.449) [-1006.744] (-1007.232) (-1006.757) * (-1009.584) (-1009.839) [-1007.019] (-1011.897) -- 0:00:56 66500 -- [-1007.432] (-1008.389) (-1007.053) (-1007.468) * [-1011.861] (-1012.311) (-1008.935) (-1009.774) -- 0:00:56 67000 -- (-1008.471) [-1009.037] (-1006.697) (-1006.931) * (-1012.236) (-1013.866) (-1007.257) [-1010.155] -- 0:00:55 67500 -- (-1008.456) (-1013.728) [-1006.786] (-1015.025) * (-1012.388) (-1010.411) [-1007.777] (-1008.981) -- 0:00:55 68000 -- [-1009.447] (-1007.013) (-1008.781) (-1009.344) * (-1007.432) (-1009.412) [-1008.392] (-1006.951) -- 0:00:54 68500 -- [-1006.908] (-1007.827) (-1007.899) (-1009.623) * (-1010.383) (-1007.537) [-1008.001] (-1010.566) -- 0:00:54 69000 -- (-1009.024) (-1010.421) [-1007.372] (-1009.056) * (-1009.564) [-1007.327] (-1007.342) (-1009.211) -- 0:00:53 69500 -- [-1008.668] (-1008.026) (-1011.226) (-1009.195) * (-1012.202) (-1009.316) [-1007.376] (-1009.444) -- 0:00:53 70000 -- (-1012.286) (-1007.132) [-1010.128] (-1007.293) * (-1015.857) (-1008.862) (-1008.281) [-1007.293] -- 0:00:53 Average standard deviation of split frequencies: 0.025683 70500 -- (-1013.131) (-1008.683) (-1010.409) [-1010.735] * (-1007.879) (-1008.523) [-1007.821] (-1007.685) -- 0:00:52 71000 -- (-1009.706) (-1008.290) [-1009.712] (-1009.849) * (-1010.094) (-1008.831) (-1007.489) [-1007.823] -- 0:00:52 71500 -- (-1011.546) [-1008.288] (-1008.643) (-1012.118) * (-1009.863) [-1010.265] (-1008.203) (-1008.102) -- 0:00:51 72000 -- [-1011.026] (-1007.975) (-1012.981) (-1010.269) * (-1010.435) (-1012.016) (-1008.672) [-1009.435] -- 0:00:51 72500 -- [-1007.965] (-1011.651) (-1008.496) (-1009.713) * (-1008.319) (-1012.171) (-1006.826) [-1009.292] -- 0:00:51 73000 -- (-1008.193) (-1008.991) (-1008.981) [-1008.234] * (-1007.590) [-1011.642] (-1009.868) (-1008.556) -- 0:00:50 73500 -- (-1007.505) (-1011.028) (-1007.500) [-1007.251] * (-1009.628) [-1009.991] (-1008.596) (-1009.872) -- 0:01:03 74000 -- (-1010.656) (-1008.774) [-1007.529] (-1006.721) * (-1012.622) (-1007.577) (-1007.879) [-1008.940] -- 0:01:02 74500 -- (-1011.011) (-1008.706) [-1008.451] (-1007.429) * [-1008.279] (-1007.451) (-1016.922) (-1010.029) -- 0:01:02 75000 -- [-1008.174] (-1006.860) (-1009.260) (-1007.563) * (-1008.056) [-1008.121] (-1015.839) (-1010.811) -- 0:01:01 Average standard deviation of split frequencies: 0.026770 75500 -- [-1011.326] (-1006.990) (-1008.726) (-1007.996) * [-1008.230] (-1007.653) (-1014.426) (-1013.309) -- 0:01:01 76000 -- (-1010.740) (-1008.020) (-1009.229) [-1014.613] * (-1009.136) (-1006.941) (-1009.508) [-1011.320] -- 0:01:00 76500 -- (-1009.113) (-1009.877) [-1008.090] (-1010.186) * (-1010.087) [-1007.896] (-1010.385) (-1010.259) -- 0:01:00 77000 -- (-1009.699) [-1007.104] (-1008.538) (-1012.082) * (-1010.119) (-1010.827) [-1010.940] (-1009.450) -- 0:00:59 77500 -- (-1008.250) [-1007.653] (-1009.802) (-1012.326) * [-1010.830] (-1010.563) (-1009.259) (-1008.878) -- 0:00:59 78000 -- [-1009.437] (-1008.295) (-1008.007) (-1009.477) * (-1010.040) [-1008.881] (-1010.415) (-1008.966) -- 0:00:59 78500 -- (-1011.169) (-1008.754) (-1007.592) [-1010.547] * [-1010.697] (-1015.029) (-1010.332) (-1010.778) -- 0:00:58 79000 -- [-1009.973] (-1009.827) (-1011.801) (-1009.543) * (-1008.748) (-1012.013) [-1012.330] (-1008.777) -- 0:00:58 79500 -- (-1015.240) [-1008.107] (-1008.511) (-1010.768) * (-1008.205) [-1006.799] (-1010.311) (-1011.402) -- 0:00:57 80000 -- (-1011.445) [-1008.534] (-1010.073) (-1015.462) * [-1008.103] (-1007.017) (-1011.868) (-1011.468) -- 0:00:57 Average standard deviation of split frequencies: 0.024674 80500 -- (-1010.644) (-1008.179) [-1007.204] (-1010.602) * (-1008.648) (-1008.084) [-1007.625] (-1010.084) -- 0:00:57 81000 -- [-1006.858] (-1007.809) (-1009.132) (-1017.190) * (-1011.060) (-1007.267) (-1010.677) [-1008.580] -- 0:00:56 81500 -- (-1008.807) (-1008.335) [-1007.647] (-1011.137) * [-1010.591] (-1009.321) (-1010.333) (-1010.241) -- 0:00:56 82000 -- [-1008.327] (-1011.389) (-1009.810) (-1009.913) * [-1007.420] (-1007.414) (-1008.753) (-1014.382) -- 0:00:55 82500 -- (-1008.326) (-1012.604) [-1009.248] (-1008.273) * [-1009.012] (-1012.665) (-1007.946) (-1009.925) -- 0:00:55 83000 -- (-1006.594) (-1008.334) (-1008.110) [-1007.857] * (-1008.166) [-1008.312] (-1007.334) (-1008.324) -- 0:00:55 83500 -- [-1006.646] (-1009.793) (-1008.669) (-1007.761) * (-1013.957) [-1007.879] (-1008.170) (-1010.916) -- 0:00:54 84000 -- (-1006.915) (-1009.118) (-1011.340) [-1009.170] * (-1009.418) (-1009.627) [-1010.797] (-1011.310) -- 0:00:54 84500 -- (-1006.688) [-1007.130] (-1011.616) (-1009.762) * (-1010.333) (-1009.285) [-1010.058] (-1010.030) -- 0:00:54 85000 -- (-1008.264) (-1007.028) (-1009.215) [-1009.371] * [-1009.637] (-1011.098) (-1010.890) (-1008.712) -- 0:00:53 Average standard deviation of split frequencies: 0.023753 85500 -- (-1007.526) [-1007.896] (-1007.873) (-1010.550) * (-1008.672) (-1007.455) [-1008.496] (-1013.071) -- 0:00:53 86000 -- (-1008.242) (-1011.145) [-1008.302] (-1006.531) * [-1009.794] (-1011.661) (-1006.770) (-1011.536) -- 0:00:53 86500 -- (-1010.021) (-1013.695) [-1007.902] (-1006.479) * [-1008.772] (-1009.254) (-1008.902) (-1008.548) -- 0:00:52 87000 -- (-1008.281) (-1010.391) [-1008.226] (-1006.572) * (-1009.754) (-1012.946) (-1013.637) [-1007.580] -- 0:00:52 87500 -- (-1008.746) (-1009.925) [-1008.288] (-1008.286) * (-1007.840) (-1011.012) [-1010.803] (-1009.300) -- 0:00:52 88000 -- [-1008.160] (-1008.909) (-1010.438) (-1009.926) * [-1009.194] (-1008.837) (-1012.833) (-1008.410) -- 0:00:51 88500 -- (-1008.185) (-1008.489) [-1010.419] (-1006.913) * [-1009.260] (-1008.309) (-1009.912) (-1008.367) -- 0:00:51 89000 -- (-1007.022) [-1008.035] (-1007.081) (-1013.393) * (-1011.073) (-1010.266) [-1012.633] (-1007.157) -- 0:00:51 89500 -- (-1007.204) (-1007.684) [-1009.408] (-1007.946) * (-1010.390) (-1009.578) (-1016.191) [-1006.670] -- 0:00:50 90000 -- [-1008.441] (-1008.623) (-1007.163) (-1008.987) * (-1009.209) (-1010.244) (-1010.563) [-1007.211] -- 0:01:00 Average standard deviation of split frequencies: 0.027441 90500 -- (-1012.771) (-1008.340) (-1009.106) [-1007.660] * (-1007.202) (-1008.456) (-1013.185) [-1006.859] -- 0:01:00 91000 -- [-1008.543] (-1008.060) (-1007.792) (-1008.009) * (-1011.268) (-1006.567) [-1010.964] (-1006.995) -- 0:00:59 91500 -- (-1009.283) (-1008.060) [-1008.660] (-1007.896) * (-1008.629) (-1007.307) (-1009.500) [-1007.451] -- 0:00:59 92000 -- (-1006.813) (-1008.305) [-1006.959] (-1013.293) * (-1010.481) [-1008.642] (-1009.584) (-1007.190) -- 0:00:59 92500 -- [-1006.733] (-1009.166) (-1009.649) (-1011.744) * (-1008.453) [-1008.457] (-1010.294) (-1007.776) -- 0:00:58 93000 -- [-1007.900] (-1007.728) (-1007.988) (-1008.152) * [-1008.019] (-1008.415) (-1011.456) (-1008.867) -- 0:00:58 93500 -- [-1007.774] (-1008.949) (-1011.414) (-1008.838) * (-1008.033) [-1007.495] (-1011.604) (-1011.475) -- 0:00:58 94000 -- (-1009.858) [-1007.444] (-1012.298) (-1009.691) * (-1008.640) [-1008.982] (-1010.621) (-1012.436) -- 0:00:57 94500 -- [-1008.221] (-1009.432) (-1008.192) (-1012.943) * (-1008.256) [-1007.579] (-1011.199) (-1011.872) -- 0:00:57 95000 -- (-1009.124) (-1012.234) [-1010.429] (-1013.893) * [-1009.769] (-1009.157) (-1010.272) (-1010.170) -- 0:00:57 Average standard deviation of split frequencies: 0.026574 95500 -- (-1009.114) [-1009.416] (-1009.856) (-1011.850) * (-1007.881) [-1008.500] (-1009.759) (-1010.337) -- 0:00:56 96000 -- (-1007.821) (-1009.334) [-1007.469] (-1013.932) * (-1008.501) (-1008.046) (-1008.645) [-1009.841] -- 0:00:56 96500 -- [-1007.827] (-1009.579) (-1007.858) (-1013.302) * (-1007.627) [-1007.884] (-1008.753) (-1013.647) -- 0:00:56 97000 -- (-1008.244) [-1008.582] (-1012.557) (-1012.915) * (-1007.679) (-1008.134) (-1009.149) [-1010.643] -- 0:00:55 97500 -- (-1006.840) [-1007.862] (-1011.093) (-1010.702) * (-1010.180) [-1009.010] (-1010.120) (-1009.362) -- 0:00:55 98000 -- (-1007.501) (-1012.188) [-1008.476] (-1012.045) * (-1009.794) [-1008.820] (-1008.347) (-1008.949) -- 0:00:55 98500 -- [-1008.433] (-1007.598) (-1008.306) (-1009.806) * [-1007.444] (-1008.585) (-1008.748) (-1008.318) -- 0:00:54 99000 -- (-1012.716) (-1009.320) (-1008.762) [-1010.197] * (-1011.883) (-1007.661) (-1009.489) [-1009.304] -- 0:00:54 99500 -- [-1009.261] (-1009.376) (-1008.133) (-1011.514) * (-1009.440) (-1009.188) (-1006.798) [-1010.489] -- 0:00:54 100000 -- (-1007.686) (-1013.489) [-1007.448] (-1011.897) * [-1007.098] (-1010.221) (-1007.674) (-1010.750) -- 0:00:54 Average standard deviation of split frequencies: 0.027577 100500 -- [-1009.561] (-1009.157) (-1012.562) (-1009.425) * (-1007.596) (-1007.300) (-1006.962) [-1008.937] -- 0:00:53 101000 -- (-1007.405) (-1008.338) [-1007.745] (-1011.669) * [-1007.812] (-1008.678) (-1009.782) (-1011.380) -- 0:00:53 101500 -- [-1007.877] (-1010.991) (-1010.121) (-1009.676) * (-1007.518) [-1007.992] (-1008.536) (-1010.545) -- 0:00:53 102000 -- (-1009.923) [-1009.729] (-1013.381) (-1011.123) * (-1008.247) [-1009.697] (-1008.900) (-1010.285) -- 0:00:52 102500 -- [-1009.664] (-1011.074) (-1009.662) (-1009.370) * (-1009.051) (-1007.897) [-1008.090] (-1009.392) -- 0:00:52 103000 -- (-1011.038) [-1007.960] (-1009.229) (-1008.370) * (-1006.886) (-1007.803) [-1007.171] (-1008.557) -- 0:00:52 103500 -- (-1011.068) (-1008.298) [-1010.588] (-1010.219) * (-1007.935) [-1007.590] (-1007.261) (-1009.668) -- 0:00:51 104000 -- (-1010.661) (-1009.948) (-1008.087) [-1008.028] * (-1007.382) [-1009.080] (-1007.767) (-1017.825) -- 0:00:51 104500 -- (-1007.637) [-1007.156] (-1007.549) (-1008.848) * (-1008.041) (-1010.706) [-1007.069] (-1013.503) -- 0:00:51 105000 -- (-1009.085) [-1008.599] (-1008.118) (-1009.743) * (-1008.835) (-1007.836) (-1007.338) [-1008.907] -- 0:00:51 Average standard deviation of split frequencies: 0.026449 105500 -- (-1007.560) [-1008.579] (-1007.514) (-1010.331) * [-1008.453] (-1012.244) (-1008.384) (-1009.269) -- 0:00:50 106000 -- (-1009.129) [-1008.949] (-1010.510) (-1011.308) * [-1010.887] (-1010.586) (-1009.081) (-1008.882) -- 0:00:59 106500 -- (-1008.370) (-1008.029) (-1011.708) [-1011.997] * (-1009.422) [-1009.820] (-1008.038) (-1010.081) -- 0:00:58 107000 -- (-1009.140) [-1007.595] (-1009.394) (-1010.515) * [-1009.047] (-1008.268) (-1010.039) (-1007.952) -- 0:00:58 107500 -- [-1007.798] (-1011.475) (-1013.575) (-1008.206) * (-1009.949) (-1008.450) [-1009.172] (-1009.854) -- 0:00:58 108000 -- (-1006.688) (-1011.964) (-1007.489) [-1008.588] * (-1009.612) (-1006.608) (-1011.224) [-1009.578] -- 0:00:57 108500 -- [-1006.597] (-1011.770) (-1008.170) (-1008.528) * (-1007.967) [-1009.252] (-1011.313) (-1011.162) -- 0:00:57 109000 -- (-1008.892) (-1009.420) [-1009.181] (-1011.480) * [-1011.416] (-1009.740) (-1007.832) (-1010.015) -- 0:00:57 109500 -- (-1008.698) [-1010.611] (-1010.036) (-1009.200) * [-1008.985] (-1012.460) (-1010.329) (-1009.807) -- 0:00:56 110000 -- [-1009.920] (-1008.501) (-1009.734) (-1009.631) * (-1011.043) [-1008.986] (-1013.439) (-1010.651) -- 0:00:56 Average standard deviation of split frequencies: 0.026679 110500 -- (-1015.006) (-1009.085) (-1012.632) [-1009.288] * (-1009.361) [-1010.175] (-1008.978) (-1013.596) -- 0:00:56 111000 -- [-1009.427] (-1009.814) (-1014.859) (-1009.878) * (-1008.386) (-1010.121) [-1009.883] (-1008.204) -- 0:00:56 111500 -- (-1007.574) (-1007.964) (-1009.353) [-1007.368] * (-1011.186) [-1007.115] (-1009.014) (-1008.210) -- 0:00:55 112000 -- [-1008.145] (-1007.557) (-1009.838) (-1007.196) * [-1012.053] (-1009.621) (-1012.566) (-1009.299) -- 0:00:55 112500 -- (-1013.362) (-1006.821) [-1007.917] (-1009.941) * (-1010.086) [-1006.961] (-1008.470) (-1008.775) -- 0:00:55 113000 -- (-1008.187) (-1011.496) [-1007.010] (-1017.727) * (-1010.106) (-1009.642) [-1007.875] (-1010.428) -- 0:00:54 113500 -- (-1007.694) [-1008.369] (-1011.110) (-1009.052) * (-1009.903) [-1010.363] (-1012.597) (-1009.896) -- 0:00:54 114000 -- (-1012.451) (-1010.047) [-1008.293] (-1009.519) * (-1008.425) [-1008.296] (-1014.030) (-1008.827) -- 0:00:54 114500 -- [-1007.534] (-1008.147) (-1008.409) (-1010.956) * (-1006.983) [-1007.040] (-1008.065) (-1010.306) -- 0:00:54 115000 -- [-1008.927] (-1008.600) (-1011.657) (-1007.899) * (-1006.972) [-1008.645] (-1010.201) (-1014.028) -- 0:00:53 Average standard deviation of split frequencies: 0.025060 115500 -- (-1010.375) (-1009.475) (-1008.111) [-1009.560] * [-1007.288] (-1010.337) (-1009.163) (-1009.327) -- 0:00:53 116000 -- (-1011.109) [-1009.067] (-1009.523) (-1009.741) * (-1007.661) (-1007.708) (-1008.270) [-1007.676] -- 0:00:53 116500 -- (-1011.840) (-1010.294) [-1010.253] (-1010.143) * (-1007.360) (-1007.951) [-1007.400] (-1008.334) -- 0:00:53 117000 -- (-1008.808) (-1010.350) [-1008.474] (-1010.437) * [-1009.597] (-1008.131) (-1009.515) (-1010.897) -- 0:00:52 117500 -- [-1008.301] (-1007.420) (-1009.756) (-1008.469) * [-1006.858] (-1008.407) (-1008.845) (-1010.810) -- 0:00:52 118000 -- (-1008.442) [-1007.465] (-1008.271) (-1010.894) * (-1007.416) (-1011.267) (-1009.288) [-1009.093] -- 0:00:52 118500 -- (-1013.316) (-1007.867) [-1009.770] (-1009.731) * [-1007.606] (-1014.559) (-1008.909) (-1008.156) -- 0:00:52 119000 -- (-1010.251) (-1009.754) (-1010.274) [-1009.968] * (-1011.344) (-1007.902) [-1009.298] (-1010.460) -- 0:00:51 119500 -- (-1009.011) [-1012.318] (-1010.112) (-1011.747) * (-1012.366) (-1006.690) [-1007.211] (-1007.754) -- 0:00:51 120000 -- (-1008.607) (-1010.262) [-1007.895] (-1008.783) * [-1009.629] (-1008.330) (-1008.253) (-1011.242) -- 0:00:51 Average standard deviation of split frequencies: 0.023440 120500 -- (-1008.481) (-1009.832) [-1007.329] (-1008.889) * [-1007.911] (-1008.531) (-1011.318) (-1006.957) -- 0:00:51 121000 -- [-1008.964] (-1011.362) (-1006.541) (-1009.188) * (-1010.618) (-1007.727) [-1008.028] (-1009.402) -- 0:00:50 121500 -- (-1007.631) (-1009.584) [-1006.821] (-1009.557) * (-1008.768) (-1012.600) [-1009.764] (-1008.088) -- 0:00:50 122000 -- (-1009.111) (-1008.058) (-1007.364) [-1009.924] * (-1008.607) [-1014.618] (-1010.185) (-1007.862) -- 0:00:57 122500 -- (-1012.031) [-1009.219] (-1008.673) (-1008.569) * (-1008.866) (-1013.112) (-1013.347) [-1007.798] -- 0:00:57 123000 -- (-1010.187) [-1010.511] (-1008.781) (-1008.517) * (-1009.262) (-1008.887) (-1013.581) [-1008.118] -- 0:00:57 123500 -- (-1009.830) (-1010.851) [-1007.557] (-1009.430) * (-1008.766) [-1008.462] (-1011.068) (-1010.178) -- 0:00:56 124000 -- (-1010.052) (-1009.533) [-1008.282] (-1010.351) * [-1009.720] (-1008.638) (-1010.652) (-1007.632) -- 0:00:56 124500 -- (-1011.308) [-1007.431] (-1009.102) (-1013.049) * [-1012.685] (-1009.544) (-1007.395) (-1007.327) -- 0:00:56 125000 -- (-1012.605) (-1009.171) (-1010.295) [-1007.366] * (-1009.924) (-1012.014) (-1010.263) [-1008.571] -- 0:00:56 Average standard deviation of split frequencies: 0.023768 125500 -- (-1009.114) [-1008.114] (-1007.761) (-1009.964) * (-1008.825) (-1016.345) (-1009.553) [-1008.150] -- 0:00:55 126000 -- [-1008.817] (-1007.728) (-1012.274) (-1010.247) * (-1011.249) [-1008.561] (-1008.745) (-1006.862) -- 0:00:55 126500 -- (-1011.093) (-1006.916) [-1011.096] (-1009.608) * (-1008.616) (-1006.994) [-1008.968] (-1012.489) -- 0:00:55 127000 -- [-1008.915] (-1008.405) (-1009.744) (-1008.441) * (-1011.148) [-1008.398] (-1007.247) (-1013.799) -- 0:00:54 127500 -- (-1008.915) [-1008.374] (-1009.341) (-1010.967) * [-1008.582] (-1008.865) (-1007.276) (-1008.945) -- 0:00:54 128000 -- (-1007.484) [-1009.129] (-1007.385) (-1010.113) * (-1010.280) (-1007.695) [-1011.031] (-1007.396) -- 0:00:54 128500 -- [-1010.335] (-1007.534) (-1008.228) (-1009.900) * [-1007.306] (-1007.532) (-1017.832) (-1007.832) -- 0:00:54 129000 -- [-1008.834] (-1007.921) (-1008.660) (-1010.040) * (-1007.357) (-1008.484) (-1009.260) [-1009.440] -- 0:00:54 129500 -- (-1006.947) [-1007.471] (-1009.484) (-1013.317) * (-1016.228) (-1007.751) [-1007.217] (-1010.453) -- 0:00:53 130000 -- (-1007.120) (-1012.910) (-1008.425) [-1009.944] * (-1009.918) (-1008.472) [-1007.897] (-1010.315) -- 0:00:53 Average standard deviation of split frequencies: 0.026739 130500 -- (-1007.163) (-1009.919) (-1008.090) [-1011.010] * [-1008.463] (-1008.532) (-1008.606) (-1006.848) -- 0:00:53 131000 -- (-1007.306) (-1012.934) (-1008.079) [-1008.445] * [-1008.402] (-1008.723) (-1009.275) (-1006.889) -- 0:00:53 131500 -- (-1011.652) (-1010.048) (-1013.277) [-1007.715] * (-1008.342) [-1011.013] (-1007.056) (-1006.697) -- 0:00:52 132000 -- (-1008.686) (-1009.064) (-1009.380) [-1008.394] * (-1008.471) (-1010.426) (-1009.059) [-1011.063] -- 0:00:52 132500 -- (-1013.745) (-1013.455) (-1009.372) [-1008.514] * (-1008.174) (-1009.359) (-1007.509) [-1009.991] -- 0:00:52 133000 -- (-1011.538) [-1014.810] (-1009.175) (-1007.682) * [-1008.317] (-1008.110) (-1006.943) (-1008.323) -- 0:00:52 133500 -- (-1008.739) (-1011.990) (-1009.467) [-1006.714] * [-1007.989] (-1009.923) (-1007.465) (-1008.196) -- 0:00:51 134000 -- [-1007.216] (-1008.935) (-1013.677) (-1007.260) * (-1007.586) [-1007.781] (-1008.635) (-1008.865) -- 0:00:51 134500 -- (-1009.826) [-1007.816] (-1009.164) (-1007.747) * (-1007.899) [-1009.027] (-1009.358) (-1007.000) -- 0:00:51 135000 -- [-1010.356] (-1008.554) (-1008.991) (-1008.062) * (-1011.437) (-1009.451) (-1009.956) [-1011.372] -- 0:00:51 Average standard deviation of split frequencies: 0.025804 135500 -- (-1009.925) (-1009.226) [-1010.163] (-1008.319) * (-1008.492) (-1007.261) [-1014.103] (-1010.828) -- 0:00:51 136000 -- [-1008.998] (-1006.809) (-1011.450) (-1010.733) * (-1010.004) [-1010.217] (-1008.429) (-1009.350) -- 0:00:50 136500 -- [-1009.812] (-1008.436) (-1012.922) (-1008.827) * [-1008.801] (-1007.986) (-1010.086) (-1008.589) -- 0:00:50 137000 -- [-1008.313] (-1009.044) (-1009.781) (-1009.949) * (-1009.097) (-1007.489) (-1007.557) [-1009.498] -- 0:00:50 137500 -- (-1009.533) (-1008.778) (-1009.473) [-1009.624] * [-1008.195] (-1006.994) (-1012.875) (-1008.110) -- 0:00:50 138000 -- (-1011.113) (-1009.211) (-1009.708) [-1010.755] * [-1007.124] (-1009.397) (-1008.226) (-1007.830) -- 0:00:49 138500 -- (-1013.520) (-1007.889) [-1007.791] (-1010.390) * [-1007.609] (-1009.472) (-1008.348) (-1009.558) -- 0:00:55 139000 -- (-1008.016) [-1009.262] (-1010.246) (-1008.645) * (-1007.711) [-1008.086] (-1010.750) (-1008.610) -- 0:00:55 139500 -- (-1008.388) (-1012.313) (-1008.381) [-1007.101] * (-1010.615) [-1010.760] (-1010.531) (-1007.459) -- 0:00:55 140000 -- [-1007.911] (-1007.417) (-1009.817) (-1011.620) * (-1011.327) (-1007.975) (-1008.740) [-1007.530] -- 0:00:55 Average standard deviation of split frequencies: 0.024948 140500 -- (-1007.886) [-1010.495] (-1008.365) (-1006.900) * (-1009.962) [-1007.339] (-1008.365) (-1007.023) -- 0:00:55 141000 -- (-1007.791) (-1008.381) (-1007.149) [-1010.479] * (-1008.825) (-1007.715) [-1009.376] (-1007.091) -- 0:00:54 141500 -- (-1010.541) [-1008.635] (-1007.852) (-1008.381) * (-1013.551) [-1009.151] (-1008.039) (-1007.788) -- 0:00:54 142000 -- (-1007.903) (-1007.633) (-1007.893) [-1007.288] * (-1013.250) (-1009.395) (-1009.571) [-1007.286] -- 0:00:54 142500 -- (-1010.208) (-1008.777) [-1006.866] (-1011.276) * (-1010.369) (-1009.627) [-1011.366] (-1009.222) -- 0:00:54 143000 -- (-1012.933) (-1007.252) [-1007.323] (-1009.927) * (-1014.645) (-1010.026) [-1009.233] (-1009.774) -- 0:00:53 143500 -- [-1007.038] (-1013.093) (-1007.797) (-1008.495) * [-1011.520] (-1013.279) (-1009.984) (-1010.417) -- 0:00:53 144000 -- (-1008.057) (-1007.242) [-1007.795] (-1009.879) * (-1008.619) [-1008.603] (-1008.707) (-1011.401) -- 0:00:53 144500 -- [-1007.568] (-1010.721) (-1008.399) (-1008.671) * (-1012.050) (-1006.969) [-1010.465] (-1010.633) -- 0:00:53 145000 -- (-1008.998) [-1009.347] (-1010.775) (-1009.161) * (-1012.809) (-1007.750) (-1009.356) [-1010.604] -- 0:00:53 Average standard deviation of split frequencies: 0.022763 145500 -- [-1009.544] (-1007.718) (-1012.414) (-1008.670) * (-1017.514) [-1008.302] (-1010.846) (-1009.708) -- 0:00:52 146000 -- (-1010.847) [-1011.134] (-1012.812) (-1010.416) * [-1007.547] (-1007.350) (-1013.554) (-1010.282) -- 0:00:52 146500 -- (-1009.369) (-1009.234) (-1010.898) [-1009.396] * (-1006.898) [-1007.784] (-1011.718) (-1008.251) -- 0:00:52 147000 -- (-1007.076) (-1007.724) (-1009.399) [-1008.724] * [-1007.633] (-1013.441) (-1008.496) (-1008.951) -- 0:00:52 147500 -- (-1007.368) [-1008.052] (-1007.451) (-1006.670) * [-1007.851] (-1015.917) (-1008.254) (-1008.499) -- 0:00:52 148000 -- [-1007.748] (-1012.942) (-1012.560) (-1008.002) * [-1008.403] (-1008.552) (-1008.495) (-1008.134) -- 0:00:51 148500 -- (-1008.873) (-1009.800) [-1007.773] (-1010.245) * (-1008.768) (-1011.996) [-1009.042] (-1007.716) -- 0:00:51 149000 -- (-1008.669) [-1008.752] (-1008.240) (-1010.358) * [-1007.423] (-1006.825) (-1008.241) (-1009.383) -- 0:00:51 149500 -- [-1006.734] (-1009.498) (-1010.314) (-1013.786) * (-1010.193) (-1007.314) [-1009.958] (-1011.908) -- 0:00:51 150000 -- (-1007.933) (-1010.991) [-1009.715] (-1007.564) * [-1008.510] (-1007.811) (-1012.618) (-1008.354) -- 0:00:51 Average standard deviation of split frequencies: 0.022058 150500 -- (-1009.760) (-1015.466) [-1009.450] (-1006.945) * (-1007.653) (-1007.888) [-1010.152] (-1008.299) -- 0:00:50 151000 -- (-1008.361) (-1009.565) [-1009.567] (-1007.319) * (-1008.896) (-1008.102) [-1010.885] (-1008.417) -- 0:00:50 151500 -- (-1007.988) [-1008.396] (-1009.169) (-1007.316) * (-1010.477) [-1007.206] (-1008.423) (-1007.935) -- 0:00:50 152000 -- (-1008.134) (-1008.115) (-1010.572) [-1008.749] * (-1010.477) (-1009.160) [-1007.389] (-1009.173) -- 0:00:50 152500 -- (-1008.777) (-1008.583) [-1010.073] (-1009.603) * (-1010.515) (-1012.911) [-1007.421] (-1007.527) -- 0:00:50 153000 -- (-1009.599) (-1009.661) (-1009.041) [-1009.682] * (-1011.628) (-1012.906) (-1007.039) [-1007.759] -- 0:00:49 153500 -- (-1006.820) (-1008.168) [-1006.930] (-1008.434) * (-1008.478) (-1009.671) (-1007.638) [-1007.643] -- 0:00:49 154000 -- [-1007.081] (-1008.089) (-1007.897) (-1013.334) * [-1008.368] (-1010.692) (-1007.715) (-1007.257) -- 0:00:49 154500 -- [-1009.782] (-1007.604) (-1009.188) (-1012.229) * (-1007.875) (-1008.793) [-1008.095] (-1007.257) -- 0:00:49 155000 -- [-1008.889] (-1010.575) (-1008.051) (-1011.585) * (-1016.128) (-1008.442) (-1010.121) [-1009.686] -- 0:00:54 Average standard deviation of split frequencies: 0.022210 155500 -- [-1008.847] (-1006.682) (-1009.150) (-1010.936) * (-1008.389) [-1013.036] (-1008.242) (-1011.083) -- 0:00:54 156000 -- (-1011.399) [-1009.367] (-1009.143) (-1009.414) * (-1008.586) (-1008.458) [-1007.949] (-1008.027) -- 0:00:54 156500 -- [-1008.276] (-1008.590) (-1007.822) (-1010.243) * (-1010.409) (-1012.134) (-1011.081) [-1008.716] -- 0:00:53 157000 -- (-1008.870) (-1009.325) [-1007.798] (-1008.738) * [-1006.682] (-1009.056) (-1010.455) (-1008.436) -- 0:00:53 157500 -- (-1007.644) (-1007.425) (-1007.626) [-1008.790] * (-1006.577) (-1009.145) [-1007.636] (-1008.769) -- 0:00:53 158000 -- (-1009.696) (-1008.333) (-1008.745) [-1008.152] * (-1007.017) [-1008.159] (-1014.887) (-1011.890) -- 0:00:53 158500 -- (-1009.538) (-1009.031) (-1007.187) [-1007.806] * [-1008.407] (-1013.550) (-1009.124) (-1008.467) -- 0:00:53 159000 -- [-1008.326] (-1008.414) (-1008.896) (-1010.128) * (-1007.828) (-1009.446) (-1011.623) [-1008.780] -- 0:00:52 159500 -- (-1008.690) (-1008.373) (-1008.392) [-1008.787] * (-1010.212) (-1009.098) [-1012.941] (-1007.903) -- 0:00:52 160000 -- (-1011.748) (-1007.872) [-1007.067] (-1009.047) * (-1009.570) (-1010.352) [-1013.694] (-1007.946) -- 0:00:52 Average standard deviation of split frequencies: 0.019612 160500 -- (-1009.015) [-1008.360] (-1007.612) (-1008.703) * (-1010.537) [-1009.284] (-1007.426) (-1009.380) -- 0:00:52 161000 -- [-1010.068] (-1008.966) (-1007.435) (-1010.212) * (-1007.500) (-1009.001) [-1010.933] (-1011.869) -- 0:00:52 161500 -- [-1007.546] (-1008.509) (-1007.461) (-1010.414) * [-1008.683] (-1008.224) (-1007.552) (-1012.176) -- 0:00:51 162000 -- (-1010.209) (-1007.449) (-1008.941) [-1007.086] * (-1012.564) (-1010.152) [-1007.539] (-1008.914) -- 0:00:51 162500 -- (-1014.642) [-1008.148] (-1009.215) (-1007.700) * [-1011.156] (-1008.246) (-1008.537) (-1008.369) -- 0:00:51 163000 -- (-1017.493) (-1006.735) [-1007.753] (-1007.594) * (-1011.942) (-1007.838) [-1008.702] (-1008.931) -- 0:00:51 163500 -- [-1010.865] (-1009.465) (-1006.920) (-1007.562) * (-1007.890) (-1007.215) [-1009.695] (-1007.988) -- 0:00:51 164000 -- [-1008.382] (-1011.060) (-1013.896) (-1007.196) * (-1007.641) [-1010.384] (-1008.075) (-1010.605) -- 0:00:50 164500 -- [-1013.401] (-1006.958) (-1010.078) (-1008.118) * (-1009.678) (-1010.422) [-1007.567] (-1009.833) -- 0:00:50 165000 -- (-1013.251) (-1008.102) (-1006.827) [-1008.357] * (-1006.966) (-1007.267) (-1007.547) [-1010.012] -- 0:00:50 Average standard deviation of split frequencies: 0.018885 165500 -- [-1009.016] (-1008.674) (-1009.276) (-1008.284) * (-1006.731) (-1007.704) [-1007.347] (-1010.626) -- 0:00:50 166000 -- (-1010.288) (-1008.442) [-1006.808] (-1009.574) * (-1008.800) (-1007.512) (-1007.656) [-1011.982] -- 0:00:50 166500 -- (-1009.974) (-1008.565) [-1006.732] (-1008.514) * (-1011.547) (-1007.703) (-1006.741) [-1009.579] -- 0:00:50 167000 -- (-1009.217) [-1008.507] (-1006.648) (-1008.455) * (-1009.618) (-1014.467) [-1008.813] (-1009.239) -- 0:00:49 167500 -- (-1016.153) (-1009.284) (-1010.791) [-1007.993] * [-1007.027] (-1007.770) (-1008.278) (-1009.839) -- 0:00:49 168000 -- (-1011.393) (-1011.590) [-1006.580] (-1008.051) * (-1008.458) [-1007.491] (-1009.659) (-1006.920) -- 0:00:49 168500 -- (-1009.972) [-1010.320] (-1007.326) (-1007.718) * [-1008.051] (-1016.383) (-1008.951) (-1007.330) -- 0:00:49 169000 -- (-1010.626) (-1014.831) [-1010.039] (-1007.445) * [-1008.246] (-1014.452) (-1009.712) (-1007.689) -- 0:00:49 169500 -- [-1009.354] (-1012.867) (-1007.525) (-1007.504) * (-1008.383) (-1010.020) [-1010.559] (-1007.896) -- 0:00:48 170000 -- (-1013.030) [-1009.858] (-1009.904) (-1007.183) * [-1008.434] (-1007.276) (-1015.356) (-1013.600) -- 0:00:48 Average standard deviation of split frequencies: 0.016987 170500 -- (-1007.404) (-1010.765) [-1008.448] (-1008.644) * (-1009.462) [-1008.094] (-1011.131) (-1012.767) -- 0:00:48 171000 -- (-1008.441) [-1009.166] (-1009.347) (-1008.066) * (-1010.650) (-1009.467) (-1011.756) [-1009.687] -- 0:00:53 171500 -- (-1008.422) (-1010.544) [-1008.066] (-1007.763) * [-1008.488] (-1009.464) (-1008.197) (-1011.935) -- 0:00:53 172000 -- [-1008.388] (-1007.389) (-1006.880) (-1006.861) * [-1010.109] (-1008.497) (-1010.191) (-1014.332) -- 0:00:52 172500 -- (-1007.696) (-1011.160) [-1009.001] (-1008.766) * (-1008.418) (-1014.660) [-1007.952] (-1008.810) -- 0:00:52 173000 -- [-1007.945] (-1009.391) (-1008.269) (-1007.556) * (-1008.118) [-1007.810] (-1008.112) (-1008.970) -- 0:00:52 173500 -- (-1008.566) (-1008.799) (-1007.150) [-1009.543] * (-1012.289) (-1009.093) [-1008.812] (-1008.921) -- 0:00:52 174000 -- [-1007.577] (-1007.995) (-1009.457) (-1011.629) * (-1011.342) [-1006.802] (-1008.806) (-1009.798) -- 0:00:52 174500 -- (-1007.689) [-1009.219] (-1008.209) (-1007.610) * (-1009.549) [-1006.772] (-1011.888) (-1007.777) -- 0:00:52 175000 -- (-1007.453) (-1012.137) (-1007.566) [-1012.212] * [-1012.549] (-1008.142) (-1013.508) (-1007.777) -- 0:00:51 Average standard deviation of split frequencies: 0.016634 175500 -- (-1006.970) (-1009.891) (-1007.753) [-1007.980] * (-1008.600) (-1010.424) [-1008.000] (-1007.484) -- 0:00:51 176000 -- (-1007.677) (-1009.316) [-1007.771] (-1009.621) * (-1008.514) (-1007.952) [-1009.595] (-1011.186) -- 0:00:51 176500 -- [-1007.487] (-1009.058) (-1007.771) (-1007.015) * [-1008.414] (-1008.734) (-1007.528) (-1010.819) -- 0:00:51 177000 -- (-1012.620) [-1009.645] (-1008.410) (-1010.801) * [-1009.212] (-1007.596) (-1008.554) (-1014.948) -- 0:00:51 177500 -- [-1012.735] (-1008.031) (-1008.101) (-1006.784) * (-1010.182) [-1007.585] (-1009.051) (-1010.518) -- 0:00:50 178000 -- (-1008.962) (-1007.596) (-1008.121) [-1007.952] * (-1010.104) (-1009.264) [-1009.221] (-1011.726) -- 0:00:50 178500 -- (-1011.548) (-1011.063) (-1008.994) [-1011.375] * (-1007.553) (-1009.764) [-1008.446] (-1008.946) -- 0:00:50 179000 -- (-1008.489) (-1009.035) [-1010.132] (-1009.987) * [-1010.491] (-1009.257) (-1008.017) (-1009.218) -- 0:00:50 179500 -- (-1009.665) (-1007.311) [-1011.996] (-1008.627) * (-1007.964) [-1007.674] (-1007.427) (-1008.863) -- 0:00:50 180000 -- (-1007.410) [-1008.853] (-1010.791) (-1008.890) * [-1008.106] (-1007.003) (-1012.643) (-1007.760) -- 0:00:50 Average standard deviation of split frequencies: 0.016235 180500 -- [-1009.462] (-1012.215) (-1008.051) (-1007.613) * (-1010.745) (-1006.985) [-1008.277] (-1008.686) -- 0:00:49 181000 -- [-1008.224] (-1007.217) (-1009.817) (-1007.808) * (-1010.659) [-1011.463] (-1009.353) (-1010.754) -- 0:00:49 181500 -- [-1008.882] (-1011.275) (-1010.060) (-1012.462) * (-1009.255) [-1008.046] (-1011.761) (-1011.356) -- 0:00:49 182000 -- (-1007.551) (-1006.844) [-1008.437] (-1010.767) * (-1008.165) (-1009.680) (-1008.688) [-1009.501] -- 0:00:49 182500 -- (-1008.451) (-1008.946) [-1008.987] (-1008.010) * [-1009.782] (-1007.436) (-1009.380) (-1008.549) -- 0:00:49 183000 -- [-1010.675] (-1010.373) (-1013.200) (-1007.373) * (-1007.026) [-1008.619] (-1013.032) (-1012.932) -- 0:00:49 183500 -- [-1007.689] (-1009.439) (-1009.172) (-1009.185) * (-1007.028) (-1007.071) [-1012.161] (-1009.020) -- 0:00:48 184000 -- [-1007.684] (-1007.787) (-1007.206) (-1008.231) * (-1008.015) (-1007.404) [-1010.047] (-1011.326) -- 0:00:48 184500 -- (-1010.458) [-1008.304] (-1010.660) (-1008.364) * (-1008.232) [-1007.575] (-1007.689) (-1015.905) -- 0:00:48 185000 -- (-1008.086) (-1007.269) [-1008.837] (-1008.257) * (-1012.336) (-1008.831) [-1008.175] (-1012.761) -- 0:00:48 Average standard deviation of split frequencies: 0.015740 185500 -- (-1008.035) (-1008.711) (-1008.247) [-1007.529] * (-1009.571) (-1010.794) [-1009.071] (-1007.438) -- 0:00:48 186000 -- [-1007.019] (-1011.136) (-1008.329) (-1009.874) * (-1008.490) (-1009.312) [-1009.999] (-1010.818) -- 0:00:48 186500 -- (-1011.158) (-1011.506) [-1007.062] (-1007.367) * (-1009.294) (-1010.809) (-1010.811) [-1007.334] -- 0:00:47 187000 -- (-1013.182) [-1008.798] (-1007.245) (-1007.894) * (-1008.986) (-1009.982) [-1008.789] (-1007.459) -- 0:00:47 187500 -- (-1012.290) [-1008.589] (-1007.278) (-1011.664) * (-1011.413) (-1010.821) [-1008.980] (-1007.666) -- 0:00:52 188000 -- (-1012.136) [-1010.180] (-1008.226) (-1008.210) * (-1009.497) (-1011.364) [-1007.991] (-1007.920) -- 0:00:51 188500 -- [-1008.922] (-1010.565) (-1009.508) (-1009.923) * (-1009.130) [-1010.794] (-1007.373) (-1007.921) -- 0:00:51 189000 -- [-1008.596] (-1009.139) (-1007.042) (-1007.239) * (-1010.287) (-1007.855) [-1007.126] (-1007.978) -- 0:00:51 189500 -- (-1007.892) (-1009.574) [-1008.384] (-1007.239) * (-1010.434) (-1006.922) [-1008.022] (-1007.977) -- 0:00:51 190000 -- [-1012.023] (-1007.760) (-1009.083) (-1007.022) * (-1011.421) (-1007.284) [-1009.563] (-1008.666) -- 0:00:51 Average standard deviation of split frequencies: 0.014010 190500 -- (-1008.122) (-1008.657) [-1008.107] (-1007.706) * (-1008.453) (-1007.114) [-1013.726] (-1011.819) -- 0:00:50 191000 -- (-1007.353) (-1008.819) (-1008.375) [-1009.554] * (-1007.450) (-1007.789) [-1017.854] (-1009.602) -- 0:00:50 191500 -- (-1007.800) (-1008.039) [-1009.818] (-1009.729) * [-1008.290] (-1012.025) (-1015.929) (-1009.371) -- 0:00:50 192000 -- (-1007.892) (-1007.115) [-1008.224] (-1010.630) * (-1008.840) (-1009.649) [-1007.341] (-1014.903) -- 0:00:50 192500 -- (-1007.185) [-1008.250] (-1009.615) (-1014.449) * (-1006.903) (-1007.244) (-1010.402) [-1009.310] -- 0:00:50 193000 -- [-1008.173] (-1011.203) (-1008.325) (-1015.098) * [-1006.497] (-1008.222) (-1007.832) (-1010.541) -- 0:00:50 193500 -- (-1011.225) (-1011.881) [-1008.183] (-1009.108) * (-1006.774) (-1007.833) (-1007.464) [-1010.286] -- 0:00:50 194000 -- (-1008.173) (-1010.459) [-1007.947] (-1008.880) * (-1007.953) (-1010.539) (-1007.477) [-1007.219] -- 0:00:49 194500 -- [-1009.914] (-1008.726) (-1014.640) (-1007.721) * [-1009.212] (-1010.523) (-1008.779) (-1008.643) -- 0:00:49 195000 -- (-1007.241) (-1009.356) (-1012.684) [-1009.216] * [-1007.949] (-1008.745) (-1013.035) (-1011.643) -- 0:00:49 Average standard deviation of split frequencies: 0.011892 195500 -- (-1009.976) [-1010.334] (-1009.044) (-1009.024) * (-1007.819) [-1011.010] (-1009.022) (-1009.987) -- 0:00:49 196000 -- (-1008.456) (-1009.804) [-1009.363] (-1009.058) * (-1006.623) (-1009.653) [-1008.935] (-1009.124) -- 0:00:49 196500 -- (-1007.933) (-1007.703) (-1010.027) [-1007.944] * (-1006.527) (-1008.092) (-1007.181) [-1009.429] -- 0:00:49 197000 -- (-1007.521) [-1008.549] (-1008.513) (-1009.656) * [-1007.765] (-1014.205) (-1008.949) (-1007.640) -- 0:00:48 197500 -- (-1007.958) (-1007.987) (-1008.555) [-1010.119] * (-1008.958) (-1012.141) (-1008.362) [-1008.973] -- 0:00:48 198000 -- (-1007.140) (-1008.433) (-1008.868) [-1009.137] * (-1007.967) (-1010.829) (-1008.585) [-1012.429] -- 0:00:48 198500 -- (-1006.998) [-1009.455] (-1012.665) (-1008.126) * [-1009.736] (-1007.774) (-1007.818) (-1008.449) -- 0:00:48 199000 -- (-1008.750) (-1007.740) [-1008.656] (-1007.548) * [-1007.786] (-1008.597) (-1012.047) (-1008.154) -- 0:00:48 199500 -- [-1007.136] (-1006.848) (-1008.271) (-1009.726) * [-1009.407] (-1011.871) (-1009.622) (-1009.441) -- 0:00:48 200000 -- [-1006.869] (-1009.630) (-1007.706) (-1011.483) * (-1009.054) (-1008.467) [-1008.275] (-1008.788) -- 0:00:48 Average standard deviation of split frequencies: 0.014837 200500 -- [-1006.807] (-1011.265) (-1008.098) (-1009.663) * [-1008.061] (-1007.995) (-1011.738) (-1008.114) -- 0:00:47 201000 -- (-1009.208) (-1007.496) [-1008.042] (-1009.424) * (-1010.649) (-1011.943) (-1014.067) [-1009.340] -- 0:00:47 201500 -- (-1013.522) (-1007.232) (-1007.358) [-1010.131] * (-1010.019) (-1009.410) [-1009.682] (-1010.447) -- 0:00:47 202000 -- (-1009.756) (-1007.007) (-1007.200) [-1008.907] * (-1012.855) (-1008.298) (-1009.626) [-1007.131] -- 0:00:47 202500 -- (-1007.058) (-1007.145) (-1013.540) [-1008.563] * (-1008.998) (-1011.099) [-1011.905] (-1007.617) -- 0:00:47 203000 -- (-1010.307) (-1007.261) (-1008.020) [-1008.272] * [-1006.713] (-1014.321) (-1010.179) (-1008.609) -- 0:00:47 203500 -- (-1008.697) [-1008.538] (-1007.506) (-1009.184) * (-1007.538) (-1009.039) [-1009.323] (-1007.532) -- 0:00:50 204000 -- [-1006.872] (-1009.576) (-1006.996) (-1008.960) * (-1010.438) (-1014.132) [-1007.320] (-1007.068) -- 0:00:50 204500 -- (-1008.032) (-1008.181) (-1007.697) [-1007.739] * (-1007.900) (-1011.878) (-1010.629) [-1008.263] -- 0:00:50 205000 -- (-1007.395) (-1007.519) [-1007.648] (-1009.344) * (-1010.849) (-1008.437) (-1008.910) [-1007.704] -- 0:00:50 Average standard deviation of split frequencies: 0.014935 205500 -- [-1006.706] (-1008.431) (-1008.230) (-1010.763) * (-1010.751) (-1008.863) [-1011.154] (-1008.962) -- 0:00:50 206000 -- (-1006.706) [-1009.118] (-1012.580) (-1014.591) * (-1008.417) (-1007.624) [-1008.810] (-1013.295) -- 0:00:50 206500 -- [-1009.304] (-1008.825) (-1007.128) (-1011.754) * (-1011.082) [-1008.070] (-1008.413) (-1007.897) -- 0:00:49 207000 -- [-1007.164] (-1009.628) (-1008.412) (-1014.995) * (-1012.812) (-1007.324) (-1008.719) [-1006.677] -- 0:00:49 207500 -- (-1010.570) (-1010.892) (-1010.803) [-1009.515] * [-1007.999] (-1008.337) (-1009.183) (-1008.103) -- 0:00:49 208000 -- [-1010.643] (-1012.641) (-1007.234) (-1008.242) * (-1007.776) (-1007.489) (-1006.977) [-1006.769] -- 0:00:49 208500 -- [-1007.640] (-1011.724) (-1008.338) (-1008.229) * (-1006.963) (-1013.279) (-1007.881) [-1009.039] -- 0:00:49 209000 -- (-1008.975) (-1009.803) (-1009.629) [-1008.734] * [-1006.963] (-1008.824) (-1009.291) (-1008.161) -- 0:00:49 209500 -- (-1010.875) [-1009.144] (-1008.413) (-1008.743) * (-1008.725) (-1008.367) (-1010.380) [-1013.821] -- 0:00:49 210000 -- [-1009.142] (-1007.994) (-1011.598) (-1008.721) * (-1010.459) (-1008.568) (-1011.597) [-1009.711] -- 0:00:48 Average standard deviation of split frequencies: 0.015193 210500 -- (-1010.534) (-1007.624) (-1010.211) [-1009.193] * (-1007.188) (-1008.234) [-1009.151] (-1008.139) -- 0:00:48 211000 -- (-1014.222) (-1009.274) [-1008.140] (-1007.498) * [-1007.785] (-1010.744) (-1009.022) (-1009.971) -- 0:00:48 211500 -- (-1010.434) [-1011.365] (-1007.883) (-1009.697) * (-1012.841) [-1010.292] (-1012.238) (-1007.505) -- 0:00:48 212000 -- (-1010.508) (-1010.229) [-1007.304] (-1010.530) * (-1016.969) [-1010.309] (-1012.099) (-1011.840) -- 0:00:48 212500 -- (-1010.792) [-1012.044] (-1007.763) (-1009.068) * (-1010.224) [-1006.671] (-1012.043) (-1007.711) -- 0:00:48 213000 -- (-1012.470) (-1010.967) [-1007.920] (-1008.671) * [-1011.350] (-1007.937) (-1007.099) (-1010.921) -- 0:00:48 213500 -- (-1012.021) [-1008.222] (-1009.326) (-1007.281) * (-1009.381) (-1008.493) (-1008.563) [-1011.236] -- 0:00:47 214000 -- (-1016.101) (-1007.082) (-1009.138) [-1008.782] * (-1011.113) (-1009.323) [-1007.626] (-1008.240) -- 0:00:47 214500 -- (-1009.773) [-1007.126] (-1013.339) (-1007.696) * (-1012.249) [-1010.018] (-1009.598) (-1008.151) -- 0:00:47 215000 -- (-1011.379) [-1006.870] (-1008.334) (-1009.026) * [-1007.921] (-1009.845) (-1009.365) (-1008.821) -- 0:00:47 Average standard deviation of split frequencies: 0.014703 215500 -- (-1008.321) (-1010.788) (-1009.443) [-1010.177] * (-1008.429) [-1010.631] (-1012.069) (-1009.735) -- 0:00:47 216000 -- [-1008.858] (-1009.361) (-1009.911) (-1011.271) * (-1006.817) (-1009.966) (-1013.272) [-1007.939] -- 0:00:47 216500 -- (-1007.280) (-1009.835) [-1011.464] (-1008.316) * (-1008.564) (-1008.471) (-1010.041) [-1009.013] -- 0:00:47 217000 -- [-1007.429] (-1008.945) (-1009.255) (-1009.651) * [-1010.117] (-1010.405) (-1009.836) (-1009.695) -- 0:00:46 217500 -- (-1007.387) (-1008.945) (-1009.884) [-1008.905] * (-1007.761) [-1010.409] (-1009.979) (-1010.754) -- 0:00:46 218000 -- (-1011.227) (-1009.278) (-1007.430) [-1008.122] * (-1012.491) [-1009.122] (-1008.703) (-1009.763) -- 0:00:46 218500 -- (-1012.895) [-1007.253] (-1008.775) (-1006.869) * (-1009.595) (-1008.385) (-1007.852) [-1009.657] -- 0:00:46 219000 -- (-1008.296) (-1008.558) [-1009.662] (-1007.375) * [-1007.551] (-1009.636) (-1007.022) (-1008.844) -- 0:00:46 219500 -- [-1008.335] (-1008.713) (-1010.090) (-1007.641) * [-1007.696] (-1010.886) (-1010.881) (-1008.699) -- 0:00:46 220000 -- [-1008.251] (-1011.035) (-1010.691) (-1011.792) * [-1012.428] (-1009.434) (-1013.277) (-1007.758) -- 0:00:49 Average standard deviation of split frequencies: 0.014847 220500 -- (-1009.003) [-1008.689] (-1009.520) (-1009.945) * (-1010.212) [-1007.947] (-1013.264) (-1009.510) -- 0:00:49 221000 -- [-1010.554] (-1009.349) (-1010.700) (-1010.964) * (-1007.811) (-1007.748) [-1007.801] (-1013.623) -- 0:00:49 221500 -- (-1012.638) [-1007.802] (-1007.819) (-1009.426) * (-1006.566) (-1007.221) [-1008.294] (-1011.563) -- 0:00:49 222000 -- (-1007.646) [-1007.815] (-1010.297) (-1010.096) * (-1006.794) (-1014.014) [-1010.565] (-1007.565) -- 0:00:49 222500 -- (-1008.542) [-1009.044] (-1010.493) (-1009.936) * (-1010.042) [-1009.475] (-1008.619) (-1009.525) -- 0:00:48 223000 -- (-1009.527) (-1010.210) (-1013.809) [-1008.296] * (-1007.949) [-1008.808] (-1008.737) (-1008.466) -- 0:00:48 223500 -- (-1009.953) (-1012.757) [-1008.791] (-1008.655) * (-1007.233) (-1007.413) [-1010.666] (-1010.528) -- 0:00:48 224000 -- (-1011.500) (-1011.900) [-1007.589] (-1009.671) * (-1008.121) (-1009.207) (-1013.053) [-1007.614] -- 0:00:48 224500 -- (-1008.820) (-1011.096) [-1007.196] (-1009.067) * (-1012.405) (-1009.697) (-1009.877) [-1008.216] -- 0:00:48 225000 -- [-1010.538] (-1010.963) (-1012.172) (-1009.272) * (-1008.561) (-1017.956) (-1010.149) [-1010.121] -- 0:00:48 Average standard deviation of split frequencies: 0.014810 225500 -- [-1007.463] (-1008.043) (-1009.973) (-1010.039) * [-1007.830] (-1011.265) (-1012.775) (-1009.084) -- 0:00:48 226000 -- (-1010.958) (-1009.277) [-1012.745] (-1007.098) * (-1008.800) (-1009.043) (-1009.539) [-1008.489] -- 0:00:47 226500 -- (-1010.955) [-1009.150] (-1009.574) (-1007.097) * (-1007.804) (-1008.409) (-1007.816) [-1007.473] -- 0:00:47 227000 -- (-1014.792) (-1008.271) [-1009.355] (-1009.680) * (-1010.852) [-1009.072] (-1008.219) (-1006.793) -- 0:00:47 227500 -- (-1015.026) (-1009.018) [-1007.499] (-1010.490) * (-1010.856) (-1011.096) (-1008.734) [-1007.423] -- 0:00:47 228000 -- [-1010.986] (-1007.227) (-1008.120) (-1010.629) * (-1008.896) (-1013.371) [-1009.084] (-1009.337) -- 0:00:47 228500 -- [-1009.280] (-1007.224) (-1009.112) (-1009.725) * (-1008.972) (-1013.970) [-1010.448] (-1012.348) -- 0:00:47 229000 -- (-1006.479) (-1006.813) (-1011.339) [-1009.387] * (-1008.200) [-1007.650] (-1012.401) (-1008.640) -- 0:00:47 229500 -- [-1006.476] (-1006.888) (-1012.601) (-1008.827) * (-1009.489) (-1009.073) [-1007.928] (-1012.199) -- 0:00:47 230000 -- [-1006.876] (-1012.461) (-1007.629) (-1008.709) * (-1008.458) [-1010.977] (-1014.227) (-1011.272) -- 0:00:46 Average standard deviation of split frequencies: 0.012603 230500 -- (-1008.596) (-1007.419) (-1007.619) [-1007.374] * (-1011.156) (-1007.806) [-1009.112] (-1007.348) -- 0:00:46 231000 -- (-1007.269) (-1007.866) [-1007.952] (-1015.405) * (-1009.364) [-1007.028] (-1009.545) (-1009.743) -- 0:00:46 231500 -- [-1006.760] (-1009.866) (-1007.577) (-1009.924) * (-1008.502) [-1007.308] (-1007.970) (-1008.169) -- 0:00:46 232000 -- (-1008.027) [-1009.896] (-1007.581) (-1007.355) * (-1007.178) (-1011.863) (-1011.132) [-1008.329] -- 0:00:46 232500 -- [-1007.518] (-1011.383) (-1010.942) (-1009.311) * (-1007.571) (-1007.670) (-1007.815) [-1008.481] -- 0:00:46 233000 -- (-1012.890) (-1009.050) [-1008.903] (-1008.542) * (-1007.201) (-1010.456) (-1010.419) [-1008.151] -- 0:00:46 233500 -- (-1009.441) (-1009.430) [-1007.746] (-1008.647) * [-1007.910] (-1008.660) (-1012.397) (-1007.979) -- 0:00:45 234000 -- (-1009.608) (-1010.284) [-1007.054] (-1008.589) * (-1008.608) (-1009.328) (-1011.168) [-1011.314] -- 0:00:45 234500 -- [-1009.094] (-1008.784) (-1008.507) (-1007.605) * (-1009.388) [-1007.147] (-1008.229) (-1012.951) -- 0:00:45 235000 -- (-1008.169) [-1011.982] (-1012.343) (-1007.778) * (-1010.040) (-1006.855) [-1007.292] (-1012.896) -- 0:00:45 Average standard deviation of split frequencies: 0.012651 235500 -- [-1007.784] (-1008.963) (-1009.455) (-1011.004) * (-1012.230) (-1007.722) [-1007.348] (-1012.241) -- 0:00:45 236000 -- (-1008.864) (-1009.670) [-1009.844] (-1009.971) * (-1009.465) (-1007.647) [-1007.873] (-1012.299) -- 0:00:48 236500 -- [-1006.653] (-1008.444) (-1010.726) (-1009.294) * [-1008.145] (-1012.706) (-1007.212) (-1009.880) -- 0:00:48 237000 -- (-1008.625) [-1008.264] (-1011.300) (-1007.882) * (-1007.480) (-1016.900) [-1007.786] (-1010.430) -- 0:00:48 237500 -- (-1011.126) (-1007.322) [-1008.482] (-1009.065) * (-1007.921) [-1010.796] (-1007.167) (-1009.601) -- 0:00:48 238000 -- [-1006.985] (-1010.446) (-1009.333) (-1006.891) * (-1009.456) [-1010.042] (-1008.069) (-1008.610) -- 0:00:48 238500 -- (-1012.594) [-1007.828] (-1012.754) (-1006.826) * [-1007.520] (-1009.562) (-1008.882) (-1009.082) -- 0:00:47 239000 -- (-1007.551) (-1009.427) [-1010.926] (-1007.764) * (-1010.536) (-1009.671) (-1008.842) [-1008.594] -- 0:00:47 239500 -- (-1008.634) [-1007.540] (-1008.573) (-1007.761) * (-1009.436) [-1008.079] (-1009.706) (-1014.176) -- 0:00:47 240000 -- (-1008.298) (-1006.964) (-1010.938) [-1008.518] * (-1011.802) (-1009.574) [-1007.541] (-1010.471) -- 0:00:47 Average standard deviation of split frequencies: 0.013820 240500 -- (-1006.814) (-1010.717) (-1008.258) [-1008.292] * (-1008.969) (-1011.049) [-1008.189] (-1007.712) -- 0:00:47 241000 -- [-1007.525] (-1011.112) (-1008.688) (-1008.799) * (-1009.319) (-1009.650) [-1007.378] (-1009.973) -- 0:00:47 241500 -- [-1008.029] (-1010.696) (-1009.146) (-1009.595) * (-1007.406) (-1009.940) [-1008.267] (-1007.922) -- 0:00:47 242000 -- (-1009.921) (-1007.326) [-1008.803] (-1010.191) * (-1007.838) (-1007.829) (-1006.837) [-1011.655] -- 0:00:46 242500 -- (-1007.207) (-1007.394) (-1010.356) [-1007.809] * [-1007.373] (-1007.898) (-1009.089) (-1014.420) -- 0:00:46 243000 -- [-1007.111] (-1007.270) (-1010.676) (-1007.984) * (-1009.200) (-1009.199) (-1007.646) [-1009.511] -- 0:00:46 243500 -- [-1007.743] (-1007.237) (-1007.161) (-1010.201) * [-1009.459] (-1008.947) (-1009.791) (-1007.829) -- 0:00:46 244000 -- [-1007.576] (-1009.299) (-1008.260) (-1008.171) * (-1006.690) (-1007.527) [-1011.280] (-1009.553) -- 0:00:46 244500 -- (-1007.916) [-1007.293] (-1008.566) (-1007.986) * (-1007.161) (-1007.716) [-1008.679] (-1009.014) -- 0:00:46 245000 -- [-1010.042] (-1008.014) (-1006.436) (-1010.252) * (-1011.665) (-1011.193) [-1008.301] (-1006.687) -- 0:00:46 Average standard deviation of split frequencies: 0.013011 245500 -- (-1007.761) (-1006.947) [-1007.472] (-1011.660) * [-1007.019] (-1008.072) (-1007.000) (-1006.630) -- 0:00:46 246000 -- [-1008.956] (-1007.483) (-1007.507) (-1010.189) * [-1011.293] (-1009.255) (-1006.778) (-1006.925) -- 0:00:45 246500 -- (-1011.179) (-1007.588) [-1006.889] (-1016.085) * (-1011.690) [-1008.285] (-1008.324) (-1007.622) -- 0:00:45 247000 -- (-1012.733) [-1010.066] (-1009.398) (-1007.133) * (-1009.944) (-1010.481) [-1011.839] (-1010.498) -- 0:00:45 247500 -- (-1011.319) (-1008.828) (-1008.816) [-1008.694] * (-1010.951) [-1008.852] (-1006.719) (-1008.558) -- 0:00:45 248000 -- (-1006.752) [-1007.878] (-1009.152) (-1007.053) * (-1008.492) (-1007.296) [-1008.101] (-1009.177) -- 0:00:45 248500 -- (-1007.763) (-1007.411) [-1008.338] (-1009.894) * [-1007.486] (-1011.897) (-1008.413) (-1014.667) -- 0:00:45 249000 -- [-1007.268] (-1009.132) (-1008.142) (-1010.622) * [-1009.998] (-1007.834) (-1009.168) (-1013.877) -- 0:00:45 249500 -- (-1007.481) [-1008.037] (-1009.057) (-1007.241) * [-1008.000] (-1008.148) (-1008.645) (-1008.349) -- 0:00:45 250000 -- (-1010.445) (-1009.441) [-1009.539] (-1008.855) * (-1008.045) (-1008.541) (-1008.449) [-1008.244] -- 0:00:45 Average standard deviation of split frequencies: 0.012669 250500 -- (-1007.987) (-1018.033) (-1008.520) [-1009.242] * [-1009.239] (-1008.509) (-1010.266) (-1011.026) -- 0:00:44 251000 -- [-1007.377] (-1008.396) (-1011.420) (-1008.084) * (-1008.501) (-1010.153) [-1011.827] (-1010.819) -- 0:00:44 251500 -- (-1007.619) (-1009.892) [-1009.607] (-1008.091) * (-1007.406) (-1007.421) (-1011.571) [-1010.339] -- 0:00:44 252000 -- (-1007.424) (-1014.742) [-1007.859] (-1008.170) * (-1007.378) (-1007.162) (-1008.244) [-1007.350] -- 0:00:44 252500 -- [-1008.394] (-1012.325) (-1008.686) (-1008.000) * (-1007.223) (-1006.778) (-1010.550) [-1007.408] -- 0:00:47 253000 -- (-1008.074) (-1010.926) [-1011.284] (-1007.131) * (-1009.526) (-1018.934) (-1007.771) [-1008.822] -- 0:00:47 253500 -- [-1010.448] (-1008.915) (-1008.202) (-1007.466) * (-1009.762) (-1012.248) (-1008.880) [-1007.917] -- 0:00:47 254000 -- (-1008.279) (-1008.247) (-1009.229) [-1008.669] * (-1008.412) [-1011.237] (-1012.298) (-1008.806) -- 0:00:46 254500 -- (-1008.460) [-1008.362] (-1007.970) (-1013.247) * (-1010.877) (-1010.839) [-1007.862] (-1006.646) -- 0:00:46 255000 -- (-1011.904) [-1008.736] (-1007.936) (-1009.229) * (-1011.163) [-1008.779] (-1012.294) (-1009.387) -- 0:00:46 Average standard deviation of split frequencies: 0.013627 255500 -- (-1008.780) [-1009.905] (-1010.306) (-1009.193) * (-1010.630) (-1008.927) [-1007.057] (-1010.420) -- 0:00:46 256000 -- [-1010.190] (-1013.087) (-1007.981) (-1009.737) * (-1009.354) (-1011.126) (-1007.961) [-1008.193] -- 0:00:46 256500 -- [-1007.766] (-1009.528) (-1009.061) (-1011.813) * (-1008.527) [-1008.714] (-1008.041) (-1008.167) -- 0:00:46 257000 -- (-1009.193) (-1009.127) [-1013.101] (-1009.756) * (-1009.263) [-1006.945] (-1007.349) (-1008.204) -- 0:00:46 257500 -- (-1011.194) (-1012.780) [-1008.094] (-1007.758) * (-1009.276) (-1007.355) (-1009.197) [-1010.010] -- 0:00:46 258000 -- (-1007.787) (-1011.670) [-1008.772] (-1006.755) * (-1008.465) (-1007.891) (-1012.781) [-1009.866] -- 0:00:46 258500 -- [-1009.046] (-1008.740) (-1008.228) (-1007.870) * (-1009.521) [-1009.004] (-1011.674) (-1012.466) -- 0:00:45 259000 -- (-1009.293) (-1013.040) [-1007.880] (-1010.217) * (-1012.101) [-1010.381] (-1016.894) (-1013.505) -- 0:00:45 259500 -- (-1009.714) (-1011.604) (-1007.932) [-1009.240] * [-1009.557] (-1009.400) (-1014.420) (-1008.277) -- 0:00:45 260000 -- (-1008.446) (-1011.207) [-1010.382] (-1008.473) * (-1008.967) [-1008.220] (-1009.482) (-1007.086) -- 0:00:45 Average standard deviation of split frequencies: 0.013706 260500 -- (-1007.265) (-1009.394) [-1010.514] (-1008.926) * (-1009.990) [-1008.964] (-1010.800) (-1008.379) -- 0:00:45 261000 -- (-1007.481) [-1009.381] (-1008.451) (-1008.634) * (-1010.245) (-1012.957) [-1010.637] (-1009.154) -- 0:00:45 261500 -- (-1009.696) (-1008.516) [-1009.441] (-1009.640) * (-1008.863) (-1011.783) [-1008.583] (-1012.050) -- 0:00:45 262000 -- (-1009.304) [-1009.888] (-1007.575) (-1009.206) * (-1009.404) (-1011.923) (-1007.601) [-1008.100] -- 0:00:45 262500 -- (-1009.701) (-1013.615) [-1009.449] (-1007.975) * (-1009.162) (-1014.658) [-1008.180] (-1008.061) -- 0:00:44 263000 -- (-1008.484) (-1011.916) (-1008.365) [-1011.120] * (-1009.780) (-1011.863) [-1009.024] (-1011.926) -- 0:00:44 263500 -- (-1009.758) (-1008.872) (-1009.469) [-1007.792] * [-1009.116] (-1009.568) (-1008.403) (-1009.569) -- 0:00:44 264000 -- (-1011.026) (-1008.710) (-1009.149) [-1008.601] * (-1012.190) [-1010.912] (-1010.069) (-1007.821) -- 0:00:44 264500 -- (-1008.421) (-1007.478) [-1008.311] (-1009.479) * [-1009.761] (-1010.369) (-1008.054) (-1008.295) -- 0:00:44 265000 -- [-1009.854] (-1007.994) (-1009.067) (-1011.668) * (-1010.034) [-1011.904] (-1012.463) (-1014.455) -- 0:00:44 Average standard deviation of split frequencies: 0.012494 265500 -- [-1008.798] (-1010.750) (-1006.960) (-1008.098) * (-1006.867) [-1012.624] (-1008.263) (-1013.790) -- 0:00:44 266000 -- [-1009.286] (-1009.416) (-1007.374) (-1010.078) * (-1007.997) (-1008.620) (-1010.381) [-1010.631] -- 0:00:44 266500 -- (-1011.232) (-1008.642) [-1009.439] (-1010.359) * (-1009.910) (-1008.713) (-1008.788) [-1009.303] -- 0:00:44 267000 -- (-1009.308) (-1008.459) (-1009.509) [-1008.421] * (-1008.372) (-1008.109) (-1008.250) [-1009.099] -- 0:00:43 267500 -- [-1008.702] (-1007.401) (-1008.401) (-1015.600) * [-1009.540] (-1007.969) (-1008.028) (-1009.669) -- 0:00:43 268000 -- (-1010.726) (-1007.394) (-1008.980) [-1009.133] * [-1008.234] (-1009.873) (-1007.408) (-1007.175) -- 0:00:43 268500 -- (-1008.094) (-1007.434) (-1009.328) [-1010.438] * (-1010.025) (-1011.170) (-1009.975) [-1007.831] -- 0:00:46 269000 -- (-1008.967) (-1010.739) (-1007.966) [-1008.425] * (-1009.456) (-1010.767) (-1014.491) [-1012.759] -- 0:00:46 269500 -- [-1010.506] (-1009.480) (-1009.411) (-1007.550) * [-1010.830] (-1011.903) (-1007.160) (-1021.016) -- 0:00:46 270000 -- (-1012.202) (-1010.310) (-1007.082) [-1006.858] * (-1012.299) (-1009.209) [-1007.886] (-1011.459) -- 0:00:45 Average standard deviation of split frequencies: 0.012975 270500 -- [-1011.081] (-1010.123) (-1007.364) (-1007.150) * (-1009.044) (-1008.971) [-1007.902] (-1009.047) -- 0:00:45 271000 -- (-1012.948) (-1009.669) (-1009.045) [-1010.158] * (-1009.598) (-1014.915) (-1009.945) [-1008.673] -- 0:00:45 271500 -- [-1011.952] (-1009.742) (-1008.787) (-1016.658) * [-1009.113] (-1009.931) (-1008.260) (-1009.050) -- 0:00:45 272000 -- (-1017.174) [-1013.874] (-1006.684) (-1015.428) * (-1006.826) [-1009.665] (-1011.321) (-1008.491) -- 0:00:45 272500 -- (-1012.064) (-1008.663) (-1007.775) [-1011.136] * (-1007.318) [-1007.473] (-1007.840) (-1009.945) -- 0:00:45 273000 -- (-1008.251) (-1008.667) (-1006.743) [-1009.192] * (-1013.368) (-1007.187) (-1008.027) [-1007.733] -- 0:00:45 273500 -- (-1009.746) (-1009.871) (-1007.614) [-1010.905] * (-1008.996) (-1009.345) [-1007.331] (-1009.166) -- 0:00:45 274000 -- [-1008.077] (-1008.815) (-1008.610) (-1009.456) * (-1011.865) (-1010.088) [-1007.820] (-1008.753) -- 0:00:45 274500 -- (-1017.303) (-1009.297) [-1009.472] (-1010.472) * (-1009.662) [-1009.783] (-1010.602) (-1010.042) -- 0:00:44 275000 -- (-1008.886) (-1010.523) (-1015.801) [-1006.984] * [-1010.337] (-1008.131) (-1011.846) (-1009.398) -- 0:00:44 Average standard deviation of split frequencies: 0.012495 275500 -- (-1008.220) [-1009.965] (-1008.208) (-1007.905) * (-1008.041) (-1007.740) [-1007.471] (-1008.025) -- 0:00:44 276000 -- (-1007.955) (-1013.946) [-1008.342] (-1008.154) * (-1008.377) (-1009.727) [-1007.052] (-1009.273) -- 0:00:44 276500 -- (-1007.970) [-1007.173] (-1008.574) (-1008.936) * (-1007.838) [-1009.438] (-1010.444) (-1007.961) -- 0:00:44 277000 -- (-1009.614) (-1009.588) (-1011.664) [-1006.921] * (-1008.038) [-1009.554] (-1007.382) (-1009.579) -- 0:00:44 277500 -- (-1010.479) (-1008.908) (-1009.191) [-1006.952] * (-1007.882) (-1011.140) [-1013.556] (-1008.418) -- 0:00:44 278000 -- (-1010.014) [-1007.457] (-1008.370) (-1006.722) * (-1010.199) (-1007.045) (-1009.157) [-1007.989] -- 0:00:44 278500 -- (-1007.567) (-1007.792) (-1010.280) [-1008.141] * (-1009.234) (-1007.811) [-1008.221] (-1009.031) -- 0:00:44 279000 -- (-1008.207) (-1008.422) (-1009.353) [-1009.389] * (-1008.804) (-1008.870) (-1008.534) [-1008.254] -- 0:00:43 279500 -- (-1008.413) (-1006.847) [-1010.225] (-1014.139) * (-1012.376) [-1007.304] (-1009.705) (-1009.857) -- 0:00:43 280000 -- [-1008.989] (-1006.958) (-1010.744) (-1015.056) * (-1012.931) (-1009.079) (-1008.338) [-1009.187] -- 0:00:43 Average standard deviation of split frequencies: 0.013343 280500 -- [-1006.755] (-1007.331) (-1008.988) (-1012.402) * (-1010.091) (-1007.947) (-1008.302) [-1012.191] -- 0:00:43 281000 -- (-1007.456) (-1007.853) (-1010.106) [-1010.307] * (-1009.532) (-1008.279) (-1013.486) [-1008.481] -- 0:00:43 281500 -- (-1012.488) [-1007.472] (-1007.936) (-1007.374) * [-1008.568] (-1009.189) (-1009.341) (-1009.876) -- 0:00:45 282000 -- [-1009.816] (-1008.567) (-1006.764) (-1009.425) * (-1008.973) [-1009.478] (-1010.353) (-1009.823) -- 0:00:45 282500 -- (-1008.649) (-1008.892) [-1008.158] (-1015.097) * (-1009.754) (-1010.201) [-1008.214] (-1007.180) -- 0:00:45 283000 -- (-1012.368) (-1010.885) [-1008.153] (-1013.210) * (-1008.189) (-1011.760) [-1008.166] (-1007.983) -- 0:00:45 283500 -- (-1013.172) (-1011.310) [-1009.872] (-1008.915) * [-1008.064] (-1013.269) (-1009.425) (-1007.114) -- 0:00:45 284000 -- (-1012.951) (-1008.766) [-1009.390] (-1007.467) * (-1007.214) (-1008.810) (-1006.663) [-1009.599] -- 0:00:45 284500 -- (-1010.637) [-1009.662] (-1010.577) (-1009.153) * (-1008.063) (-1015.747) (-1013.586) [-1008.239] -- 0:00:45 285000 -- (-1010.814) (-1009.098) (-1009.556) [-1007.276] * (-1006.879) (-1011.922) (-1011.576) [-1010.299] -- 0:00:45 Average standard deviation of split frequencies: 0.013269 285500 -- [-1011.149] (-1008.539) (-1012.476) (-1010.096) * [-1009.842] (-1015.703) (-1011.598) (-1010.317) -- 0:00:45 286000 -- (-1008.060) [-1007.977] (-1011.871) (-1011.144) * (-1007.849) (-1008.598) [-1009.065] (-1008.776) -- 0:00:44 286500 -- (-1008.369) (-1007.969) [-1009.432] (-1009.301) * (-1007.268) [-1006.973] (-1009.472) (-1009.015) -- 0:00:44 287000 -- (-1014.717) (-1006.839) (-1010.205) [-1008.533] * (-1014.645) (-1007.908) (-1009.307) [-1008.564] -- 0:00:44 287500 -- (-1012.310) [-1007.052] (-1008.634) (-1009.859) * (-1014.118) (-1009.489) [-1008.807] (-1009.194) -- 0:00:44 288000 -- (-1007.974) [-1007.246] (-1008.292) (-1012.351) * (-1007.891) [-1008.573] (-1007.407) (-1009.782) -- 0:00:44 288500 -- [-1012.113] (-1008.763) (-1008.911) (-1007.469) * (-1007.439) [-1008.571] (-1006.760) (-1007.087) -- 0:00:44 289000 -- (-1010.998) (-1009.234) (-1008.595) [-1008.708] * (-1010.173) [-1008.485] (-1007.744) (-1006.836) -- 0:00:44 289500 -- (-1010.059) (-1009.941) (-1014.897) [-1008.386] * (-1008.719) (-1009.515) [-1008.433] (-1010.957) -- 0:00:44 290000 -- (-1007.517) [-1007.400] (-1013.774) (-1010.753) * (-1008.878) [-1009.156] (-1007.363) (-1009.853) -- 0:00:44 Average standard deviation of split frequencies: 0.012614 290500 -- (-1008.660) [-1006.917] (-1008.197) (-1008.532) * (-1008.491) (-1011.313) [-1011.026] (-1013.043) -- 0:00:43 291000 -- [-1009.911] (-1009.328) (-1007.465) (-1008.412) * (-1008.203) (-1009.738) (-1007.589) [-1009.770] -- 0:00:43 291500 -- [-1008.496] (-1006.930) (-1009.293) (-1010.442) * (-1010.056) (-1008.330) (-1007.791) [-1006.575] -- 0:00:43 292000 -- (-1009.858) [-1007.964] (-1010.316) (-1008.227) * [-1016.650] (-1007.689) (-1010.998) (-1009.419) -- 0:00:43 292500 -- (-1012.353) [-1008.180] (-1011.535) (-1008.707) * (-1012.011) (-1009.406) (-1007.246) [-1006.502] -- 0:00:43 293000 -- (-1007.880) (-1008.072) (-1009.738) [-1008.536] * (-1009.198) (-1011.160) (-1010.565) [-1007.579] -- 0:00:43 293500 -- [-1006.593] (-1006.866) (-1008.419) (-1012.173) * (-1008.835) [-1010.518] (-1014.076) (-1007.578) -- 0:00:43 294000 -- (-1012.905) [-1007.504] (-1008.713) (-1012.069) * (-1009.199) [-1012.428] (-1013.404) (-1009.191) -- 0:00:43 294500 -- [-1008.735] (-1009.997) (-1011.691) (-1006.991) * (-1008.639) (-1011.432) (-1011.135) [-1009.169] -- 0:00:43 295000 -- (-1011.427) (-1010.314) [-1010.737] (-1007.802) * [-1009.857] (-1008.929) (-1007.245) (-1011.377) -- 0:00:43 Average standard deviation of split frequencies: 0.011944 295500 -- (-1011.708) (-1011.025) (-1008.993) [-1007.805] * (-1007.919) (-1008.262) (-1012.459) [-1010.170] -- 0:00:42 296000 -- (-1009.887) (-1008.079) (-1010.669) [-1007.422] * (-1008.192) [-1010.898] (-1009.438) (-1009.372) -- 0:00:42 296500 -- (-1009.103) [-1008.308] (-1014.712) (-1008.462) * [-1014.252] (-1008.411) (-1009.559) (-1012.221) -- 0:00:45 297000 -- [-1008.198] (-1008.581) (-1007.979) (-1008.832) * (-1009.241) (-1008.944) [-1007.509] (-1009.905) -- 0:00:44 297500 -- (-1010.862) [-1007.897] (-1009.698) (-1010.769) * (-1013.645) (-1007.537) [-1008.038] (-1007.673) -- 0:00:44 298000 -- [-1012.064] (-1009.251) (-1012.058) (-1007.173) * (-1007.903) (-1010.938) (-1007.954) [-1007.980] -- 0:00:44 298500 -- (-1008.121) [-1008.827] (-1009.937) (-1015.388) * (-1007.842) [-1008.383] (-1008.091) (-1008.015) -- 0:00:44 299000 -- (-1009.526) [-1009.302] (-1013.645) (-1010.187) * (-1007.686) (-1007.736) (-1013.213) [-1009.349] -- 0:00:44 299500 -- [-1009.751] (-1014.050) (-1006.892) (-1013.466) * (-1007.898) [-1008.630] (-1009.919) (-1013.655) -- 0:00:44 300000 -- (-1009.691) [-1017.025] (-1010.798) (-1013.172) * [-1007.023] (-1009.221) (-1012.965) (-1009.378) -- 0:00:44 Average standard deviation of split frequencies: 0.012194 300500 -- (-1014.070) [-1012.629] (-1010.564) (-1010.281) * (-1007.737) (-1013.664) (-1010.928) [-1007.257] -- 0:00:44 301000 -- (-1012.208) (-1011.851) [-1010.502] (-1008.178) * (-1010.020) (-1010.816) (-1008.563) [-1007.376] -- 0:00:44 301500 -- (-1008.462) (-1010.939) [-1009.197] (-1009.128) * (-1011.086) [-1006.952] (-1011.373) (-1006.854) -- 0:00:44 302000 -- (-1011.636) (-1010.051) [-1008.264] (-1009.604) * (-1011.847) (-1009.016) (-1016.373) [-1007.195] -- 0:00:43 302500 -- (-1011.832) [-1009.463] (-1009.062) (-1008.778) * (-1010.251) [-1009.555] (-1011.801) (-1010.138) -- 0:00:43 303000 -- (-1012.009) (-1009.745) (-1010.106) [-1006.792] * (-1009.909) [-1012.097] (-1014.533) (-1011.648) -- 0:00:43 303500 -- [-1009.160] (-1009.226) (-1011.518) (-1007.168) * (-1007.744) [-1008.598] (-1011.627) (-1009.274) -- 0:00:43 304000 -- (-1008.763) (-1009.114) (-1008.473) [-1009.935] * (-1009.093) [-1009.621] (-1010.267) (-1011.667) -- 0:00:43 304500 -- (-1012.680) [-1008.579] (-1008.583) (-1008.219) * (-1009.253) (-1013.179) [-1014.311] (-1010.290) -- 0:00:43 305000 -- (-1010.919) (-1008.554) [-1008.663] (-1013.671) * [-1008.292] (-1010.793) (-1009.160) (-1007.340) -- 0:00:43 Average standard deviation of split frequencies: 0.011896 305500 -- (-1011.600) (-1008.549) [-1009.674] (-1008.248) * [-1006.645] (-1011.273) (-1008.807) (-1012.226) -- 0:00:43 306000 -- (-1009.114) (-1009.186) [-1008.774] (-1008.794) * (-1006.561) [-1007.477] (-1009.215) (-1013.461) -- 0:00:43 306500 -- (-1007.671) (-1010.054) (-1013.633) [-1007.909] * (-1008.864) (-1009.784) [-1008.232] (-1010.579) -- 0:00:42 307000 -- (-1011.057) (-1012.887) (-1010.946) [-1007.119] * (-1011.944) (-1011.516) (-1010.575) [-1007.920] -- 0:00:42 307500 -- (-1012.430) [-1007.828] (-1012.365) (-1009.775) * (-1007.911) [-1007.622] (-1008.199) (-1009.878) -- 0:00:42 308000 -- [-1008.597] (-1015.074) (-1010.832) (-1007.691) * (-1007.500) (-1011.313) [-1008.178] (-1009.765) -- 0:00:42 308500 -- (-1011.214) (-1012.328) [-1008.724] (-1009.342) * (-1008.607) (-1010.415) (-1008.818) [-1009.883] -- 0:00:42 309000 -- (-1007.720) (-1008.142) [-1007.728] (-1010.842) * (-1007.458) (-1008.670) (-1013.784) [-1008.037] -- 0:00:42 309500 -- (-1009.329) (-1011.239) (-1007.879) [-1008.344] * [-1007.166] (-1007.406) (-1011.131) (-1007.429) -- 0:00:44 310000 -- [-1007.958] (-1006.565) (-1009.060) (-1009.907) * (-1006.861) (-1007.694) (-1011.491) [-1009.466] -- 0:00:44 Average standard deviation of split frequencies: 0.011549 310500 -- [-1007.451] (-1007.239) (-1007.505) (-1008.938) * (-1010.241) (-1011.551) (-1010.482) [-1008.308] -- 0:00:44 311000 -- (-1009.222) [-1007.827] (-1008.219) (-1010.030) * (-1012.901) (-1009.925) [-1009.314] (-1009.030) -- 0:00:44 311500 -- [-1007.739] (-1007.644) (-1010.606) (-1007.922) * [-1008.628] (-1009.091) (-1011.366) (-1008.240) -- 0:00:44 312000 -- (-1006.607) (-1008.811) (-1008.490) [-1008.909] * [-1008.786] (-1012.109) (-1009.276) (-1007.793) -- 0:00:44 312500 -- [-1006.861] (-1008.622) (-1007.456) (-1010.604) * (-1008.369) [-1007.721] (-1006.905) (-1008.006) -- 0:00:44 313000 -- [-1008.519] (-1007.178) (-1008.310) (-1007.491) * (-1009.042) (-1010.323) (-1006.891) [-1007.471] -- 0:00:43 313500 -- (-1007.073) (-1008.076) (-1010.250) [-1008.468] * (-1013.612) (-1008.150) [-1006.576] (-1011.728) -- 0:00:43 314000 -- (-1008.379) (-1008.128) (-1008.887) [-1007.959] * (-1013.607) [-1010.044] (-1007.095) (-1009.664) -- 0:00:43 314500 -- (-1008.022) (-1008.258) [-1010.305] (-1010.220) * (-1008.448) (-1009.476) [-1007.838] (-1008.595) -- 0:00:43 315000 -- (-1007.687) [-1008.743] (-1013.017) (-1009.623) * (-1007.609) (-1007.348) [-1008.549] (-1010.607) -- 0:00:43 Average standard deviation of split frequencies: 0.012183 315500 -- (-1011.337) (-1011.120) [-1009.503] (-1008.219) * (-1007.844) [-1007.335] (-1014.374) (-1014.397) -- 0:00:43 316000 -- (-1009.322) (-1010.646) [-1010.012] (-1008.220) * (-1007.539) [-1007.180] (-1013.122) (-1009.012) -- 0:00:43 316500 -- [-1008.625] (-1012.698) (-1008.546) (-1007.769) * (-1009.019) (-1011.551) [-1007.909] (-1008.047) -- 0:00:43 317000 -- (-1012.611) (-1009.719) [-1007.687] (-1006.971) * (-1011.693) (-1011.840) (-1011.052) [-1010.136] -- 0:00:43 317500 -- (-1007.890) (-1010.406) (-1010.482) [-1007.823] * [-1010.414] (-1008.140) (-1015.960) (-1011.199) -- 0:00:42 318000 -- (-1009.414) [-1008.622] (-1010.888) (-1010.796) * [-1012.298] (-1010.093) (-1014.348) (-1010.101) -- 0:00:42 318500 -- (-1008.908) (-1009.116) [-1010.182] (-1008.434) * (-1009.482) (-1008.243) [-1009.374] (-1009.820) -- 0:00:42 319000 -- (-1008.771) (-1008.395) [-1010.287] (-1008.466) * (-1007.145) [-1009.306] (-1007.958) (-1008.883) -- 0:00:42 319500 -- (-1011.116) (-1011.901) [-1011.071] (-1009.150) * (-1011.281) [-1007.756] (-1009.737) (-1010.898) -- 0:00:42 320000 -- (-1009.800) (-1011.677) (-1010.080) [-1010.782] * [-1009.583] (-1007.917) (-1007.640) (-1007.046) -- 0:00:42 Average standard deviation of split frequencies: 0.012986 320500 -- (-1007.738) (-1012.266) (-1011.775) [-1008.880] * (-1007.643) (-1007.584) [-1007.073] (-1007.017) -- 0:00:42 321000 -- [-1007.850] (-1017.426) (-1013.740) (-1009.626) * [-1006.719] (-1010.679) (-1008.039) (-1007.179) -- 0:00:42 321500 -- (-1006.718) (-1013.084) [-1015.223] (-1007.863) * (-1008.129) (-1007.607) [-1007.451] (-1017.013) -- 0:00:42 322000 -- (-1006.829) (-1012.459) (-1008.911) [-1009.544] * (-1007.328) [-1008.575] (-1012.619) (-1014.964) -- 0:00:42 322500 -- [-1008.945] (-1013.334) (-1010.322) (-1007.941) * (-1008.649) [-1011.568] (-1012.039) (-1013.144) -- 0:00:42 323000 -- [-1009.448] (-1012.415) (-1010.381) (-1015.061) * (-1007.928) [-1009.607] (-1010.900) (-1009.221) -- 0:00:41 323500 -- (-1009.733) (-1008.089) (-1007.545) [-1009.121] * (-1008.358) (-1007.397) [-1014.714] (-1007.948) -- 0:00:41 324000 -- (-1008.551) [-1007.699] (-1006.911) (-1010.366) * (-1007.980) (-1009.730) [-1008.498] (-1009.869) -- 0:00:41 324500 -- (-1010.264) (-1007.490) (-1007.340) [-1010.006] * (-1008.468) [-1007.957] (-1009.699) (-1013.217) -- 0:00:43 325000 -- (-1007.401) [-1008.426] (-1006.882) (-1009.916) * [-1006.620] (-1009.546) (-1007.773) (-1008.940) -- 0:00:43 Average standard deviation of split frequencies: 0.012613 325500 -- [-1008.844] (-1008.291) (-1010.424) (-1010.200) * (-1007.880) [-1008.354] (-1007.311) (-1009.157) -- 0:00:43 326000 -- (-1013.092) (-1009.590) (-1007.184) [-1006.977] * (-1008.446) (-1008.117) (-1006.925) [-1008.757] -- 0:00:43 326500 -- (-1007.292) (-1006.877) [-1006.904] (-1008.742) * (-1009.438) [-1008.354] (-1008.822) (-1009.593) -- 0:00:43 327000 -- (-1009.166) (-1010.777) (-1006.746) [-1010.691] * (-1008.079) (-1008.279) (-1008.373) [-1008.613] -- 0:00:43 327500 -- (-1011.677) (-1008.461) [-1006.813] (-1010.753) * [-1009.408] (-1011.337) (-1010.500) (-1007.766) -- 0:00:43 328000 -- [-1007.219] (-1008.189) (-1006.890) (-1010.807) * (-1007.106) (-1009.355) [-1009.625] (-1007.104) -- 0:00:43 328500 -- (-1008.851) [-1007.661] (-1012.916) (-1009.777) * (-1006.993) [-1008.442] (-1008.821) (-1008.448) -- 0:00:42 329000 -- [-1008.671] (-1008.337) (-1008.868) (-1009.113) * [-1008.529] (-1012.659) (-1007.897) (-1009.649) -- 0:00:42 329500 -- (-1007.995) [-1008.592] (-1009.083) (-1007.505) * (-1007.445) (-1010.536) (-1007.843) [-1009.727] -- 0:00:42 330000 -- (-1013.696) (-1007.358) [-1008.546] (-1007.625) * (-1010.072) [-1009.936] (-1008.904) (-1009.677) -- 0:00:42 Average standard deviation of split frequencies: 0.012514 330500 -- (-1012.866) (-1009.669) [-1007.421] (-1010.144) * (-1009.547) [-1008.700] (-1008.395) (-1010.926) -- 0:00:42 331000 -- (-1009.616) (-1007.809) (-1007.932) [-1010.296] * (-1009.061) [-1008.647] (-1011.587) (-1007.916) -- 0:00:42 331500 -- (-1009.401) [-1009.094] (-1009.473) (-1009.861) * (-1010.167) [-1010.870] (-1010.446) (-1008.920) -- 0:00:42 332000 -- (-1006.785) [-1008.596] (-1010.767) (-1009.096) * (-1008.565) (-1013.466) [-1010.148] (-1009.403) -- 0:00:42 332500 -- (-1006.785) (-1010.650) [-1008.874] (-1012.158) * (-1009.374) (-1013.649) [-1008.001] (-1009.367) -- 0:00:42 333000 -- (-1007.187) (-1009.641) [-1007.934] (-1009.517) * (-1009.172) (-1010.108) [-1008.614] (-1006.766) -- 0:00:42 333500 -- [-1010.291] (-1008.239) (-1007.879) (-1008.320) * (-1014.359) (-1009.319) (-1008.227) [-1007.308] -- 0:00:41 334000 -- (-1012.731) (-1011.530) (-1008.079) [-1012.935] * (-1007.916) (-1013.220) [-1007.707] (-1006.994) -- 0:00:41 334500 -- (-1007.565) (-1008.517) [-1009.503] (-1008.281) * [-1008.224] (-1011.120) (-1009.220) (-1009.886) -- 0:00:41 335000 -- (-1007.127) (-1011.857) [-1007.041] (-1009.529) * [-1007.483] (-1007.667) (-1010.147) (-1006.617) -- 0:00:41 Average standard deviation of split frequencies: 0.012861 335500 -- (-1008.794) (-1012.104) [-1008.443] (-1009.001) * [-1009.260] (-1007.855) (-1010.058) (-1007.506) -- 0:00:41 336000 -- (-1014.747) (-1014.132) [-1007.028] (-1008.438) * [-1010.420] (-1009.014) (-1008.998) (-1008.150) -- 0:00:41 336500 -- (-1010.598) [-1008.104] (-1008.022) (-1010.004) * (-1007.867) [-1008.481] (-1010.444) (-1010.377) -- 0:00:41 337000 -- (-1009.051) (-1010.429) [-1010.136] (-1008.515) * [-1007.813] (-1008.481) (-1012.850) (-1010.434) -- 0:00:41 337500 -- [-1008.354] (-1007.982) (-1008.008) (-1009.953) * (-1008.245) (-1010.132) (-1009.269) [-1008.863] -- 0:00:41 338000 -- (-1007.049) (-1008.971) (-1006.846) [-1008.746] * [-1009.631] (-1010.424) (-1009.992) (-1010.855) -- 0:00:41 338500 -- (-1008.415) [-1009.313] (-1006.856) (-1008.815) * (-1009.085) (-1009.354) (-1008.006) [-1009.334] -- 0:00:41 339000 -- (-1008.293) [-1009.406] (-1013.963) (-1009.447) * (-1009.378) [-1010.720] (-1009.858) (-1009.334) -- 0:00:40 339500 -- (-1007.726) [-1010.645] (-1009.885) (-1011.647) * (-1007.622) [-1008.069] (-1010.370) (-1008.093) -- 0:00:42 340000 -- (-1008.779) (-1010.050) [-1010.223] (-1010.798) * (-1007.241) (-1008.497) (-1007.505) [-1008.190] -- 0:00:42 Average standard deviation of split frequencies: 0.013530 340500 -- (-1007.435) (-1010.579) [-1009.609] (-1009.101) * [-1009.817] (-1008.639) (-1007.810) (-1011.716) -- 0:00:42 341000 -- [-1007.912] (-1008.778) (-1008.040) (-1008.513) * [-1010.464] (-1009.593) (-1010.274) (-1012.857) -- 0:00:42 341500 -- (-1006.983) (-1009.830) [-1007.536] (-1008.993) * [-1010.993] (-1008.906) (-1009.378) (-1012.787) -- 0:00:42 342000 -- (-1009.299) (-1012.006) (-1008.155) [-1008.252] * [-1014.258] (-1009.359) (-1008.843) (-1007.823) -- 0:00:42 342500 -- (-1007.398) (-1010.193) [-1008.023] (-1011.968) * (-1009.303) [-1008.522] (-1008.860) (-1007.500) -- 0:00:42 343000 -- (-1011.387) (-1008.877) (-1008.403) [-1009.643] * (-1007.364) [-1010.846] (-1013.299) (-1007.567) -- 0:00:42 343500 -- (-1009.884) (-1007.830) (-1008.274) [-1008.377] * [-1009.452] (-1012.744) (-1013.170) (-1007.219) -- 0:00:42 344000 -- (-1007.906) (-1011.868) [-1008.918] (-1008.537) * [-1009.167] (-1012.792) (-1009.083) (-1009.265) -- 0:00:41 344500 -- (-1009.697) (-1011.145) [-1007.283] (-1009.267) * [-1010.974] (-1008.439) (-1009.118) (-1007.838) -- 0:00:41 345000 -- (-1010.186) [-1010.392] (-1008.092) (-1010.454) * (-1010.682) [-1009.676] (-1011.912) (-1008.440) -- 0:00:41 Average standard deviation of split frequencies: 0.013776 345500 -- (-1012.425) (-1010.006) (-1010.692) [-1008.156] * [-1007.492] (-1009.511) (-1012.046) (-1008.519) -- 0:00:41 346000 -- [-1010.416] (-1009.640) (-1010.144) (-1010.698) * (-1008.529) [-1012.945] (-1011.715) (-1007.686) -- 0:00:41 346500 -- [-1014.612] (-1013.940) (-1009.938) (-1007.003) * [-1010.628] (-1009.480) (-1009.777) (-1009.119) -- 0:00:41 347000 -- (-1009.308) (-1015.119) (-1011.119) [-1006.576] * [-1007.338] (-1009.044) (-1010.311) (-1007.948) -- 0:00:41 347500 -- (-1010.095) (-1008.765) [-1008.067] (-1011.958) * (-1008.690) (-1008.741) [-1008.997] (-1008.969) -- 0:00:41 348000 -- (-1008.387) [-1009.454] (-1009.310) (-1007.021) * (-1007.108) (-1011.161) [-1009.024] (-1008.745) -- 0:00:41 348500 -- [-1008.181] (-1011.856) (-1009.496) (-1009.474) * (-1007.115) (-1013.543) [-1009.456] (-1012.798) -- 0:00:41 349000 -- (-1008.254) (-1011.221) (-1008.529) [-1007.583] * (-1007.584) [-1011.284] (-1008.844) (-1007.964) -- 0:00:41 349500 -- (-1007.813) [-1009.180] (-1011.546) (-1009.757) * [-1010.255] (-1007.603) (-1011.730) (-1008.806) -- 0:00:40 350000 -- (-1007.346) (-1008.632) (-1010.128) [-1010.186] * (-1011.874) (-1007.667) [-1007.393] (-1012.408) -- 0:00:40 Average standard deviation of split frequencies: 0.014563 350500 -- [-1008.004] (-1008.777) (-1013.972) (-1009.050) * (-1012.617) (-1008.285) (-1008.772) [-1013.789] -- 0:00:40 351000 -- (-1008.935) [-1011.300] (-1013.352) (-1008.258) * (-1008.318) [-1008.616] (-1009.370) (-1008.631) -- 0:00:40 351500 -- (-1007.878) (-1014.125) (-1007.844) [-1009.895] * [-1007.166] (-1006.960) (-1007.853) (-1010.490) -- 0:00:40 352000 -- (-1009.315) (-1012.640) (-1008.729) [-1010.807] * [-1009.342] (-1007.216) (-1009.087) (-1014.261) -- 0:00:40 352500 -- (-1007.335) (-1009.202) (-1007.437) [-1009.512] * (-1011.322) (-1010.619) [-1009.172] (-1012.424) -- 0:00:40 353000 -- (-1008.862) [-1008.960] (-1009.703) (-1008.080) * (-1010.521) (-1010.612) [-1010.729] (-1011.167) -- 0:00:40 353500 -- [-1008.101] (-1013.756) (-1007.163) (-1008.906) * [-1009.543] (-1012.920) (-1012.175) (-1008.676) -- 0:00:40 354000 -- (-1008.594) [-1008.924] (-1008.856) (-1009.741) * (-1008.179) (-1010.052) (-1009.613) [-1008.099] -- 0:00:40 354500 -- (-1008.551) (-1011.196) (-1006.922) [-1008.759] * (-1013.727) (-1007.589) (-1010.679) [-1010.056] -- 0:00:40 355000 -- (-1010.444) [-1012.759] (-1014.727) (-1008.941) * (-1008.563) (-1010.325) [-1008.670] (-1008.418) -- 0:00:41 Average standard deviation of split frequencies: 0.014488 355500 -- (-1010.148) [-1008.949] (-1009.666) (-1007.319) * (-1009.019) (-1007.961) (-1008.555) [-1008.925] -- 0:00:41 356000 -- (-1008.412) (-1010.447) (-1018.747) [-1007.244] * (-1007.900) (-1008.814) (-1007.934) [-1012.189] -- 0:00:41 356500 -- (-1008.947) [-1007.178] (-1014.970) (-1008.566) * (-1012.093) (-1012.083) (-1011.868) [-1007.001] -- 0:00:41 357000 -- (-1008.944) (-1007.219) (-1008.021) [-1008.195] * (-1007.849) [-1010.234] (-1008.176) (-1007.690) -- 0:00:41 357500 -- (-1009.261) [-1008.377] (-1007.085) (-1011.227) * (-1010.237) (-1009.769) (-1008.689) [-1008.166] -- 0:00:41 358000 -- (-1009.922) [-1007.631] (-1009.532) (-1010.169) * (-1007.634) [-1008.487] (-1008.055) (-1007.835) -- 0:00:41 358500 -- (-1013.648) (-1007.355) [-1008.043] (-1007.646) * [-1013.336] (-1007.354) (-1011.561) (-1008.785) -- 0:00:41 359000 -- (-1008.908) (-1008.015) [-1008.112] (-1009.277) * (-1011.348) (-1008.030) [-1009.971] (-1008.461) -- 0:00:41 359500 -- (-1009.451) (-1007.100) [-1007.252] (-1010.943) * (-1011.031) [-1007.936] (-1008.573) (-1008.154) -- 0:00:40 360000 -- (-1009.627) (-1008.090) [-1008.862] (-1010.931) * [-1010.635] (-1006.669) (-1013.198) (-1008.570) -- 0:00:40 Average standard deviation of split frequencies: 0.014685 360500 -- (-1009.395) (-1009.166) [-1008.483] (-1007.480) * (-1011.248) (-1006.554) (-1012.040) [-1008.461] -- 0:00:40 361000 -- [-1009.544] (-1011.441) (-1010.452) (-1013.435) * (-1011.020) [-1007.812] (-1011.716) (-1009.706) -- 0:00:40 361500 -- (-1013.385) (-1006.867) [-1008.514] (-1009.552) * (-1010.293) (-1007.148) [-1008.486] (-1007.774) -- 0:00:40 362000 -- (-1007.655) (-1009.495) [-1007.248] (-1010.134) * (-1009.487) (-1007.981) (-1009.143) [-1008.421] -- 0:00:40 362500 -- (-1008.899) (-1007.277) [-1007.199] (-1009.049) * (-1011.821) (-1008.236) (-1008.252) [-1007.704] -- 0:00:40 363000 -- (-1008.689) [-1006.847] (-1010.022) (-1008.956) * (-1008.385) (-1007.910) [-1012.873] (-1011.871) -- 0:00:40 363500 -- [-1008.051] (-1009.220) (-1010.394) (-1007.853) * (-1009.508) (-1008.046) [-1010.417] (-1014.739) -- 0:00:40 364000 -- (-1008.623) (-1007.799) (-1011.646) [-1008.842] * (-1011.093) (-1010.591) [-1008.740] (-1008.569) -- 0:00:40 364500 -- (-1012.488) (-1008.181) [-1010.913] (-1008.361) * (-1010.114) (-1015.642) [-1006.697] (-1008.569) -- 0:00:40 365000 -- (-1010.965) (-1009.249) (-1011.409) [-1009.026] * (-1008.237) (-1008.236) [-1006.945] (-1008.471) -- 0:00:40 Average standard deviation of split frequencies: 0.015027 365500 -- (-1013.433) [-1009.643] (-1010.419) (-1012.299) * (-1012.441) [-1007.552] (-1008.433) (-1007.775) -- 0:00:39 366000 -- (-1013.579) [-1008.494] (-1007.483) (-1008.532) * (-1009.390) (-1010.946) (-1008.041) [-1008.930] -- 0:00:39 366500 -- (-1011.571) [-1010.161] (-1007.372) (-1008.393) * (-1010.261) (-1008.796) (-1010.473) [-1010.473] -- 0:00:39 367000 -- [-1009.106] (-1008.344) (-1007.982) (-1010.718) * (-1008.090) (-1009.490) [-1010.810] (-1010.380) -- 0:00:39 367500 -- (-1009.440) (-1010.006) [-1006.506] (-1007.666) * (-1011.258) (-1009.725) (-1007.548) [-1009.123] -- 0:00:39 368000 -- (-1014.044) (-1007.048) [-1008.449] (-1010.220) * (-1008.795) (-1009.918) (-1009.847) [-1012.127] -- 0:00:39 368500 -- (-1011.160) (-1007.048) [-1007.777] (-1012.694) * (-1011.707) (-1009.921) [-1011.415] (-1009.611) -- 0:00:39 369000 -- (-1009.082) (-1008.108) [-1008.801] (-1009.561) * (-1008.782) (-1009.015) [-1007.758] (-1007.234) -- 0:00:39 369500 -- (-1007.700) (-1007.808) (-1007.522) [-1008.588] * (-1009.806) (-1007.664) [-1007.818] (-1007.239) -- 0:00:39 370000 -- (-1007.884) (-1011.702) [-1009.200] (-1009.485) * (-1007.693) (-1008.144) (-1008.448) [-1007.509] -- 0:00:39 Average standard deviation of split frequencies: 0.014908 370500 -- [-1009.342] (-1006.747) (-1009.295) (-1008.687) * (-1007.117) (-1010.732) [-1010.027] (-1012.378) -- 0:00:39 371000 -- [-1010.235] (-1006.834) (-1009.766) (-1009.630) * (-1012.233) [-1009.698] (-1007.868) (-1009.676) -- 0:00:40 371500 -- (-1009.680) [-1007.288] (-1007.394) (-1008.740) * (-1011.098) (-1008.425) (-1008.713) [-1009.578] -- 0:00:40 372000 -- (-1011.421) (-1008.803) [-1008.073] (-1012.094) * (-1009.157) [-1007.149] (-1007.529) (-1009.832) -- 0:00:40 372500 -- (-1009.661) (-1008.766) [-1008.340] (-1007.916) * (-1010.146) (-1009.909) (-1010.181) [-1011.209] -- 0:00:40 373000 -- (-1009.322) (-1008.146) (-1008.036) [-1008.015] * (-1010.335) [-1009.016] (-1010.303) (-1008.634) -- 0:00:40 373500 -- (-1010.193) [-1008.862] (-1009.365) (-1012.344) * (-1009.862) [-1010.340] (-1007.838) (-1008.552) -- 0:00:40 374000 -- (-1012.853) (-1009.993) [-1007.971] (-1015.742) * (-1009.473) [-1009.972] (-1008.032) (-1007.731) -- 0:00:40 374500 -- [-1008.182] (-1012.046) (-1008.166) (-1009.403) * (-1010.913) (-1009.708) [-1009.967] (-1010.302) -- 0:00:40 375000 -- (-1009.661) [-1007.804] (-1007.497) (-1009.488) * (-1009.851) (-1010.142) (-1010.527) [-1007.727] -- 0:00:40 Average standard deviation of split frequencies: 0.015184 375500 -- [-1008.482] (-1009.748) (-1009.042) (-1012.925) * [-1008.808] (-1009.826) (-1007.795) (-1007.933) -- 0:00:39 376000 -- (-1008.845) (-1010.542) (-1007.957) [-1007.965] * (-1008.683) [-1008.756] (-1008.398) (-1008.354) -- 0:00:39 376500 -- (-1011.061) (-1008.823) (-1008.691) [-1010.328] * (-1008.799) (-1009.606) (-1007.598) [-1009.351] -- 0:00:39 377000 -- [-1009.773] (-1009.893) (-1009.640) (-1009.738) * (-1008.769) [-1006.975] (-1010.708) (-1009.682) -- 0:00:39 377500 -- [-1010.430] (-1010.726) (-1008.232) (-1011.143) * (-1008.958) (-1007.266) [-1013.712] (-1009.812) -- 0:00:39 378000 -- (-1009.196) (-1007.502) (-1008.490) [-1008.320] * [-1009.283] (-1007.265) (-1007.463) (-1009.681) -- 0:00:39 378500 -- (-1011.582) (-1008.506) (-1015.493) [-1008.136] * (-1009.715) (-1006.704) (-1008.583) [-1007.515] -- 0:00:39 379000 -- [-1007.377] (-1011.491) (-1009.416) (-1008.787) * (-1012.735) (-1008.614) [-1009.785] (-1010.352) -- 0:00:39 379500 -- (-1007.736) [-1011.004] (-1012.061) (-1009.584) * (-1010.039) (-1008.715) [-1008.280] (-1010.987) -- 0:00:39 380000 -- (-1009.556) [-1010.700] (-1007.854) (-1011.443) * (-1008.925) (-1007.747) [-1012.513] (-1008.631) -- 0:00:39 Average standard deviation of split frequencies: 0.015225 380500 -- (-1009.157) [-1009.162] (-1015.083) (-1009.036) * (-1008.359) [-1008.831] (-1007.392) (-1009.408) -- 0:00:39 381000 -- (-1008.996) [-1014.774] (-1007.541) (-1014.945) * [-1007.310] (-1007.413) (-1011.486) (-1007.608) -- 0:00:38 381500 -- (-1011.203) (-1009.400) (-1008.204) [-1007.732] * (-1007.090) (-1011.847) [-1008.592] (-1010.311) -- 0:00:38 382000 -- [-1007.470] (-1009.481) (-1013.145) (-1008.932) * (-1008.395) [-1007.048] (-1008.346) (-1008.536) -- 0:00:38 382500 -- [-1007.925] (-1013.864) (-1008.751) (-1009.238) * [-1010.080] (-1006.965) (-1009.379) (-1008.230) -- 0:00:38 383000 -- (-1008.194) [-1008.677] (-1007.739) (-1007.887) * (-1008.240) (-1007.186) (-1007.581) [-1006.790] -- 0:00:38 383500 -- (-1009.049) (-1007.249) (-1009.369) [-1007.731] * (-1010.999) (-1009.335) (-1008.326) [-1009.999] -- 0:00:38 384000 -- (-1007.121) [-1008.536] (-1010.834) (-1006.633) * [-1010.803] (-1008.826) (-1010.046) (-1011.006) -- 0:00:38 384500 -- [-1007.735] (-1009.685) (-1011.636) (-1006.499) * (-1008.301) [-1007.605] (-1007.464) (-1011.162) -- 0:00:38 385000 -- (-1007.315) [-1011.611] (-1016.251) (-1008.848) * (-1008.495) [-1009.669] (-1007.422) (-1011.159) -- 0:00:38 Average standard deviation of split frequencies: 0.014859 385500 -- [-1007.728] (-1010.968) (-1013.597) (-1012.234) * (-1007.453) (-1011.129) (-1007.525) [-1007.485] -- 0:00:38 386000 -- (-1007.128) (-1009.831) [-1010.012] (-1008.760) * (-1008.984) (-1009.483) [-1007.426] (-1007.487) -- 0:00:38 386500 -- (-1006.899) (-1009.590) [-1009.672] (-1008.508) * (-1008.236) [-1010.481] (-1009.392) (-1010.905) -- 0:00:38 387000 -- (-1008.029) (-1008.206) (-1008.890) [-1007.060] * (-1007.356) (-1014.616) (-1011.481) [-1009.844] -- 0:00:38 387500 -- (-1009.672) (-1007.762) [-1007.506] (-1012.903) * [-1008.874] (-1010.648) (-1008.374) (-1010.450) -- 0:00:39 388000 -- (-1009.072) [-1010.176] (-1008.239) (-1008.840) * [-1007.406] (-1008.979) (-1008.031) (-1007.564) -- 0:00:39 388500 -- (-1011.202) (-1010.318) (-1008.138) [-1010.660] * (-1006.693) [-1007.968] (-1008.317) (-1008.434) -- 0:00:39 389000 -- (-1010.744) [-1006.718] (-1008.727) (-1008.780) * (-1007.366) (-1011.877) (-1009.964) [-1008.421] -- 0:00:39 389500 -- [-1008.296] (-1010.610) (-1008.341) (-1010.750) * (-1008.712) (-1012.560) [-1009.315] (-1011.335) -- 0:00:39 390000 -- [-1010.705] (-1010.146) (-1007.887) (-1014.897) * (-1007.636) (-1008.082) [-1007.787] (-1012.143) -- 0:00:39 Average standard deviation of split frequencies: 0.014681 390500 -- (-1008.819) (-1007.286) (-1008.511) [-1008.527] * (-1012.470) [-1008.436] (-1006.986) (-1007.489) -- 0:00:39 391000 -- [-1007.545] (-1007.289) (-1008.117) (-1009.076) * (-1009.247) (-1008.048) (-1007.614) [-1007.824] -- 0:00:38 391500 -- [-1008.188] (-1007.554) (-1008.121) (-1011.015) * (-1007.592) (-1009.407) (-1010.223) [-1007.126] -- 0:00:38 392000 -- (-1011.439) [-1007.746] (-1007.371) (-1010.783) * (-1009.359) (-1009.513) [-1011.049] (-1007.754) -- 0:00:38 392500 -- (-1012.843) (-1006.843) [-1010.524] (-1009.284) * (-1010.616) (-1011.223) (-1012.374) [-1008.928] -- 0:00:38 393000 -- (-1012.773) (-1008.345) (-1009.467) [-1011.002] * (-1009.760) (-1011.220) (-1007.848) [-1007.678] -- 0:00:38 393500 -- (-1012.493) [-1010.453] (-1008.481) (-1015.094) * (-1008.233) [-1008.736] (-1012.914) (-1014.625) -- 0:00:38 394000 -- (-1011.758) (-1011.068) [-1008.806] (-1007.125) * (-1007.713) (-1008.634) [-1009.472] (-1008.827) -- 0:00:38 394500 -- (-1011.496) (-1008.296) [-1006.746] (-1008.221) * (-1010.605) (-1009.218) [-1008.630] (-1011.565) -- 0:00:38 395000 -- (-1008.822) (-1008.660) (-1008.727) [-1007.130] * (-1008.021) (-1009.385) [-1007.598] (-1013.820) -- 0:00:38 Average standard deviation of split frequencies: 0.014915 395500 -- (-1011.830) [-1007.598] (-1008.882) (-1010.103) * (-1011.752) (-1008.936) (-1009.147) [-1009.532] -- 0:00:38 396000 -- (-1008.312) [-1008.824] (-1007.550) (-1007.188) * (-1009.212) [-1007.760] (-1008.268) (-1007.165) -- 0:00:38 396500 -- (-1007.757) [-1008.316] (-1008.963) (-1007.685) * (-1009.119) (-1008.523) [-1009.192] (-1007.053) -- 0:00:38 397000 -- (-1007.272) (-1008.721) (-1007.313) [-1007.368] * (-1009.207) [-1011.418] (-1006.856) (-1009.234) -- 0:00:37 397500 -- (-1007.390) [-1010.056] (-1013.159) (-1011.042) * (-1010.135) (-1010.904) (-1007.656) [-1008.393] -- 0:00:37 398000 -- (-1007.100) [-1008.377] (-1007.707) (-1013.704) * [-1007.743] (-1006.780) (-1010.376) (-1009.156) -- 0:00:37 398500 -- (-1007.339) [-1007.987] (-1008.210) (-1008.140) * (-1009.975) [-1008.529] (-1008.392) (-1009.601) -- 0:00:37 399000 -- (-1006.723) [-1007.175] (-1008.869) (-1010.065) * (-1007.759) (-1009.149) [-1007.717] (-1008.379) -- 0:00:37 399500 -- (-1011.187) [-1008.079] (-1008.449) (-1009.797) * (-1007.387) [-1014.059] (-1007.746) (-1008.625) -- 0:00:37 400000 -- (-1010.969) [-1009.709] (-1008.793) (-1010.995) * [-1008.259] (-1013.258) (-1011.146) (-1010.752) -- 0:00:37 Average standard deviation of split frequencies: 0.014395 400500 -- (-1010.961) [-1007.624] (-1017.349) (-1009.565) * (-1008.665) (-1014.041) (-1009.552) [-1012.238] -- 0:00:37 401000 -- [-1010.264] (-1006.930) (-1016.652) (-1010.833) * (-1007.698) (-1011.746) (-1010.390) [-1007.084] -- 0:00:37 401500 -- (-1011.482) (-1007.953) (-1008.723) [-1008.425] * [-1007.202] (-1008.556) (-1009.285) (-1008.442) -- 0:00:37 402000 -- (-1009.314) [-1006.868] (-1006.728) (-1009.708) * (-1016.079) (-1010.118) (-1008.042) [-1008.204] -- 0:00:37 402500 -- [-1011.680] (-1008.560) (-1010.161) (-1011.376) * (-1007.180) (-1012.961) [-1009.158] (-1008.473) -- 0:00:37 403000 -- [-1010.034] (-1010.062) (-1009.555) (-1007.028) * (-1010.034) (-1010.300) (-1008.976) [-1007.224] -- 0:00:37 403500 -- [-1010.443] (-1009.644) (-1010.833) (-1012.383) * (-1013.120) [-1009.452] (-1008.941) (-1008.397) -- 0:00:38 404000 -- (-1008.696) (-1009.677) (-1007.235) [-1010.805] * (-1011.898) [-1011.921] (-1011.295) (-1011.558) -- 0:00:38 404500 -- [-1007.117] (-1013.285) (-1008.626) (-1011.131) * (-1012.397) (-1008.175) (-1007.859) [-1007.423] -- 0:00:38 405000 -- [-1006.969] (-1016.497) (-1010.616) (-1011.181) * (-1008.199) (-1008.050) [-1011.272] (-1008.710) -- 0:00:38 Average standard deviation of split frequencies: 0.013592 405500 -- (-1006.873) [-1009.590] (-1009.575) (-1008.972) * (-1011.967) (-1012.792) [-1008.133] (-1012.662) -- 0:00:38 406000 -- [-1008.681] (-1009.995) (-1009.944) (-1011.925) * [-1008.819] (-1014.892) (-1007.355) (-1009.074) -- 0:00:38 406500 -- (-1009.735) (-1008.469) (-1010.962) [-1008.329] * (-1007.417) (-1008.527) (-1007.574) [-1011.915] -- 0:00:37 407000 -- (-1009.015) (-1009.725) [-1009.679] (-1006.785) * (-1007.835) (-1007.373) (-1008.749) [-1010.474] -- 0:00:37 407500 -- (-1011.745) [-1009.168] (-1008.794) (-1006.847) * [-1008.669] (-1009.054) (-1011.901) (-1008.699) -- 0:00:37 408000 -- (-1009.415) (-1011.104) (-1007.208) [-1010.034] * (-1007.408) [-1007.415] (-1008.407) (-1010.099) -- 0:00:37 408500 -- [-1009.865] (-1007.826) (-1010.098) (-1009.800) * (-1008.623) (-1008.112) (-1009.294) [-1009.667] -- 0:00:37 409000 -- (-1012.283) (-1009.526) (-1011.043) [-1009.400] * (-1012.760) (-1009.113) (-1010.794) [-1009.954] -- 0:00:37 409500 -- (-1009.159) (-1012.295) (-1010.018) [-1009.197] * (-1008.276) (-1009.881) (-1009.308) [-1009.147] -- 0:00:37 410000 -- (-1010.078) (-1009.184) [-1013.311] (-1007.452) * [-1007.705] (-1006.449) (-1009.132) (-1012.528) -- 0:00:37 Average standard deviation of split frequencies: 0.013100 410500 -- (-1008.784) (-1007.515) [-1009.535] (-1008.030) * (-1010.405) [-1006.745] (-1008.822) (-1009.072) -- 0:00:37 411000 -- [-1007.353] (-1007.137) (-1008.521) (-1011.415) * [-1008.372] (-1008.600) (-1008.098) (-1010.509) -- 0:00:37 411500 -- (-1007.307) [-1008.447] (-1007.900) (-1009.124) * (-1008.444) (-1007.727) [-1006.735] (-1010.648) -- 0:00:37 412000 -- (-1007.641) [-1008.664] (-1008.161) (-1010.038) * (-1007.991) [-1007.101] (-1009.250) (-1007.802) -- 0:00:37 412500 -- (-1011.231) [-1006.766] (-1009.381) (-1006.905) * (-1008.480) (-1007.514) [-1011.290] (-1007.122) -- 0:00:37 413000 -- (-1011.155) (-1009.146) [-1007.323] (-1011.491) * (-1009.150) [-1010.322] (-1008.075) (-1007.089) -- 0:00:36 413500 -- (-1008.147) (-1007.215) (-1008.863) [-1013.190] * (-1009.256) (-1010.348) [-1009.877] (-1008.297) -- 0:00:36 414000 -- (-1009.296) [-1010.277] (-1007.205) (-1012.162) * (-1010.946) [-1007.857] (-1009.605) (-1008.432) -- 0:00:36 414500 -- (-1006.923) (-1012.795) [-1009.473] (-1010.099) * (-1009.604) [-1008.275] (-1010.524) (-1007.073) -- 0:00:36 415000 -- (-1008.308) [-1009.486] (-1010.684) (-1008.890) * (-1009.414) (-1011.591) [-1010.857] (-1009.135) -- 0:00:36 Average standard deviation of split frequencies: 0.012890 415500 -- [-1009.264] (-1008.101) (-1009.024) (-1017.417) * [-1011.729] (-1011.332) (-1013.870) (-1008.650) -- 0:00:36 416000 -- (-1011.486) [-1008.601] (-1010.039) (-1015.655) * [-1007.516] (-1007.576) (-1012.950) (-1008.689) -- 0:00:36 416500 -- (-1011.470) [-1010.989] (-1011.899) (-1013.384) * (-1010.454) [-1009.987] (-1009.045) (-1010.543) -- 0:00:36 417000 -- [-1009.680] (-1010.029) (-1008.560) (-1009.648) * (-1009.122) (-1009.010) [-1011.486] (-1011.333) -- 0:00:36 417500 -- [-1008.667] (-1009.273) (-1009.058) (-1007.528) * [-1008.895] (-1009.370) (-1008.592) (-1009.779) -- 0:00:36 418000 -- [-1007.660] (-1007.800) (-1008.235) (-1007.825) * [-1009.199] (-1013.115) (-1007.900) (-1008.212) -- 0:00:36 418500 -- [-1007.393] (-1008.005) (-1009.955) (-1006.666) * (-1010.631) (-1011.472) [-1008.714] (-1008.221) -- 0:00:36 419000 -- (-1011.401) (-1009.662) (-1010.212) [-1008.141] * (-1009.991) [-1009.911] (-1007.368) (-1007.466) -- 0:00:36 419500 -- (-1007.048) [-1012.233] (-1007.585) (-1008.200) * (-1008.854) (-1007.750) [-1007.010] (-1011.210) -- 0:00:35 420000 -- (-1010.268) (-1007.530) (-1009.896) [-1008.290] * (-1011.801) (-1010.211) (-1008.666) [-1008.664] -- 0:00:37 Average standard deviation of split frequencies: 0.012187 420500 -- (-1008.653) (-1009.977) [-1014.033] (-1008.904) * (-1008.911) [-1009.222] (-1008.953) (-1014.008) -- 0:00:37 421000 -- [-1009.289] (-1010.284) (-1008.376) (-1008.531) * (-1008.105) [-1008.255] (-1009.913) (-1012.707) -- 0:00:37 421500 -- (-1010.228) (-1010.140) [-1012.219] (-1008.318) * [-1008.159] (-1007.290) (-1007.982) (-1009.345) -- 0:00:37 422000 -- (-1007.781) (-1009.543) (-1008.946) [-1008.910] * (-1008.017) [-1009.736] (-1008.465) (-1010.610) -- 0:00:36 422500 -- (-1010.443) [-1009.319] (-1011.443) (-1009.460) * [-1006.863] (-1009.529) (-1011.832) (-1008.816) -- 0:00:36 423000 -- (-1008.798) (-1007.868) (-1009.012) [-1009.461] * (-1008.258) [-1010.830] (-1010.103) (-1008.391) -- 0:00:36 423500 -- (-1010.290) (-1007.342) [-1009.128] (-1011.235) * [-1009.275] (-1009.863) (-1009.252) (-1015.236) -- 0:00:36 424000 -- (-1008.503) [-1007.397] (-1013.003) (-1007.694) * [-1012.800] (-1010.778) (-1007.928) (-1015.524) -- 0:00:36 424500 -- (-1019.274) (-1008.014) (-1011.309) [-1007.451] * (-1009.922) [-1007.729] (-1010.351) (-1010.041) -- 0:00:36 425000 -- (-1013.350) (-1010.184) (-1011.467) [-1006.861] * [-1008.276] (-1008.957) (-1009.822) (-1009.533) -- 0:00:36 Average standard deviation of split frequencies: 0.013214 425500 -- (-1020.069) [-1012.077] (-1010.787) (-1009.933) * (-1009.594) (-1011.775) (-1011.002) [-1007.538] -- 0:00:36 426000 -- (-1008.216) (-1008.453) [-1009.132] (-1009.844) * (-1007.546) [-1010.256] (-1006.999) (-1007.845) -- 0:00:36 426500 -- (-1011.927) [-1006.930] (-1010.640) (-1008.218) * (-1015.481) (-1009.799) [-1007.778] (-1012.970) -- 0:00:36 427000 -- (-1009.631) [-1007.004] (-1007.737) (-1009.860) * (-1008.195) (-1007.473) [-1008.002] (-1009.593) -- 0:00:36 427500 -- (-1007.172) (-1007.011) (-1009.777) [-1008.029] * [-1008.179] (-1009.633) (-1013.784) (-1008.543) -- 0:00:36 428000 -- (-1008.747) (-1007.935) [-1007.367] (-1010.490) * [-1009.160] (-1009.124) (-1009.398) (-1008.372) -- 0:00:36 428500 -- (-1007.591) (-1006.963) [-1008.693] (-1011.577) * [-1007.786] (-1009.644) (-1008.224) (-1007.830) -- 0:00:36 429000 -- (-1008.737) (-1007.029) [-1008.901] (-1011.282) * [-1009.416] (-1010.040) (-1010.350) (-1008.443) -- 0:00:35 429500 -- (-1007.695) (-1007.215) [-1009.791] (-1010.619) * [-1007.715] (-1009.400) (-1008.619) (-1008.920) -- 0:00:35 430000 -- (-1008.163) (-1007.687) [-1010.759] (-1008.923) * (-1009.318) (-1009.611) (-1011.604) [-1008.699] -- 0:00:35 Average standard deviation of split frequencies: 0.013272 430500 -- (-1008.247) (-1011.962) [-1014.330] (-1007.346) * (-1011.154) (-1008.435) (-1008.834) [-1006.970] -- 0:00:35 431000 -- (-1009.558) (-1010.298) (-1015.634) [-1007.659] * [-1010.457] (-1007.960) (-1008.442) (-1006.974) -- 0:00:35 431500 -- (-1012.930) [-1010.469] (-1011.045) (-1009.233) * (-1008.626) (-1007.969) (-1008.031) [-1006.965] -- 0:00:35 432000 -- [-1006.987] (-1008.084) (-1007.676) (-1008.904) * (-1008.778) [-1010.626] (-1011.223) (-1006.900) -- 0:00:35 432500 -- (-1007.449) [-1010.775] (-1006.979) (-1008.348) * (-1007.835) (-1012.387) [-1008.470] (-1015.714) -- 0:00:35 433000 -- (-1007.663) [-1008.652] (-1014.044) (-1011.570) * (-1006.693) (-1010.725) [-1011.405] (-1013.646) -- 0:00:35 433500 -- (-1011.815) [-1010.197] (-1015.107) (-1008.667) * [-1006.708] (-1008.432) (-1013.573) (-1012.475) -- 0:00:35 434000 -- [-1011.413] (-1010.089) (-1011.914) (-1009.315) * (-1007.922) (-1008.072) (-1014.567) [-1008.104] -- 0:00:35 434500 -- (-1012.879) (-1007.193) (-1008.728) [-1009.534] * (-1009.525) [-1010.321] (-1010.541) (-1011.589) -- 0:00:35 435000 -- (-1012.607) (-1008.313) (-1009.232) [-1007.872] * (-1009.123) [-1009.216] (-1008.215) (-1011.972) -- 0:00:35 Average standard deviation of split frequencies: 0.013583 435500 -- (-1010.162) (-1008.747) (-1007.874) [-1008.934] * (-1007.340) (-1007.700) (-1010.513) [-1008.082] -- 0:00:34 436000 -- (-1008.767) [-1007.840] (-1013.437) (-1008.262) * (-1007.495) [-1008.832] (-1007.659) (-1009.027) -- 0:00:36 436500 -- [-1009.847] (-1007.353) (-1008.136) (-1007.934) * [-1010.931] (-1007.891) (-1008.855) (-1007.546) -- 0:00:36 437000 -- (-1008.703) [-1007.492] (-1008.451) (-1007.901) * (-1008.847) (-1008.558) (-1010.025) [-1011.094] -- 0:00:36 437500 -- (-1013.795) (-1008.632) [-1008.517] (-1009.288) * (-1006.547) [-1008.375] (-1008.431) (-1009.786) -- 0:00:36 438000 -- [-1010.012] (-1013.240) (-1010.700) (-1011.600) * (-1008.017) (-1009.632) (-1009.221) [-1009.952] -- 0:00:35 438500 -- (-1008.843) (-1009.116) [-1008.751] (-1009.801) * (-1007.878) [-1009.286] (-1008.122) (-1007.747) -- 0:00:35 439000 -- (-1008.916) (-1007.612) [-1007.791] (-1010.823) * (-1010.820) (-1011.353) [-1007.440] (-1009.000) -- 0:00:35 439500 -- [-1010.022] (-1008.134) (-1008.920) (-1011.183) * (-1009.559) (-1010.682) [-1008.965] (-1007.802) -- 0:00:35 440000 -- [-1009.839] (-1011.778) (-1011.216) (-1007.856) * (-1007.627) [-1015.128] (-1012.969) (-1008.335) -- 0:00:35 Average standard deviation of split frequencies: 0.012703 440500 -- [-1009.018] (-1009.546) (-1008.038) (-1007.542) * (-1007.645) (-1011.597) [-1006.972] (-1010.582) -- 0:00:35 441000 -- (-1008.621) [-1007.779] (-1008.315) (-1007.039) * (-1009.206) (-1008.596) [-1007.133] (-1009.335) -- 0:00:35 441500 -- (-1007.309) [-1010.937] (-1010.116) (-1007.935) * (-1008.356) (-1007.365) [-1009.618] (-1007.924) -- 0:00:35 442000 -- (-1008.083) (-1011.369) (-1010.954) [-1007.308] * (-1007.598) (-1008.378) [-1008.552] (-1009.193) -- 0:00:35 442500 -- (-1011.429) (-1009.232) [-1007.096] (-1008.999) * (-1011.662) (-1007.767) [-1008.117] (-1008.960) -- 0:00:35 443000 -- (-1007.411) (-1008.348) [-1007.833] (-1010.406) * (-1011.030) (-1008.825) [-1007.886] (-1007.145) -- 0:00:35 443500 -- [-1008.074] (-1009.181) (-1008.061) (-1008.836) * (-1010.231) (-1009.319) [-1006.966] (-1007.895) -- 0:00:35 444000 -- (-1007.771) [-1010.268] (-1008.343) (-1007.889) * [-1008.022] (-1008.787) (-1007.171) (-1007.266) -- 0:00:35 444500 -- (-1010.894) (-1010.395) (-1010.065) [-1008.423] * (-1008.606) (-1007.447) [-1009.640] (-1008.076) -- 0:00:34 445000 -- (-1013.027) [-1012.344] (-1008.185) (-1007.752) * (-1008.786) [-1008.612] (-1010.160) (-1007.246) -- 0:00:34 Average standard deviation of split frequencies: 0.012621 445500 -- (-1010.184) (-1011.849) [-1007.702] (-1008.768) * (-1008.722) [-1009.617] (-1009.638) (-1007.310) -- 0:00:34 446000 -- (-1010.189) (-1012.179) (-1010.420) [-1008.330] * (-1008.224) (-1007.842) (-1014.470) [-1010.477] -- 0:00:34 446500 -- (-1010.385) (-1006.641) [-1012.598] (-1008.482) * (-1011.931) (-1008.698) (-1012.404) [-1009.463] -- 0:00:34 447000 -- [-1007.457] (-1008.584) (-1013.279) (-1013.945) * (-1007.846) [-1009.687] (-1011.271) (-1007.666) -- 0:00:34 447500 -- (-1007.549) (-1007.476) (-1011.502) [-1010.452] * (-1007.146) (-1007.842) [-1010.532] (-1009.040) -- 0:00:34 448000 -- (-1009.469) (-1007.677) [-1008.804] (-1006.992) * (-1010.366) (-1008.049) (-1010.047) [-1009.685] -- 0:00:34 448500 -- (-1009.629) (-1007.405) (-1009.761) [-1010.035] * (-1008.791) (-1009.621) (-1014.030) [-1008.078] -- 0:00:34 449000 -- (-1008.910) [-1011.000] (-1010.336) (-1013.104) * (-1012.286) (-1013.181) [-1008.134] (-1010.559) -- 0:00:34 449500 -- (-1010.711) [-1007.818] (-1010.733) (-1012.863) * (-1010.927) (-1009.491) (-1009.309) [-1008.377] -- 0:00:34 450000 -- [-1010.211] (-1013.894) (-1009.418) (-1008.676) * (-1008.516) [-1006.794] (-1014.304) (-1008.391) -- 0:00:34 Average standard deviation of split frequencies: 0.013106 450500 -- (-1008.937) (-1009.188) [-1008.869] (-1009.483) * (-1010.836) (-1008.150) (-1011.351) [-1008.844] -- 0:00:34 451000 -- [-1008.148] (-1008.285) (-1009.756) (-1009.789) * (-1007.859) (-1008.307) [-1009.376] (-1008.310) -- 0:00:34 451500 -- [-1014.973] (-1008.991) (-1008.840) (-1010.442) * (-1009.294) [-1008.996] (-1007.941) (-1007.962) -- 0:00:34 452000 -- (-1013.511) (-1009.498) [-1007.481] (-1007.501) * [-1009.365] (-1008.709) (-1008.678) (-1012.553) -- 0:00:33 452500 -- (-1012.145) (-1007.816) (-1010.250) [-1010.636] * (-1009.467) [-1008.646] (-1010.065) (-1009.106) -- 0:00:35 453000 -- (-1011.797) (-1007.967) [-1007.876] (-1013.358) * (-1007.914) (-1010.990) (-1008.367) [-1006.854] -- 0:00:35 453500 -- [-1009.083] (-1007.967) (-1008.052) (-1009.814) * (-1009.363) [-1007.077] (-1014.038) (-1009.525) -- 0:00:34 454000 -- [-1010.284] (-1008.970) (-1009.441) (-1007.378) * (-1009.080) (-1006.953) (-1010.453) [-1007.179] -- 0:00:34 454500 -- [-1008.927] (-1009.885) (-1008.035) (-1007.053) * (-1008.388) (-1008.032) (-1009.649) [-1010.454] -- 0:00:34 455000 -- (-1008.298) [-1009.132] (-1010.168) (-1009.545) * [-1009.893] (-1006.656) (-1009.266) (-1008.529) -- 0:00:34 Average standard deviation of split frequencies: 0.013310 455500 -- (-1008.104) [-1008.383] (-1010.896) (-1012.188) * (-1010.297) [-1006.657] (-1007.368) (-1008.401) -- 0:00:34 456000 -- (-1013.154) (-1009.220) [-1009.799] (-1009.909) * (-1011.732) (-1011.670) (-1007.361) [-1008.031] -- 0:00:34 456500 -- (-1008.494) (-1007.748) (-1007.791) [-1010.164] * [-1007.735] (-1014.546) (-1007.122) (-1007.718) -- 0:00:34 457000 -- (-1007.204) [-1009.097] (-1008.402) (-1011.969) * [-1009.588] (-1009.246) (-1008.805) (-1009.120) -- 0:00:34 457500 -- [-1009.428] (-1008.535) (-1012.080) (-1010.541) * (-1008.344) (-1008.772) (-1008.030) [-1009.093] -- 0:00:34 458000 -- (-1007.432) [-1007.729] (-1011.517) (-1010.397) * [-1008.150] (-1011.856) (-1008.695) (-1012.661) -- 0:00:34 458500 -- (-1006.997) (-1007.229) [-1009.135] (-1014.564) * (-1008.921) (-1007.857) [-1011.032] (-1010.481) -- 0:00:34 459000 -- [-1006.775] (-1010.669) (-1009.050) (-1009.020) * (-1007.531) [-1007.877] (-1008.079) (-1014.242) -- 0:00:34 459500 -- [-1011.733] (-1011.056) (-1011.860) (-1007.277) * (-1013.796) (-1009.000) [-1007.234] (-1013.439) -- 0:00:34 460000 -- (-1008.052) (-1010.079) [-1007.832] (-1008.306) * [-1007.305] (-1008.452) (-1006.795) (-1010.180) -- 0:00:34 Average standard deviation of split frequencies: 0.013495 460500 -- [-1011.941] (-1010.981) (-1007.011) (-1008.291) * (-1007.678) [-1008.082] (-1008.443) (-1009.240) -- 0:00:33 461000 -- (-1009.366) [-1009.728] (-1012.672) (-1008.530) * [-1010.690] (-1007.863) (-1008.771) (-1011.299) -- 0:00:33 461500 -- (-1009.763) [-1007.460] (-1008.135) (-1007.187) * (-1012.784) (-1012.401) [-1007.800] (-1012.177) -- 0:00:33 462000 -- (-1007.003) (-1006.661) (-1009.749) [-1007.024] * (-1012.204) [-1008.126] (-1008.905) (-1010.020) -- 0:00:33 462500 -- (-1012.098) (-1011.410) [-1011.043] (-1010.063) * (-1010.593) (-1007.470) (-1014.710) [-1012.612] -- 0:00:33 463000 -- (-1014.937) (-1011.696) [-1008.627] (-1009.020) * (-1011.266) (-1006.743) [-1007.507] (-1014.286) -- 0:00:33 463500 -- (-1013.248) [-1007.546] (-1010.075) (-1008.136) * [-1009.551] (-1009.251) (-1007.165) (-1009.213) -- 0:00:33 464000 -- (-1009.825) [-1007.937] (-1007.195) (-1008.730) * [-1008.610] (-1009.440) (-1008.129) (-1010.365) -- 0:00:33 464500 -- (-1009.194) (-1008.047) [-1007.311] (-1008.408) * (-1009.818) (-1006.857) [-1008.358] (-1007.729) -- 0:00:33 465000 -- [-1008.327] (-1007.806) (-1008.607) (-1008.158) * (-1010.351) (-1007.646) [-1008.292] (-1012.601) -- 0:00:33 Average standard deviation of split frequencies: 0.012645 465500 -- [-1007.303] (-1009.054) (-1008.416) (-1012.782) * [-1008.230] (-1010.276) (-1008.414) (-1008.829) -- 0:00:33 466000 -- (-1008.405) [-1007.046] (-1008.772) (-1008.951) * [-1007.337] (-1008.976) (-1011.812) (-1014.593) -- 0:00:33 466500 -- (-1010.673) (-1008.749) [-1009.650] (-1008.929) * [-1010.993] (-1010.505) (-1009.181) (-1008.438) -- 0:00:33 467000 -- (-1011.257) (-1012.233) [-1009.346] (-1010.069) * (-1010.932) [-1007.948] (-1011.956) (-1008.602) -- 0:00:33 467500 -- (-1010.615) [-1011.355] (-1012.398) (-1010.824) * (-1008.578) (-1009.381) [-1010.060] (-1011.742) -- 0:00:33 468000 -- (-1007.334) (-1010.646) [-1009.620] (-1008.684) * (-1008.103) [-1009.533] (-1009.627) (-1010.415) -- 0:00:32 468500 -- [-1007.647] (-1011.472) (-1010.445) (-1009.716) * (-1009.964) (-1008.437) [-1006.909] (-1007.818) -- 0:00:32 469000 -- (-1008.929) [-1009.329] (-1008.633) (-1014.753) * (-1008.996) [-1007.888] (-1008.898) (-1007.471) -- 0:00:33 469500 -- (-1011.573) [-1008.786] (-1008.743) (-1007.555) * (-1008.908) (-1011.008) (-1013.456) [-1010.906] -- 0:00:33 470000 -- [-1008.657] (-1011.462) (-1011.968) (-1006.869) * (-1010.662) (-1010.234) (-1014.475) [-1008.797] -- 0:00:33 Average standard deviation of split frequencies: 0.012457 470500 -- [-1009.151] (-1008.222) (-1010.113) (-1008.245) * [-1010.077] (-1008.031) (-1014.673) (-1011.832) -- 0:00:33 471000 -- (-1009.219) (-1007.277) (-1012.481) [-1007.609] * (-1008.152) [-1007.513] (-1009.512) (-1011.993) -- 0:00:33 471500 -- (-1012.413) (-1009.053) (-1011.041) [-1008.610] * (-1012.404) (-1011.102) [-1009.685] (-1013.530) -- 0:00:33 472000 -- (-1009.732) (-1008.586) (-1007.587) [-1009.171] * (-1010.685) [-1008.333] (-1008.033) (-1011.172) -- 0:00:33 472500 -- (-1008.725) (-1009.693) [-1007.531] (-1011.398) * (-1010.250) [-1009.733] (-1013.286) (-1009.415) -- 0:00:33 473000 -- (-1007.885) (-1009.366) [-1009.115] (-1010.437) * [-1006.879] (-1008.355) (-1012.685) (-1009.272) -- 0:00:33 473500 -- (-1010.096) (-1011.976) (-1007.681) [-1006.651] * (-1009.047) (-1007.452) (-1008.767) [-1007.805] -- 0:00:33 474000 -- (-1011.046) [-1008.502] (-1009.082) (-1008.015) * (-1009.919) (-1008.262) [-1009.586] (-1008.249) -- 0:00:33 474500 -- [-1008.992] (-1009.831) (-1007.762) (-1007.334) * (-1006.716) [-1007.352] (-1010.901) (-1007.342) -- 0:00:33 475000 -- (-1012.465) (-1007.549) [-1008.348] (-1009.532) * (-1007.828) [-1007.057] (-1014.552) (-1007.420) -- 0:00:33 Average standard deviation of split frequencies: 0.011698 475500 -- (-1010.611) (-1011.074) [-1010.903] (-1010.270) * (-1011.326) (-1007.451) [-1014.301] (-1011.530) -- 0:00:33 476000 -- (-1007.956) [-1009.786] (-1008.157) (-1009.629) * [-1008.123] (-1011.112) (-1009.505) (-1009.689) -- 0:00:33 476500 -- (-1011.100) [-1009.885] (-1011.159) (-1007.557) * (-1010.150) (-1009.204) [-1008.892] (-1007.030) -- 0:00:32 477000 -- (-1009.041) (-1014.187) [-1006.763] (-1007.376) * (-1013.653) (-1011.547) [-1011.750] (-1010.259) -- 0:00:32 477500 -- (-1014.435) [-1009.991] (-1008.954) (-1009.459) * (-1009.609) (-1010.025) (-1011.313) [-1009.462] -- 0:00:32 478000 -- (-1010.232) (-1009.474) [-1010.947] (-1009.402) * (-1008.428) (-1008.135) (-1015.286) [-1008.390] -- 0:00:32 478500 -- [-1009.385] (-1010.478) (-1009.825) (-1010.436) * (-1007.325) (-1009.363) (-1011.568) [-1007.929] -- 0:00:32 479000 -- (-1009.968) (-1008.605) (-1008.349) [-1014.019] * [-1007.615] (-1006.847) (-1009.826) (-1008.687) -- 0:00:32 479500 -- [-1008.067] (-1009.632) (-1006.879) (-1010.637) * (-1008.254) [-1009.065] (-1008.532) (-1009.135) -- 0:00:32 480000 -- (-1007.276) (-1008.617) [-1006.887] (-1010.176) * [-1008.811] (-1009.386) (-1008.427) (-1009.485) -- 0:00:32 Average standard deviation of split frequencies: 0.012014 480500 -- (-1011.190) (-1009.540) [-1007.287] (-1008.797) * (-1009.722) (-1009.125) [-1007.641] (-1007.094) -- 0:00:32 481000 -- (-1007.374) (-1008.304) [-1008.967] (-1010.558) * [-1008.171] (-1007.535) (-1009.219) (-1010.117) -- 0:00:32 481500 -- (-1012.628) (-1008.242) (-1011.072) [-1008.052] * (-1010.061) [-1011.702] (-1007.358) (-1008.720) -- 0:00:32 482000 -- (-1007.873) [-1006.701] (-1007.034) (-1009.428) * (-1011.317) (-1012.262) [-1009.420] (-1008.296) -- 0:00:32 482500 -- (-1010.401) (-1007.571) (-1007.472) [-1009.849] * (-1010.922) (-1009.363) [-1008.115] (-1010.670) -- 0:00:32 483000 -- (-1008.159) [-1008.370] (-1007.472) (-1011.757) * [-1009.984] (-1008.205) (-1007.833) (-1009.015) -- 0:00:32 483500 -- (-1016.143) (-1006.929) [-1008.603] (-1011.747) * (-1009.875) (-1008.809) [-1010.002] (-1010.172) -- 0:00:32 484000 -- (-1011.834) (-1008.127) [-1008.195] (-1009.774) * (-1009.251) [-1009.281] (-1007.983) (-1010.032) -- 0:00:31 484500 -- (-1010.602) (-1007.021) (-1008.878) [-1010.318] * (-1007.406) [-1007.565] (-1006.578) (-1011.348) -- 0:00:31 485000 -- (-1008.646) [-1010.171] (-1009.081) (-1011.774) * (-1009.047) (-1008.059) [-1007.162] (-1009.815) -- 0:00:32 Average standard deviation of split frequencies: 0.012367 485500 -- (-1008.685) (-1008.254) (-1008.226) [-1008.706] * [-1009.473] (-1009.678) (-1007.902) (-1006.890) -- 0:00:32 486000 -- (-1007.973) (-1008.213) [-1010.468] (-1007.905) * (-1009.524) (-1008.100) (-1007.131) [-1007.553] -- 0:00:32 486500 -- (-1008.032) (-1010.256) (-1011.185) [-1008.244] * (-1008.752) (-1007.937) [-1011.010] (-1007.813) -- 0:00:32 487000 -- (-1008.383) [-1007.592] (-1008.784) (-1007.648) * (-1009.184) (-1008.781) (-1008.711) [-1009.166] -- 0:00:32 487500 -- (-1011.711) [-1007.770] (-1006.657) (-1007.726) * (-1009.291) (-1015.063) [-1007.911] (-1007.712) -- 0:00:32 488000 -- [-1007.496] (-1008.227) (-1008.054) (-1009.611) * [-1007.791] (-1013.447) (-1008.316) (-1009.279) -- 0:00:32 488500 -- (-1008.168) (-1009.967) [-1006.754] (-1008.493) * [-1008.272] (-1010.689) (-1006.990) (-1008.407) -- 0:00:32 489000 -- [-1008.082] (-1007.635) (-1010.627) (-1006.880) * (-1010.224) (-1016.638) (-1006.990) [-1009.117] -- 0:00:32 489500 -- [-1008.181] (-1007.350) (-1008.412) (-1007.532) * (-1008.640) [-1009.100] (-1007.371) (-1008.582) -- 0:00:32 490000 -- [-1007.752] (-1010.475) (-1009.926) (-1009.846) * (-1008.730) (-1010.726) [-1007.627] (-1009.087) -- 0:00:32 Average standard deviation of split frequencies: 0.012069 490500 -- (-1009.992) (-1016.118) (-1009.903) [-1011.457] * (-1008.287) [-1010.395] (-1008.895) (-1012.596) -- 0:00:32 491000 -- (-1007.790) (-1008.756) (-1009.766) [-1008.670] * (-1008.225) [-1007.172] (-1011.719) (-1010.626) -- 0:00:32 491500 -- [-1006.934] (-1010.031) (-1007.210) (-1007.068) * [-1008.500] (-1007.649) (-1008.648) (-1010.588) -- 0:00:32 492000 -- (-1007.543) [-1009.683] (-1011.252) (-1007.029) * [-1010.284] (-1008.418) (-1008.404) (-1010.849) -- 0:00:32 492500 -- (-1007.556) (-1008.376) (-1009.130) [-1008.742] * (-1010.403) [-1009.576] (-1007.524) (-1011.641) -- 0:00:31 493000 -- [-1009.476] (-1010.375) (-1007.779) (-1007.923) * [-1009.342] (-1010.775) (-1009.062) (-1007.883) -- 0:00:31 493500 -- (-1008.771) (-1007.988) (-1015.756) [-1010.582] * (-1007.600) (-1008.861) (-1011.057) [-1008.522] -- 0:00:31 494000 -- (-1011.272) [-1008.429] (-1009.227) (-1009.260) * [-1007.897] (-1012.895) (-1010.042) (-1009.371) -- 0:00:31 494500 -- [-1008.953] (-1008.137) (-1009.102) (-1008.410) * (-1010.720) (-1010.226) [-1014.206] (-1009.242) -- 0:00:31 495000 -- (-1007.818) [-1007.380] (-1009.090) (-1012.408) * [-1011.665] (-1007.397) (-1009.027) (-1013.494) -- 0:00:31 Average standard deviation of split frequencies: 0.012712 495500 -- [-1011.749] (-1007.721) (-1010.379) (-1011.484) * (-1009.035) [-1008.244] (-1011.087) (-1012.904) -- 0:00:31 496000 -- (-1016.216) (-1009.793) (-1007.943) [-1008.149] * (-1008.363) (-1009.596) (-1007.907) [-1012.449] -- 0:00:31 496500 -- (-1009.571) (-1007.922) (-1009.029) [-1009.266] * (-1010.484) (-1010.477) [-1011.248] (-1007.983) -- 0:00:31 497000 -- (-1008.675) (-1008.879) [-1007.718] (-1009.764) * (-1006.819) (-1008.733) (-1009.068) [-1006.873] -- 0:00:31 497500 -- [-1007.165] (-1006.905) (-1008.333) (-1006.955) * (-1010.145) [-1010.606] (-1009.319) (-1009.411) -- 0:00:31 498000 -- (-1008.641) (-1007.233) [-1008.355] (-1010.624) * (-1007.266) [-1007.902] (-1013.444) (-1008.274) -- 0:00:31 498500 -- (-1014.020) [-1007.047] (-1007.961) (-1011.984) * (-1008.170) (-1010.502) (-1009.787) [-1012.782] -- 0:00:31 499000 -- (-1007.868) [-1007.595] (-1013.108) (-1010.378) * (-1009.501) [-1011.190] (-1007.859) (-1009.225) -- 0:00:31 499500 -- (-1010.809) (-1008.260) [-1008.781] (-1009.917) * [-1006.747] (-1009.103) (-1012.772) (-1008.400) -- 0:00:31 500000 -- [-1008.689] (-1009.843) (-1011.932) (-1007.613) * (-1011.728) (-1007.838) (-1012.227) [-1007.418] -- 0:00:31 Average standard deviation of split frequencies: 0.012946 500500 -- (-1007.209) (-1007.128) (-1007.836) [-1007.244] * (-1007.770) [-1007.554] (-1013.256) (-1007.663) -- 0:00:30 501000 -- (-1014.949) (-1007.774) (-1010.030) [-1007.248] * [-1009.114] (-1013.066) (-1012.449) (-1010.810) -- 0:00:31 501500 -- (-1014.225) (-1008.699) (-1010.364) [-1007.325] * (-1009.024) (-1009.232) [-1008.648] (-1007.265) -- 0:00:31 502000 -- [-1011.418] (-1007.664) (-1009.963) (-1007.325) * [-1008.183] (-1009.139) (-1009.493) (-1006.600) -- 0:00:31 502500 -- (-1012.146) [-1008.965] (-1009.115) (-1008.007) * [-1013.271] (-1007.126) (-1011.798) (-1006.602) -- 0:00:31 503000 -- [-1007.337] (-1009.719) (-1008.973) (-1011.338) * (-1009.429) (-1008.045) [-1007.781] (-1008.800) -- 0:00:31 503500 -- (-1008.115) (-1008.923) [-1009.837] (-1008.006) * [-1011.698] (-1008.156) (-1009.800) (-1008.171) -- 0:00:31 504000 -- (-1009.707) (-1015.268) (-1011.583) [-1010.588] * (-1008.552) [-1009.516] (-1008.682) (-1008.063) -- 0:00:31 504500 -- [-1007.313] (-1009.925) (-1011.829) (-1007.806) * [-1008.476] (-1010.453) (-1008.999) (-1008.726) -- 0:00:31 505000 -- (-1008.369) (-1008.993) [-1007.811] (-1009.468) * (-1007.989) [-1008.144] (-1010.454) (-1007.667) -- 0:00:31 Average standard deviation of split frequencies: 0.013207 505500 -- [-1008.645] (-1006.806) (-1008.050) (-1008.992) * [-1009.625] (-1009.777) (-1008.294) (-1010.197) -- 0:00:31 506000 -- (-1012.609) (-1008.050) (-1008.688) [-1009.611] * [-1010.197] (-1008.221) (-1008.011) (-1009.910) -- 0:00:31 506500 -- (-1011.727) (-1008.713) (-1010.530) [-1007.859] * [-1007.963] (-1009.330) (-1009.269) (-1010.777) -- 0:00:31 507000 -- [-1008.521] (-1008.142) (-1008.802) (-1006.823) * (-1015.332) (-1009.414) (-1007.498) [-1008.696] -- 0:00:31 507500 -- (-1006.559) [-1009.382] (-1010.448) (-1008.397) * (-1011.340) (-1009.205) (-1010.230) [-1008.612] -- 0:00:31 508000 -- (-1007.194) (-1009.251) [-1009.778] (-1006.832) * [-1009.851] (-1008.754) (-1010.232) (-1008.855) -- 0:00:30 508500 -- (-1008.625) [-1008.718] (-1008.507) (-1009.664) * (-1009.694) [-1008.641] (-1009.461) (-1010.648) -- 0:00:30 509000 -- (-1008.296) (-1006.544) [-1006.798] (-1010.923) * (-1008.738) (-1007.915) [-1007.846] (-1007.491) -- 0:00:30 509500 -- (-1008.163) (-1010.096) (-1009.376) [-1007.974] * (-1011.747) (-1012.265) [-1013.046] (-1009.749) -- 0:00:30 510000 -- [-1007.563] (-1007.810) (-1007.834) (-1011.858) * (-1009.103) (-1012.825) [-1007.609] (-1009.801) -- 0:00:30 Average standard deviation of split frequencies: 0.013684 510500 -- (-1006.621) (-1010.049) [-1008.038] (-1007.322) * (-1008.316) (-1016.647) [-1007.819] (-1014.414) -- 0:00:30 511000 -- (-1008.503) (-1008.913) (-1009.489) [-1007.815] * (-1009.338) (-1012.549) [-1007.994] (-1008.605) -- 0:00:30 511500 -- [-1008.095] (-1010.435) (-1008.508) (-1007.803) * [-1007.269] (-1008.444) (-1009.349) (-1007.450) -- 0:00:30 512000 -- (-1008.388) [-1009.860] (-1010.942) (-1018.953) * (-1008.436) [-1007.373] (-1007.910) (-1006.584) -- 0:00:30 512500 -- (-1007.762) (-1009.314) (-1007.955) [-1006.798] * (-1008.965) (-1008.072) (-1007.633) [-1012.969] -- 0:00:30 513000 -- (-1010.606) (-1006.884) [-1009.459] (-1009.506) * [-1007.030] (-1010.022) (-1009.415) (-1007.345) -- 0:00:30 513500 -- (-1016.348) [-1008.784] (-1007.952) (-1009.382) * (-1009.102) (-1007.702) (-1009.875) [-1009.306] -- 0:00:30 514000 -- [-1012.476] (-1009.090) (-1009.559) (-1008.159) * (-1008.633) (-1008.031) (-1014.238) [-1007.599] -- 0:00:30 514500 -- (-1008.377) (-1008.691) (-1009.654) [-1007.854] * (-1009.798) (-1009.328) (-1010.128) [-1007.604] -- 0:00:30 515000 -- [-1007.779] (-1010.766) (-1009.155) (-1013.616) * (-1007.662) (-1008.026) (-1008.064) [-1008.756] -- 0:00:30 Average standard deviation of split frequencies: 0.014566 515500 -- [-1007.841] (-1009.857) (-1008.496) (-1007.868) * [-1007.891] (-1009.567) (-1008.181) (-1010.470) -- 0:00:30 516000 -- (-1008.073) (-1009.174) (-1010.534) [-1007.338] * (-1008.043) (-1008.485) (-1007.048) [-1009.861] -- 0:00:30 516500 -- (-1008.857) [-1009.611] (-1009.024) (-1008.526) * (-1010.093) (-1008.903) [-1009.563] (-1011.203) -- 0:00:29 517000 -- (-1007.822) [-1007.813] (-1010.420) (-1009.591) * [-1007.574] (-1010.048) (-1010.078) (-1011.979) -- 0:00:29 517500 -- (-1008.516) (-1009.213) (-1009.002) [-1007.885] * (-1010.353) (-1012.564) [-1008.317] (-1012.429) -- 0:00:30 518000 -- (-1008.247) (-1008.976) [-1007.941] (-1007.417) * (-1012.607) (-1013.790) (-1008.917) [-1009.218] -- 0:00:30 518500 -- [-1007.772] (-1008.765) (-1006.940) (-1009.623) * (-1008.386) [-1006.845] (-1011.344) (-1010.212) -- 0:00:30 519000 -- [-1008.246] (-1007.858) (-1007.414) (-1009.180) * [-1012.234] (-1007.012) (-1013.828) (-1009.699) -- 0:00:30 519500 -- (-1009.418) (-1008.074) [-1008.312] (-1008.986) * (-1014.899) [-1006.860] (-1010.199) (-1010.207) -- 0:00:30 520000 -- (-1007.770) (-1011.672) (-1007.406) [-1008.219] * (-1008.643) (-1007.446) [-1011.683] (-1012.056) -- 0:00:30 Average standard deviation of split frequencies: 0.014436 520500 -- (-1007.905) (-1019.960) [-1009.667] (-1008.493) * (-1009.324) [-1008.339] (-1007.371) (-1007.613) -- 0:00:30 521000 -- (-1010.633) [-1008.015] (-1011.013) (-1008.578) * (-1009.802) (-1010.253) (-1007.512) [-1007.831] -- 0:00:30 521500 -- [-1008.267] (-1007.170) (-1010.627) (-1009.945) * (-1009.407) (-1009.200) (-1007.025) [-1007.990] -- 0:00:30 522000 -- [-1009.102] (-1007.229) (-1007.822) (-1010.343) * (-1008.596) (-1008.338) [-1008.539] (-1008.714) -- 0:00:30 522500 -- (-1007.744) [-1007.194] (-1008.720) (-1008.650) * (-1010.191) (-1008.025) (-1014.063) [-1007.525] -- 0:00:30 523000 -- (-1008.838) [-1008.410] (-1007.020) (-1006.759) * (-1008.918) (-1009.599) (-1015.459) [-1007.184] -- 0:00:30 523500 -- (-1012.279) (-1008.589) [-1008.222] (-1008.514) * (-1009.901) [-1009.574] (-1011.570) (-1010.489) -- 0:00:30 524000 -- (-1011.217) (-1008.436) [-1009.855] (-1007.807) * [-1010.132] (-1008.218) (-1014.158) (-1010.799) -- 0:00:29 524500 -- (-1009.914) (-1007.510) (-1012.659) [-1008.034] * (-1011.866) (-1007.670) (-1016.437) [-1009.794] -- 0:00:29 525000 -- (-1009.798) [-1007.375] (-1009.668) (-1007.387) * (-1007.884) (-1008.619) [-1011.280] (-1011.037) -- 0:00:29 Average standard deviation of split frequencies: 0.014240 525500 -- (-1010.897) (-1009.461) [-1009.093] (-1010.218) * (-1007.661) [-1008.935] (-1012.683) (-1011.660) -- 0:00:29 526000 -- [-1008.648] (-1008.055) (-1010.726) (-1009.972) * (-1011.659) (-1007.568) [-1008.752] (-1010.713) -- 0:00:29 526500 -- (-1008.712) [-1010.471] (-1007.237) (-1009.877) * (-1007.768) [-1006.618] (-1010.213) (-1007.272) -- 0:00:29 527000 -- (-1015.594) (-1010.248) [-1007.223] (-1007.899) * (-1008.433) (-1010.786) [-1008.486] (-1009.375) -- 0:00:29 527500 -- (-1013.135) (-1014.140) [-1007.613] (-1008.745) * (-1008.473) (-1010.094) (-1009.374) [-1012.498] -- 0:00:29 528000 -- (-1010.070) (-1013.626) [-1011.816] (-1009.918) * (-1010.158) (-1008.087) (-1014.498) [-1010.738] -- 0:00:29 528500 -- (-1015.784) (-1012.218) (-1010.917) [-1007.187] * (-1006.931) [-1011.767] (-1009.062) (-1007.352) -- 0:00:29 529000 -- [-1011.022] (-1016.824) (-1008.878) (-1008.844) * (-1007.505) [-1009.619] (-1011.739) (-1007.457) -- 0:00:29 529500 -- (-1008.694) (-1008.055) (-1009.401) [-1007.235] * (-1007.624) (-1007.586) (-1009.222) [-1008.188] -- 0:00:29 530000 -- (-1008.717) (-1007.958) [-1010.012] (-1007.405) * (-1008.767) (-1007.969) (-1008.041) [-1015.330] -- 0:00:29 Average standard deviation of split frequencies: 0.013522 530500 -- (-1009.348) (-1009.113) [-1008.212] (-1009.680) * (-1006.914) [-1008.038] (-1009.692) (-1012.117) -- 0:00:29 531000 -- (-1012.259) (-1009.085) [-1007.837] (-1010.366) * (-1007.568) [-1011.015] (-1008.039) (-1009.716) -- 0:00:29 531500 -- (-1015.400) (-1008.089) [-1007.121] (-1014.420) * (-1009.486) [-1008.336] (-1008.144) (-1008.493) -- 0:00:29 532000 -- (-1011.017) [-1009.290] (-1008.553) (-1009.946) * (-1010.492) (-1006.722) [-1008.836] (-1013.458) -- 0:00:29 532500 -- (-1008.021) [-1009.160] (-1011.407) (-1009.032) * (-1010.166) [-1008.045] (-1010.274) (-1009.917) -- 0:00:28 533000 -- (-1009.581) (-1012.815) [-1011.649] (-1010.267) * [-1007.618] (-1010.296) (-1009.450) (-1012.684) -- 0:00:29 533500 -- (-1008.256) [-1009.251] (-1010.263) (-1009.376) * (-1011.399) [-1010.874] (-1009.922) (-1011.087) -- 0:00:29 534000 -- [-1007.734] (-1008.730) (-1007.349) (-1009.330) * [-1008.529] (-1011.183) (-1007.859) (-1007.695) -- 0:00:29 534500 -- (-1010.868) (-1009.156) [-1007.494] (-1009.089) * [-1008.304] (-1006.993) (-1009.338) (-1008.762) -- 0:00:29 535000 -- (-1008.605) [-1008.689] (-1012.156) (-1008.041) * (-1009.771) [-1010.223] (-1009.753) (-1008.530) -- 0:00:29 Average standard deviation of split frequencies: 0.013388 535500 -- (-1010.447) (-1008.117) (-1009.686) [-1008.299] * (-1009.608) [-1009.705] (-1008.848) (-1007.512) -- 0:00:29 536000 -- [-1008.497] (-1008.003) (-1010.954) (-1011.942) * (-1008.029) (-1011.204) (-1008.550) [-1007.722] -- 0:00:29 536500 -- (-1007.166) [-1008.179] (-1010.573) (-1009.294) * (-1009.241) (-1016.369) (-1011.006) [-1007.136] -- 0:00:29 537000 -- (-1009.013) [-1007.588] (-1007.841) (-1010.740) * [-1010.474] (-1008.397) (-1014.694) (-1012.444) -- 0:00:29 537500 -- [-1007.553] (-1007.316) (-1008.289) (-1006.638) * (-1008.451) (-1008.339) (-1010.759) [-1012.704] -- 0:00:29 538000 -- [-1008.777] (-1010.146) (-1008.364) (-1007.115) * (-1009.432) (-1007.680) (-1009.565) [-1012.067] -- 0:00:29 538500 -- [-1007.056] (-1012.957) (-1012.461) (-1008.720) * [-1009.341] (-1007.680) (-1008.330) (-1011.022) -- 0:00:29 539000 -- (-1007.031) (-1013.425) [-1008.667] (-1007.965) * (-1012.205) (-1011.092) [-1009.247] (-1010.428) -- 0:00:29 539500 -- [-1007.486] (-1007.597) (-1007.722) (-1010.184) * (-1011.011) [-1008.989] (-1010.576) (-1009.409) -- 0:00:29 540000 -- (-1007.217) (-1008.457) (-1007.846) [-1009.171] * (-1014.130) (-1010.473) (-1007.852) [-1007.704] -- 0:00:28 Average standard deviation of split frequencies: 0.013078 540500 -- (-1008.126) (-1010.591) [-1008.584] (-1011.525) * (-1009.590) (-1020.550) (-1009.996) [-1008.608] -- 0:00:28 541000 -- [-1006.853] (-1008.929) (-1010.556) (-1009.452) * (-1008.983) (-1011.400) [-1007.063] (-1008.765) -- 0:00:28 541500 -- [-1006.741] (-1009.784) (-1010.487) (-1008.300) * (-1009.753) (-1008.185) (-1008.602) [-1010.072] -- 0:00:28 542000 -- (-1007.957) (-1006.626) [-1008.284] (-1008.464) * (-1020.817) (-1010.005) [-1012.086] (-1007.167) -- 0:00:28 542500 -- (-1007.956) (-1008.287) (-1009.179) [-1007.820] * (-1006.738) (-1010.074) [-1007.368] (-1014.209) -- 0:00:28 543000 -- (-1008.163) [-1008.103] (-1009.964) (-1009.491) * (-1010.906) (-1007.520) [-1007.420] (-1007.786) -- 0:00:28 543500 -- (-1007.184) (-1009.639) (-1009.452) [-1008.094] * (-1008.281) (-1008.814) [-1007.966] (-1012.894) -- 0:00:28 544000 -- (-1012.473) (-1007.285) (-1007.758) [-1007.979] * (-1010.467) [-1008.183] (-1007.434) (-1012.008) -- 0:00:28 544500 -- (-1008.507) [-1006.457] (-1008.222) (-1008.562) * (-1008.761) (-1011.137) (-1010.186) [-1008.553] -- 0:00:28 545000 -- (-1008.523) (-1006.869) [-1008.268] (-1008.332) * (-1009.058) [-1011.275] (-1009.636) (-1007.748) -- 0:00:28 Average standard deviation of split frequencies: 0.012567 545500 -- (-1008.528) (-1007.462) [-1007.608] (-1008.904) * (-1011.095) [-1008.585] (-1008.645) (-1007.965) -- 0:00:28 546000 -- (-1012.219) (-1007.812) (-1009.258) [-1007.568] * (-1009.555) (-1012.393) (-1007.458) [-1006.829] -- 0:00:28 546500 -- [-1009.396] (-1010.095) (-1009.040) (-1011.295) * (-1009.647) (-1008.780) (-1007.024) [-1007.030] -- 0:00:28 547000 -- [-1009.128] (-1008.231) (-1007.994) (-1011.225) * (-1009.745) (-1008.325) (-1012.614) [-1007.506] -- 0:00:28 547500 -- (-1013.037) [-1008.217] (-1008.189) (-1008.001) * (-1008.056) (-1008.703) (-1011.088) [-1008.206] -- 0:00:28 548000 -- (-1009.037) [-1009.885] (-1009.817) (-1014.442) * (-1008.017) (-1010.111) (-1012.864) [-1008.587] -- 0:00:28 548500 -- (-1009.257) [-1013.265] (-1010.255) (-1013.170) * (-1009.165) [-1010.217] (-1009.742) (-1007.325) -- 0:00:28 549000 -- (-1010.142) (-1013.072) [-1009.687] (-1009.483) * (-1008.925) [-1011.892] (-1010.339) (-1008.970) -- 0:00:28 549500 -- (-1009.092) (-1008.712) [-1009.037] (-1010.463) * (-1010.230) (-1012.012) [-1008.588] (-1008.703) -- 0:00:28 550000 -- (-1009.426) (-1007.808) [-1008.077] (-1008.668) * (-1010.193) (-1009.100) (-1007.794) [-1010.610] -- 0:00:28 Average standard deviation of split frequencies: 0.012791 550500 -- (-1009.587) (-1007.484) (-1007.819) [-1011.976] * (-1010.383) (-1008.176) (-1011.533) [-1008.536] -- 0:00:28 551000 -- (-1010.886) (-1007.261) (-1012.889) [-1012.171] * (-1011.216) [-1008.481] (-1009.466) (-1008.439) -- 0:00:28 551500 -- (-1009.720) [-1013.443] (-1009.195) (-1009.556) * [-1010.108] (-1009.817) (-1007.982) (-1008.439) -- 0:00:28 552000 -- (-1010.428) (-1008.071) (-1008.587) [-1011.986] * (-1008.418) (-1007.128) [-1009.299] (-1010.838) -- 0:00:28 552500 -- (-1013.628) [-1007.472] (-1008.788) (-1012.238) * (-1010.094) (-1012.202) (-1009.246) [-1008.967] -- 0:00:28 553000 -- [-1008.481] (-1012.075) (-1011.848) (-1008.881) * (-1013.468) (-1007.493) [-1007.985] (-1008.260) -- 0:00:28 553500 -- (-1007.392) [-1007.216] (-1015.828) (-1010.660) * (-1012.640) (-1007.303) (-1008.530) [-1007.162] -- 0:00:28 554000 -- (-1009.450) (-1007.033) [-1009.545] (-1009.578) * (-1010.101) (-1010.843) (-1008.426) [-1007.566] -- 0:00:28 554500 -- [-1007.242] (-1009.479) (-1010.294) (-1012.270) * [-1008.116] (-1010.108) (-1010.287) (-1008.017) -- 0:00:28 555000 -- (-1007.978) (-1010.999) [-1009.405] (-1007.259) * (-1009.505) [-1007.799] (-1009.479) (-1010.594) -- 0:00:28 Average standard deviation of split frequencies: 0.012718 555500 -- (-1012.015) [-1009.834] (-1012.044) (-1008.983) * [-1007.334] (-1009.066) (-1009.677) (-1009.358) -- 0:00:28 556000 -- (-1010.201) (-1007.133) (-1009.821) [-1007.164] * (-1010.368) (-1008.630) (-1008.486) [-1010.210] -- 0:00:27 556500 -- [-1008.244] (-1009.513) (-1007.740) (-1007.820) * (-1009.514) (-1010.435) [-1010.736] (-1008.754) -- 0:00:27 557000 -- (-1010.581) [-1009.771] (-1008.804) (-1008.337) * (-1010.943) (-1010.899) (-1007.729) [-1007.562] -- 0:00:27 557500 -- (-1011.003) (-1009.644) [-1008.921] (-1008.810) * (-1010.656) (-1007.989) (-1007.400) [-1007.128] -- 0:00:27 558000 -- (-1008.534) [-1007.919] (-1012.092) (-1008.810) * (-1011.933) (-1009.990) [-1009.083] (-1008.031) -- 0:00:27 558500 -- (-1007.660) [-1008.555] (-1010.625) (-1008.939) * (-1010.122) (-1009.783) (-1009.763) [-1009.028] -- 0:00:27 559000 -- [-1008.213] (-1008.263) (-1007.759) (-1007.773) * (-1007.450) (-1007.338) (-1008.848) [-1007.947] -- 0:00:27 559500 -- (-1008.178) (-1008.601) (-1009.110) [-1008.231] * (-1007.884) [-1010.702] (-1011.994) (-1009.029) -- 0:00:27 560000 -- (-1012.075) (-1009.619) [-1009.538] (-1010.814) * [-1007.782] (-1011.733) (-1008.759) (-1012.301) -- 0:00:27 Average standard deviation of split frequencies: 0.013057 560500 -- (-1009.576) [-1008.605] (-1009.924) (-1010.138) * [-1007.685] (-1013.168) (-1007.859) (-1013.887) -- 0:00:27 561000 -- [-1007.025] (-1009.422) (-1007.857) (-1008.015) * (-1007.706) (-1009.315) [-1007.278] (-1009.534) -- 0:00:27 561500 -- (-1010.028) (-1009.620) (-1007.950) [-1007.209] * (-1010.627) (-1009.814) [-1007.278] (-1007.215) -- 0:00:27 562000 -- (-1010.579) (-1012.430) [-1009.246] (-1007.616) * (-1009.035) (-1009.919) (-1007.839) [-1009.714] -- 0:00:27 562500 -- [-1008.638] (-1011.994) (-1008.493) (-1010.745) * (-1007.518) (-1009.214) (-1007.082) [-1007.882] -- 0:00:27 563000 -- (-1008.358) (-1015.504) [-1006.951] (-1008.141) * (-1008.721) (-1008.015) [-1007.255] (-1011.210) -- 0:00:27 563500 -- (-1010.323) (-1011.129) (-1009.977) [-1008.397] * (-1009.639) (-1010.954) [-1008.534] (-1011.073) -- 0:00:27 564000 -- [-1010.005] (-1013.979) (-1010.720) (-1009.760) * [-1009.642] (-1010.252) (-1008.357) (-1011.005) -- 0:00:27 564500 -- [-1007.461] (-1011.765) (-1009.469) (-1011.381) * (-1010.729) (-1011.604) (-1007.637) [-1008.573] -- 0:00:27 565000 -- (-1008.727) (-1009.467) [-1007.119] (-1006.920) * (-1006.727) [-1008.727] (-1006.731) (-1008.650) -- 0:00:27 Average standard deviation of split frequencies: 0.013032 565500 -- (-1009.218) [-1007.317] (-1007.779) (-1008.278) * (-1009.283) (-1007.695) [-1009.962] (-1008.978) -- 0:00:27 566000 -- [-1010.533] (-1007.255) (-1010.195) (-1009.279) * [-1008.967] (-1006.813) (-1007.372) (-1007.208) -- 0:00:27 566500 -- (-1010.836) (-1011.977) (-1010.485) [-1009.318] * (-1009.274) (-1016.027) [-1007.098] (-1011.177) -- 0:00:27 567000 -- [-1011.309] (-1018.306) (-1007.207) (-1009.139) * (-1007.702) [-1009.407] (-1008.299) (-1009.726) -- 0:00:27 567500 -- (-1009.602) (-1008.854) [-1008.606] (-1010.865) * [-1007.226] (-1011.250) (-1012.448) (-1009.891) -- 0:00:27 568000 -- (-1010.538) (-1006.960) [-1009.236] (-1008.647) * (-1007.399) [-1007.838] (-1011.280) (-1009.371) -- 0:00:27 568500 -- (-1010.597) (-1006.819) [-1009.233] (-1009.388) * (-1008.502) [-1007.424] (-1008.484) (-1013.350) -- 0:00:27 569000 -- (-1009.426) [-1006.792] (-1010.290) (-1009.412) * (-1007.319) (-1008.706) (-1010.288) [-1009.994] -- 0:00:27 569500 -- (-1009.595) [-1006.647] (-1010.662) (-1008.944) * (-1008.392) (-1007.603) [-1006.703] (-1009.122) -- 0:00:27 570000 -- [-1008.716] (-1006.939) (-1008.871) (-1010.865) * (-1010.195) (-1008.223) (-1009.172) [-1009.456] -- 0:00:27 Average standard deviation of split frequencies: 0.013363 570500 -- (-1009.772) (-1009.602) (-1009.599) [-1008.331] * (-1011.631) (-1009.849) (-1010.456) [-1008.687] -- 0:00:27 571000 -- [-1014.925] (-1009.871) (-1008.684) (-1009.940) * (-1013.272) [-1010.277] (-1007.974) (-1010.217) -- 0:00:27 571500 -- (-1012.458) (-1007.088) (-1008.566) [-1008.906] * (-1010.531) (-1007.583) (-1006.974) [-1007.868] -- 0:00:26 572000 -- (-1008.530) [-1012.180] (-1009.329) (-1007.292) * [-1006.724] (-1008.592) (-1007.203) (-1007.616) -- 0:00:26 572500 -- [-1012.102] (-1007.925) (-1007.702) (-1009.428) * (-1006.432) (-1009.278) (-1007.670) [-1007.906] -- 0:00:26 573000 -- (-1012.853) [-1012.930] (-1007.184) (-1010.175) * (-1007.854) (-1006.726) (-1011.003) [-1008.543] -- 0:00:26 573500 -- (-1009.284) (-1008.501) [-1012.772] (-1008.307) * (-1008.421) (-1008.513) (-1009.322) [-1010.133] -- 0:00:26 574000 -- [-1007.834] (-1010.721) (-1009.930) (-1007.334) * (-1007.601) [-1010.757] (-1011.525) (-1008.719) -- 0:00:26 574500 -- [-1009.233] (-1013.636) (-1007.973) (-1007.774) * [-1008.045] (-1009.105) (-1008.882) (-1007.596) -- 0:00:26 575000 -- (-1008.932) (-1007.344) [-1007.874] (-1010.660) * (-1009.718) (-1014.332) [-1009.857] (-1006.964) -- 0:00:26 Average standard deviation of split frequencies: 0.012902 575500 -- (-1014.931) (-1007.480) [-1008.235] (-1009.782) * (-1006.948) [-1007.698] (-1009.794) (-1007.109) -- 0:00:26 576000 -- (-1008.950) [-1010.772] (-1009.683) (-1008.563) * [-1006.995] (-1008.846) (-1010.057) (-1008.237) -- 0:00:26 576500 -- [-1008.112] (-1008.078) (-1010.843) (-1007.837) * (-1006.546) (-1011.368) (-1009.064) [-1009.286] -- 0:00:26 577000 -- (-1008.475) (-1011.915) (-1010.385) [-1009.707] * (-1008.426) (-1009.132) (-1012.562) [-1008.199] -- 0:00:26 577500 -- [-1009.561] (-1009.301) (-1010.905) (-1009.229) * [-1009.319] (-1009.746) (-1008.713) (-1008.580) -- 0:00:26 578000 -- [-1007.599] (-1007.538) (-1017.715) (-1011.856) * (-1007.323) (-1010.888) (-1012.161) [-1007.511] -- 0:00:26 578500 -- (-1008.259) (-1008.057) [-1008.796] (-1009.312) * (-1007.111) (-1016.367) [-1008.495] (-1007.301) -- 0:00:26 579000 -- (-1009.027) (-1010.616) (-1007.781) [-1007.863] * (-1008.663) (-1011.440) [-1006.572] (-1009.348) -- 0:00:26 579500 -- (-1009.042) [-1008.493] (-1008.007) (-1006.934) * (-1008.446) (-1007.860) [-1007.652] (-1010.360) -- 0:00:26 580000 -- (-1009.318) [-1008.363] (-1007.591) (-1009.930) * (-1008.122) [-1008.630] (-1008.525) (-1012.069) -- 0:00:26 Average standard deviation of split frequencies: 0.012607 580500 -- (-1010.613) (-1011.920) [-1007.274] (-1009.408) * [-1009.361] (-1010.079) (-1007.597) (-1007.962) -- 0:00:26 581000 -- [-1013.467] (-1013.334) (-1007.646) (-1013.834) * [-1008.713] (-1006.882) (-1010.155) (-1011.957) -- 0:00:26 581500 -- (-1010.081) [-1010.788] (-1008.042) (-1008.166) * (-1008.925) [-1007.940] (-1013.867) (-1013.999) -- 0:00:26 582000 -- (-1007.073) (-1008.066) (-1007.280) [-1007.820] * (-1008.830) [-1008.897] (-1011.207) (-1014.507) -- 0:00:26 582500 -- [-1009.931] (-1008.205) (-1009.445) (-1009.682) * (-1011.310) (-1008.732) (-1012.850) [-1008.828] -- 0:00:26 583000 -- [-1008.199] (-1007.441) (-1011.912) (-1008.108) * [-1009.525] (-1008.776) (-1014.885) (-1010.034) -- 0:00:26 583500 -- [-1009.942] (-1008.364) (-1012.059) (-1010.268) * (-1007.545) (-1013.601) [-1008.076] (-1013.900) -- 0:00:26 584000 -- (-1009.218) [-1009.734] (-1011.790) (-1009.201) * (-1008.055) [-1012.061] (-1007.961) (-1010.416) -- 0:00:26 584500 -- (-1012.155) [-1011.410] (-1011.350) (-1008.019) * (-1008.859) [-1013.416] (-1007.881) (-1010.350) -- 0:00:26 585000 -- [-1010.107] (-1008.432) (-1007.825) (-1009.209) * [-1008.038] (-1014.508) (-1010.276) (-1007.380) -- 0:00:26 Average standard deviation of split frequencies: 0.013202 585500 -- (-1011.386) (-1009.316) (-1008.137) [-1009.862] * (-1010.112) (-1008.372) [-1009.700] (-1006.932) -- 0:00:26 586000 -- (-1007.394) (-1007.964) [-1007.308] (-1007.665) * [-1007.037] (-1010.522) (-1009.536) (-1009.224) -- 0:00:26 586500 -- (-1010.570) (-1009.260) [-1008.012] (-1009.397) * (-1008.206) (-1007.483) (-1011.498) [-1008.244] -- 0:00:26 587000 -- (-1007.033) (-1012.997) [-1011.219] (-1012.655) * (-1007.377) (-1006.929) (-1008.067) [-1008.244] -- 0:00:26 587500 -- [-1009.507] (-1008.287) (-1007.766) (-1011.967) * (-1008.954) (-1009.066) (-1008.664) [-1008.173] -- 0:00:25 588000 -- (-1008.053) (-1009.795) [-1009.917] (-1007.298) * (-1011.746) (-1008.336) (-1007.773) [-1010.083] -- 0:00:25 588500 -- [-1008.110] (-1007.796) (-1010.404) (-1007.282) * (-1007.811) [-1008.531] (-1012.050) (-1011.466) -- 0:00:25 589000 -- (-1007.865) (-1010.553) [-1010.161] (-1008.236) * (-1008.479) (-1008.809) (-1008.334) [-1007.899] -- 0:00:25 589500 -- (-1009.511) (-1008.054) [-1010.244] (-1009.117) * [-1009.653] (-1009.415) (-1009.106) (-1006.963) -- 0:00:25 590000 -- [-1009.340] (-1007.642) (-1010.571) (-1010.002) * [-1006.571] (-1010.842) (-1010.803) (-1006.838) -- 0:00:25 Average standard deviation of split frequencies: 0.013051 590500 -- [-1011.482] (-1009.647) (-1010.491) (-1008.517) * [-1009.624] (-1008.410) (-1008.935) (-1007.200) -- 0:00:25 591000 -- (-1009.227) [-1008.931] (-1007.815) (-1010.624) * (-1009.573) [-1007.856] (-1012.368) (-1009.828) -- 0:00:25 591500 -- (-1009.489) (-1010.670) [-1007.433] (-1009.834) * (-1008.736) (-1007.877) [-1009.148] (-1007.371) -- 0:00:25 592000 -- [-1006.906] (-1011.516) (-1013.639) (-1008.613) * (-1008.631) (-1009.854) [-1013.550] (-1013.089) -- 0:00:25 592500 -- [-1008.159] (-1013.177) (-1007.680) (-1008.868) * (-1009.659) (-1013.391) [-1008.350] (-1017.825) -- 0:00:25 593000 -- (-1009.306) (-1009.330) (-1007.632) [-1009.673] * (-1013.344) [-1008.787] (-1007.500) (-1012.439) -- 0:00:25 593500 -- (-1007.039) (-1009.866) [-1007.388] (-1011.455) * (-1012.540) (-1010.679) (-1007.097) [-1007.968] -- 0:00:25 594000 -- [-1007.968] (-1010.370) (-1007.910) (-1008.661) * (-1009.497) [-1007.593] (-1007.414) (-1010.992) -- 0:00:25 594500 -- [-1008.060] (-1014.489) (-1008.093) (-1007.523) * (-1007.413) (-1009.909) (-1009.395) [-1007.450] -- 0:00:25 595000 -- (-1007.952) [-1010.956] (-1008.409) (-1006.801) * (-1011.161) (-1007.199) [-1008.648] (-1009.476) -- 0:00:25 Average standard deviation of split frequencies: 0.012655 595500 -- (-1008.569) (-1008.726) (-1008.081) [-1007.059] * [-1007.648] (-1007.226) (-1010.796) (-1009.484) -- 0:00:25 596000 -- (-1009.165) [-1008.717] (-1008.600) (-1011.330) * [-1008.812] (-1008.841) (-1007.920) (-1008.104) -- 0:00:25 596500 -- [-1009.608] (-1009.442) (-1008.377) (-1009.090) * [-1009.356] (-1008.998) (-1008.005) (-1007.749) -- 0:00:25 597000 -- [-1008.192] (-1010.588) (-1008.999) (-1009.782) * (-1008.869) [-1009.244] (-1008.198) (-1007.250) -- 0:00:25 597500 -- (-1008.189) (-1014.739) (-1009.238) [-1009.546] * (-1012.139) (-1008.709) [-1008.247] (-1011.181) -- 0:00:25 598000 -- (-1008.786) (-1013.925) (-1008.036) [-1010.034] * (-1009.174) (-1007.135) (-1007.798) [-1007.378] -- 0:00:25 598500 -- [-1008.103] (-1007.038) (-1009.370) (-1009.889) * (-1010.974) (-1006.906) (-1009.963) [-1009.808] -- 0:00:25 599000 -- (-1009.894) [-1008.554] (-1007.722) (-1010.452) * (-1008.558) (-1007.576) (-1010.266) [-1011.206] -- 0:00:25 599500 -- (-1009.384) [-1007.058] (-1008.270) (-1010.758) * (-1008.794) (-1009.113) (-1008.197) [-1009.165] -- 0:00:25 600000 -- [-1009.908] (-1007.313) (-1007.749) (-1010.093) * [-1012.573] (-1007.936) (-1017.135) (-1011.537) -- 0:00:25 Average standard deviation of split frequencies: 0.012095 600500 -- (-1007.703) (-1012.763) [-1008.672] (-1012.207) * (-1013.713) (-1008.301) (-1010.562) [-1009.461] -- 0:00:25 601000 -- (-1010.620) (-1017.609) (-1010.250) [-1009.671] * (-1009.237) (-1007.058) [-1008.013] (-1009.462) -- 0:00:25 601500 -- (-1008.091) [-1007.885] (-1009.185) (-1008.049) * [-1007.740] (-1008.700) (-1007.979) (-1007.100) -- 0:00:25 602000 -- (-1007.540) [-1008.085] (-1011.097) (-1008.519) * (-1011.871) [-1008.828] (-1007.498) (-1008.237) -- 0:00:25 602500 -- [-1011.596] (-1010.180) (-1009.952) (-1007.593) * (-1009.162) (-1009.721) (-1008.097) [-1006.718] -- 0:00:25 603000 -- (-1011.545) (-1012.792) [-1014.179] (-1006.813) * [-1008.164] (-1008.629) (-1007.436) (-1010.076) -- 0:00:25 603500 -- (-1009.121) (-1012.890) [-1008.557] (-1008.137) * (-1009.497) [-1008.975] (-1008.283) (-1009.618) -- 0:00:24 604000 -- (-1007.637) [-1010.138] (-1009.335) (-1015.389) * (-1008.471) [-1006.655] (-1008.922) (-1010.109) -- 0:00:24 604500 -- (-1011.235) (-1012.869) (-1010.907) [-1007.825] * (-1012.519) (-1007.708) (-1009.253) [-1013.718] -- 0:00:24 605000 -- (-1008.943) [-1013.718] (-1011.155) (-1009.503) * (-1009.204) [-1009.327] (-1007.433) (-1009.662) -- 0:00:24 Average standard deviation of split frequencies: 0.011814 605500 -- (-1009.454) [-1009.345] (-1009.047) (-1008.527) * [-1008.556] (-1008.212) (-1009.042) (-1011.022) -- 0:00:24 606000 -- (-1008.018) [-1009.145] (-1009.359) (-1007.090) * [-1009.290] (-1009.886) (-1007.863) (-1009.805) -- 0:00:24 606500 -- [-1008.653] (-1007.204) (-1011.104) (-1009.426) * (-1007.521) (-1010.494) (-1009.625) [-1010.675] -- 0:00:24 607000 -- (-1007.874) (-1009.607) (-1011.473) [-1011.784] * [-1007.549] (-1007.703) (-1013.596) (-1007.811) -- 0:00:24 607500 -- [-1010.435] (-1008.583) (-1010.013) (-1010.353) * [-1012.498] (-1010.035) (-1008.045) (-1008.030) -- 0:00:24 608000 -- [-1007.346] (-1007.253) (-1008.198) (-1006.963) * (-1009.609) (-1008.866) [-1010.631] (-1011.882) -- 0:00:24 608500 -- (-1007.557) (-1007.210) [-1010.070] (-1008.144) * [-1008.239] (-1008.339) (-1010.050) (-1011.521) -- 0:00:24 609000 -- [-1009.356] (-1008.817) (-1007.891) (-1007.029) * (-1009.684) (-1008.870) (-1011.828) [-1010.023] -- 0:00:24 609500 -- (-1011.748) (-1007.141) (-1010.652) [-1007.886] * (-1009.227) (-1007.459) (-1007.963) [-1010.921] -- 0:00:24 610000 -- (-1008.321) (-1009.306) [-1007.434] (-1008.831) * (-1008.093) [-1007.437] (-1008.631) (-1011.602) -- 0:00:24 Average standard deviation of split frequencies: 0.011097 610500 -- (-1009.224) [-1008.328] (-1009.063) (-1012.992) * (-1009.095) (-1008.346) (-1014.560) [-1009.110] -- 0:00:24 611000 -- (-1011.150) (-1009.517) [-1007.343] (-1009.354) * (-1008.018) (-1009.235) (-1010.325) [-1006.732] -- 0:00:24 611500 -- (-1009.200) (-1007.519) (-1008.155) [-1006.505] * (-1010.502) [-1008.181] (-1007.679) (-1010.399) -- 0:00:24 612000 -- (-1007.314) (-1011.310) [-1008.229] (-1008.788) * (-1007.113) (-1009.592) (-1010.924) [-1010.468] -- 0:00:24 612500 -- (-1007.542) (-1008.670) [-1009.104] (-1008.794) * (-1008.027) (-1007.918) (-1009.042) [-1010.014] -- 0:00:24 613000 -- [-1007.250] (-1007.510) (-1009.834) (-1010.982) * (-1007.216) (-1007.190) [-1007.927] (-1007.469) -- 0:00:24 613500 -- (-1007.250) (-1009.491) (-1009.191) [-1011.405] * [-1009.104] (-1007.880) (-1009.098) (-1007.530) -- 0:00:24 614000 -- (-1010.038) (-1007.333) [-1008.681] (-1008.671) * (-1008.178) (-1013.105) (-1010.547) [-1008.735] -- 0:00:24 614500 -- (-1009.045) (-1008.028) [-1008.093] (-1010.689) * [-1008.690] (-1009.409) (-1009.812) (-1009.593) -- 0:00:24 615000 -- [-1009.658] (-1007.801) (-1007.370) (-1010.449) * (-1009.614) (-1007.855) [-1008.996] (-1013.247) -- 0:00:24 Average standard deviation of split frequencies: 0.011670 615500 -- (-1009.686) (-1007.984) [-1007.450] (-1011.529) * (-1007.406) [-1009.005] (-1013.958) (-1008.586) -- 0:00:24 616000 -- (-1009.365) [-1007.266] (-1006.994) (-1013.015) * (-1008.663) [-1007.890] (-1017.899) (-1009.009) -- 0:00:24 616500 -- [-1007.623] (-1008.580) (-1007.784) (-1007.080) * [-1007.254] (-1011.314) (-1007.048) (-1007.457) -- 0:00:24 617000 -- (-1011.769) (-1007.735) (-1009.854) [-1008.034] * (-1006.965) (-1011.540) [-1007.158] (-1013.414) -- 0:00:24 617500 -- (-1008.634) (-1010.891) [-1013.737] (-1007.985) * (-1007.274) (-1007.247) [-1006.854] (-1013.839) -- 0:00:24 618000 -- (-1008.329) [-1009.180] (-1008.053) (-1011.119) * [-1008.405] (-1010.867) (-1011.459) (-1009.550) -- 0:00:24 618500 -- (-1008.330) (-1007.523) [-1008.310] (-1011.834) * (-1008.181) (-1013.576) [-1009.156] (-1007.297) -- 0:00:24 619000 -- (-1006.971) [-1007.378] (-1008.697) (-1012.606) * (-1008.902) (-1012.663) (-1009.008) [-1006.940] -- 0:00:24 619500 -- (-1015.612) [-1008.524] (-1007.248) (-1011.601) * [-1007.458] (-1010.769) (-1012.267) (-1010.500) -- 0:00:23 620000 -- (-1016.496) (-1009.320) (-1010.454) [-1008.125] * (-1007.478) (-1009.807) [-1008.640] (-1008.551) -- 0:00:23 Average standard deviation of split frequencies: 0.012342 620500 -- [-1010.733] (-1011.171) (-1008.755) (-1007.841) * (-1008.763) (-1012.148) [-1008.321] (-1011.849) -- 0:00:23 621000 -- (-1008.636) [-1007.920] (-1009.153) (-1010.044) * (-1008.288) (-1010.111) (-1008.819) [-1010.740] -- 0:00:23 621500 -- (-1008.972) (-1014.074) [-1009.214] (-1008.782) * [-1010.385] (-1009.016) (-1009.999) (-1009.466) -- 0:00:23 622000 -- (-1008.345) (-1009.361) [-1008.486] (-1008.685) * [-1009.222] (-1013.241) (-1008.825) (-1007.640) -- 0:00:23 622500 -- (-1010.628) (-1008.125) [-1008.864] (-1008.400) * [-1008.525] (-1007.813) (-1008.466) (-1007.720) -- 0:00:23 623000 -- [-1012.156] (-1009.902) (-1008.860) (-1008.852) * [-1009.236] (-1012.587) (-1007.344) (-1011.628) -- 0:00:23 623500 -- (-1011.290) (-1008.403) (-1007.306) [-1008.333] * (-1011.268) [-1007.692] (-1012.435) (-1011.022) -- 0:00:23 624000 -- (-1009.092) (-1007.866) (-1008.974) [-1007.401] * (-1010.624) [-1011.663] (-1015.058) (-1008.180) -- 0:00:23 624500 -- (-1007.604) (-1008.934) (-1007.754) [-1008.659] * (-1009.997) [-1008.360] (-1011.341) (-1007.069) -- 0:00:23 625000 -- (-1009.685) (-1008.652) (-1009.414) [-1008.424] * (-1007.167) [-1006.827] (-1009.736) (-1006.866) -- 0:00:23 Average standard deviation of split frequencies: 0.012190 625500 -- [-1011.352] (-1008.455) (-1008.155) (-1008.368) * (-1010.126) (-1007.311) (-1011.321) [-1009.144] -- 0:00:23 626000 -- (-1011.117) [-1010.002] (-1008.276) (-1009.048) * (-1011.763) (-1010.589) (-1007.106) [-1006.738] -- 0:00:23 626500 -- (-1010.380) (-1012.054) (-1011.560) [-1008.588] * (-1015.456) (-1010.711) [-1009.041] (-1009.827) -- 0:00:23 627000 -- (-1009.543) (-1008.583) [-1009.390] (-1012.327) * (-1008.033) [-1007.686] (-1007.794) (-1008.280) -- 0:00:23 627500 -- (-1010.304) (-1010.535) [-1009.136] (-1009.050) * [-1007.839] (-1007.933) (-1007.340) (-1008.795) -- 0:00:23 628000 -- [-1006.982] (-1008.344) (-1007.527) (-1015.229) * (-1007.818) (-1010.498) (-1010.149) [-1008.899] -- 0:00:23 628500 -- (-1007.418) (-1008.672) [-1007.133] (-1008.642) * (-1008.783) (-1010.569) [-1008.211] (-1009.939) -- 0:00:23 629000 -- (-1008.560) [-1008.634] (-1008.526) (-1008.703) * (-1007.590) [-1006.594] (-1007.108) (-1008.414) -- 0:00:23 629500 -- (-1008.463) (-1007.861) [-1009.353] (-1006.891) * [-1008.893] (-1008.711) (-1008.627) (-1015.492) -- 0:00:23 630000 -- (-1007.187) (-1007.109) [-1008.969] (-1011.305) * (-1016.022) (-1007.133) (-1007.870) [-1010.356] -- 0:00:23 Average standard deviation of split frequencies: 0.011586 630500 -- [-1010.577] (-1007.265) (-1007.905) (-1008.794) * (-1008.820) [-1007.062] (-1014.945) (-1009.879) -- 0:00:23 631000 -- (-1011.236) (-1014.685) (-1008.289) [-1009.396] * (-1006.910) [-1009.880] (-1016.668) (-1013.304) -- 0:00:23 631500 -- (-1009.652) (-1015.408) (-1008.211) [-1009.644] * (-1008.654) (-1012.282) (-1011.140) [-1009.529] -- 0:00:23 632000 -- (-1010.212) (-1013.299) (-1009.555) [-1007.728] * (-1007.451) [-1008.411] (-1023.316) (-1009.498) -- 0:00:23 632500 -- (-1012.068) [-1008.568] (-1009.350) (-1008.348) * (-1007.404) [-1011.487] (-1019.081) (-1012.521) -- 0:00:23 633000 -- (-1008.499) (-1012.824) (-1010.187) [-1009.046] * [-1007.697] (-1009.489) (-1010.198) (-1011.275) -- 0:00:23 633500 -- (-1010.745) (-1009.192) [-1010.117] (-1007.834) * [-1007.381] (-1009.671) (-1010.980) (-1009.664) -- 0:00:23 634000 -- [-1011.112] (-1009.866) (-1012.128) (-1007.735) * (-1006.727) (-1008.300) (-1009.077) [-1008.578] -- 0:00:23 634500 -- (-1009.316) (-1006.538) (-1007.943) [-1006.767] * (-1008.078) (-1008.137) [-1007.094] (-1008.229) -- 0:00:23 635000 -- (-1007.671) [-1009.590] (-1007.163) (-1009.260) * (-1009.953) (-1008.508) (-1006.938) [-1007.196] -- 0:00:22 Average standard deviation of split frequencies: 0.011813 635500 -- (-1007.639) (-1009.583) [-1009.523] (-1007.707) * (-1010.324) (-1011.409) (-1007.163) [-1006.790] -- 0:00:22 636000 -- (-1010.579) [-1011.331] (-1008.470) (-1007.569) * (-1010.659) (-1009.743) [-1007.410] (-1007.466) -- 0:00:22 636500 -- [-1012.081] (-1008.807) (-1006.632) (-1008.464) * (-1007.111) (-1010.130) [-1009.259] (-1006.879) -- 0:00:22 637000 -- (-1013.237) (-1011.712) (-1007.905) [-1007.851] * (-1008.907) (-1009.130) (-1007.766) [-1007.191] -- 0:00:22 637500 -- (-1007.557) (-1015.281) [-1007.979] (-1007.878) * (-1008.874) (-1008.845) [-1007.835] (-1010.300) -- 0:00:22 638000 -- (-1007.884) (-1012.479) [-1009.537] (-1015.418) * (-1007.810) [-1007.474] (-1011.364) (-1009.303) -- 0:00:22 638500 -- (-1006.916) [-1008.092] (-1009.569) (-1009.144) * (-1008.038) [-1008.880] (-1011.876) (-1009.939) -- 0:00:22 639000 -- (-1007.496) (-1010.825) (-1007.664) [-1008.820] * [-1007.499] (-1008.388) (-1009.128) (-1010.963) -- 0:00:22 639500 -- [-1006.708] (-1009.312) (-1008.396) (-1012.022) * [-1007.994] (-1008.217) (-1007.660) (-1008.056) -- 0:00:22 640000 -- (-1008.501) [-1006.573] (-1007.721) (-1010.995) * [-1007.113] (-1011.822) (-1011.421) (-1007.182) -- 0:00:22 Average standard deviation of split frequencies: 0.011819 640500 -- (-1013.567) [-1008.419] (-1008.229) (-1011.246) * (-1009.070) (-1007.043) (-1008.342) [-1006.903] -- 0:00:22 641000 -- [-1010.293] (-1011.375) (-1007.041) (-1009.640) * (-1010.261) (-1007.193) [-1011.635] (-1007.161) -- 0:00:22 641500 -- (-1014.466) [-1012.943] (-1013.148) (-1009.122) * (-1009.776) (-1008.785) [-1009.759] (-1007.028) -- 0:00:22 642000 -- (-1010.358) (-1007.472) [-1009.264] (-1007.941) * [-1009.606] (-1007.843) (-1009.128) (-1008.360) -- 0:00:22 642500 -- (-1008.934) (-1011.035) (-1010.747) [-1008.474] * (-1008.309) (-1007.477) [-1010.162] (-1009.900) -- 0:00:22 643000 -- [-1008.908] (-1009.687) (-1008.186) (-1012.651) * (-1009.873) (-1011.810) (-1011.488) [-1010.142] -- 0:00:22 643500 -- (-1009.208) [-1009.947] (-1009.227) (-1011.535) * (-1012.093) (-1010.122) [-1007.530] (-1009.468) -- 0:00:22 644000 -- (-1007.319) (-1010.326) (-1008.459) [-1008.470] * [-1010.595] (-1007.714) (-1008.649) (-1010.461) -- 0:00:22 644500 -- [-1007.700] (-1011.483) (-1009.048) (-1008.337) * (-1011.982) (-1012.759) (-1009.694) [-1010.824] -- 0:00:22 645000 -- (-1008.067) (-1008.152) [-1008.570] (-1008.121) * (-1007.048) [-1008.493] (-1009.019) (-1008.357) -- 0:00:22 Average standard deviation of split frequencies: 0.011539 645500 -- [-1007.744] (-1007.807) (-1009.693) (-1009.337) * (-1007.378) [-1007.639] (-1007.333) (-1007.255) -- 0:00:22 646000 -- [-1008.322] (-1007.903) (-1010.037) (-1007.884) * (-1008.861) (-1007.932) [-1011.773] (-1017.618) -- 0:00:22 646500 -- (-1013.083) [-1007.438] (-1013.063) (-1008.565) * (-1009.369) (-1008.109) [-1011.157] (-1008.897) -- 0:00:22 647000 -- (-1009.488) (-1007.834) (-1011.451) [-1006.855] * (-1008.297) [-1009.483] (-1009.936) (-1008.744) -- 0:00:22 647500 -- (-1007.030) (-1009.755) [-1009.453] (-1011.968) * (-1007.917) [-1008.962] (-1011.360) (-1007.865) -- 0:00:22 648000 -- (-1008.535) [-1010.557] (-1007.164) (-1008.786) * [-1007.095] (-1007.765) (-1009.744) (-1008.550) -- 0:00:22 648500 -- (-1010.289) (-1007.201) (-1008.666) [-1010.599] * (-1008.564) (-1007.444) (-1010.246) [-1007.510] -- 0:00:22 649000 -- (-1008.257) [-1007.176] (-1008.768) (-1010.911) * (-1007.584) (-1009.641) (-1010.070) [-1007.346] -- 0:00:22 649500 -- (-1008.832) (-1011.031) [-1008.380] (-1010.929) * (-1007.529) (-1009.362) [-1008.246] (-1006.808) -- 0:00:22 650000 -- (-1010.384) (-1009.409) [-1008.481] (-1009.119) * [-1009.307] (-1011.393) (-1007.899) (-1010.267) -- 0:00:22 Average standard deviation of split frequencies: 0.011637 650500 -- [-1006.923] (-1009.818) (-1008.879) (-1008.155) * (-1007.842) [-1010.481] (-1009.181) (-1008.836) -- 0:00:22 651000 -- (-1008.353) (-1008.639) (-1013.021) [-1008.033] * [-1009.309] (-1009.755) (-1009.317) (-1013.549) -- 0:00:21 651500 -- (-1007.843) (-1007.288) [-1009.409] (-1015.457) * [-1008.353] (-1010.166) (-1010.698) (-1009.090) -- 0:00:21 652000 -- (-1007.995) (-1006.850) [-1008.423] (-1009.209) * [-1007.938] (-1007.348) (-1013.642) (-1008.152) -- 0:00:21 652500 -- (-1009.971) (-1010.235) (-1008.390) [-1008.251] * (-1014.223) [-1007.911] (-1022.182) (-1006.949) -- 0:00:21 653000 -- (-1006.765) (-1008.950) (-1008.152) [-1010.157] * (-1011.328) (-1008.200) [-1008.303] (-1011.828) -- 0:00:21 653500 -- (-1010.637) [-1011.317] (-1006.856) (-1006.639) * (-1008.354) (-1008.186) [-1007.843] (-1009.713) -- 0:00:21 654000 -- (-1007.681) (-1009.464) [-1007.893] (-1006.763) * (-1009.070) (-1008.490) (-1009.248) [-1007.454] -- 0:00:21 654500 -- (-1007.125) (-1007.442) (-1008.319) [-1010.118] * [-1008.832] (-1007.080) (-1010.489) (-1011.947) -- 0:00:21 655000 -- (-1008.733) [-1007.000] (-1008.225) (-1008.265) * [-1006.592] (-1007.526) (-1009.288) (-1007.428) -- 0:00:21 Average standard deviation of split frequencies: 0.011228 655500 -- (-1007.350) [-1008.982] (-1007.255) (-1011.286) * (-1008.621) (-1009.558) (-1009.425) [-1009.652] -- 0:00:21 656000 -- (-1009.401) (-1009.915) [-1007.439] (-1010.521) * (-1009.244) (-1008.992) [-1010.814] (-1009.202) -- 0:00:21 656500 -- (-1009.728) [-1009.489] (-1007.994) (-1009.121) * [-1008.060] (-1006.835) (-1012.279) (-1009.096) -- 0:00:21 657000 -- [-1008.484] (-1011.749) (-1008.512) (-1009.917) * [-1008.155] (-1008.620) (-1010.232) (-1009.580) -- 0:00:21 657500 -- [-1008.203] (-1009.826) (-1010.216) (-1009.942) * [-1015.365] (-1008.446) (-1008.233) (-1009.409) -- 0:00:21 658000 -- (-1006.788) (-1011.456) [-1013.615] (-1008.069) * (-1010.057) [-1010.355] (-1008.027) (-1007.900) -- 0:00:21 658500 -- (-1009.109) [-1007.972] (-1010.080) (-1013.205) * (-1011.559) (-1012.177) (-1008.641) [-1007.776] -- 0:00:21 659000 -- (-1007.885) (-1008.029) (-1012.826) [-1009.150] * [-1010.602] (-1010.171) (-1016.122) (-1008.433) -- 0:00:21 659500 -- (-1007.500) [-1007.572] (-1008.728) (-1010.522) * [-1008.564] (-1009.205) (-1006.983) (-1011.626) -- 0:00:21 660000 -- (-1009.926) (-1009.329) [-1009.728] (-1009.646) * [-1007.662] (-1007.966) (-1007.308) (-1009.159) -- 0:00:21 Average standard deviation of split frequencies: 0.010792 660500 -- (-1010.785) [-1007.505] (-1007.679) (-1008.232) * [-1007.628] (-1006.990) (-1009.456) (-1007.333) -- 0:00:21 661000 -- (-1008.068) (-1007.403) [-1013.794] (-1007.856) * (-1010.402) (-1007.019) [-1008.736] (-1007.116) -- 0:00:21 661500 -- [-1007.764] (-1012.475) (-1009.155) (-1007.085) * (-1012.338) (-1007.976) [-1008.387] (-1008.476) -- 0:00:21 662000 -- [-1006.959] (-1011.773) (-1007.941) (-1007.830) * (-1013.682) (-1007.025) [-1011.820] (-1009.574) -- 0:00:21 662500 -- (-1007.022) (-1008.768) [-1008.357] (-1006.768) * (-1009.505) (-1007.552) [-1009.842] (-1007.251) -- 0:00:21 663000 -- [-1009.521] (-1007.548) (-1012.255) (-1007.910) * (-1008.844) (-1009.854) [-1009.655] (-1009.015) -- 0:00:21 663500 -- [-1008.919] (-1008.120) (-1009.694) (-1007.660) * (-1007.908) [-1013.738] (-1008.031) (-1008.260) -- 0:00:21 664000 -- [-1008.963] (-1010.657) (-1013.777) (-1007.699) * (-1015.737) [-1009.497] (-1009.902) (-1011.036) -- 0:00:21 664500 -- (-1011.339) (-1012.518) (-1012.773) [-1007.495] * (-1007.964) [-1011.722] (-1011.733) (-1010.192) -- 0:00:21 665000 -- (-1007.434) (-1011.549) (-1008.367) [-1009.679] * (-1010.564) (-1010.829) (-1011.886) [-1009.055] -- 0:00:21 Average standard deviation of split frequencies: 0.010883 665500 -- (-1008.411) (-1009.981) [-1008.397] (-1008.277) * (-1008.656) (-1008.687) [-1006.999] (-1009.274) -- 0:00:21 666000 -- (-1007.613) (-1007.175) (-1009.702) [-1008.790] * [-1007.872] (-1007.412) (-1008.869) (-1008.747) -- 0:00:21 666500 -- (-1007.939) [-1007.607] (-1009.842) (-1008.808) * (-1011.851) (-1006.886) [-1009.769] (-1008.509) -- 0:00:21 667000 -- (-1009.937) [-1011.416] (-1007.095) (-1013.430) * (-1007.863) (-1007.525) [-1009.299] (-1010.097) -- 0:00:20 667500 -- [-1009.599] (-1008.602) (-1007.794) (-1008.033) * (-1008.363) [-1006.566] (-1008.743) (-1011.706) -- 0:00:20 668000 -- (-1008.797) (-1007.661) (-1008.731) [-1008.688] * (-1007.121) [-1006.809] (-1009.604) (-1010.344) -- 0:00:20 668500 -- (-1008.612) (-1007.529) [-1011.344] (-1008.551) * (-1007.130) [-1007.232] (-1008.897) (-1008.468) -- 0:00:20 669000 -- (-1009.997) (-1011.247) (-1008.945) [-1007.362] * (-1008.672) [-1007.750] (-1008.171) (-1009.960) -- 0:00:20 669500 -- (-1008.105) (-1007.036) (-1010.564) [-1008.813] * (-1008.957) (-1010.590) (-1007.216) [-1007.632] -- 0:00:20 670000 -- [-1008.362] (-1009.123) (-1009.877) (-1009.662) * (-1007.192) (-1010.239) (-1008.478) [-1008.266] -- 0:00:20 Average standard deviation of split frequencies: 0.011290 670500 -- [-1008.886] (-1011.180) (-1007.955) (-1010.587) * (-1007.605) (-1013.358) (-1007.893) [-1010.868] -- 0:00:20 671000 -- (-1009.939) [-1009.978] (-1009.373) (-1008.626) * (-1007.539) [-1008.778] (-1007.579) (-1007.974) -- 0:00:20 671500 -- (-1012.166) [-1008.782] (-1008.810) (-1008.158) * (-1009.527) (-1010.228) [-1007.893] (-1011.508) -- 0:00:20 672000 -- [-1006.848] (-1008.644) (-1011.263) (-1007.395) * [-1009.108] (-1009.481) (-1010.687) (-1008.807) -- 0:00:20 672500 -- (-1008.129) [-1008.757] (-1010.111) (-1007.368) * (-1010.441) (-1009.050) (-1010.225) [-1007.771] -- 0:00:20 673000 -- [-1008.298] (-1007.230) (-1008.375) (-1009.745) * (-1010.650) (-1007.874) [-1008.125] (-1012.894) -- 0:00:20 673500 -- [-1014.701] (-1009.157) (-1011.686) (-1011.428) * (-1008.932) (-1008.059) (-1008.138) [-1007.468] -- 0:00:20 674000 -- [-1011.951] (-1007.859) (-1008.992) (-1010.449) * [-1007.738] (-1007.865) (-1012.997) (-1013.034) -- 0:00:20 674500 -- (-1011.096) (-1010.719) (-1007.226) [-1007.558] * (-1006.739) (-1006.849) [-1014.172] (-1020.280) -- 0:00:20 675000 -- (-1008.944) (-1008.577) [-1009.207] (-1009.977) * [-1009.500] (-1010.192) (-1009.205) (-1006.981) -- 0:00:20 Average standard deviation of split frequencies: 0.011375 675500 -- (-1008.387) (-1012.082) (-1009.099) [-1008.901] * [-1008.368] (-1009.081) (-1016.959) (-1012.579) -- 0:00:20 676000 -- (-1011.892) [-1008.155] (-1008.309) (-1008.685) * (-1009.572) (-1010.533) [-1008.856] (-1008.606) -- 0:00:20 676500 -- (-1011.149) (-1007.429) (-1008.766) [-1012.775] * (-1011.164) [-1008.285] (-1007.729) (-1011.660) -- 0:00:20 677000 -- (-1009.923) [-1008.832] (-1008.672) (-1010.196) * [-1012.029] (-1008.320) (-1008.326) (-1011.922) -- 0:00:20 677500 -- [-1008.100] (-1007.526) (-1008.350) (-1010.512) * (-1011.240) (-1009.464) (-1007.937) [-1006.875] -- 0:00:20 678000 -- [-1009.451] (-1008.422) (-1009.819) (-1010.220) * (-1008.316) (-1006.963) [-1008.527] (-1010.353) -- 0:00:20 678500 -- (-1017.416) [-1012.244] (-1009.572) (-1007.567) * [-1010.093] (-1007.204) (-1008.674) (-1007.912) -- 0:00:20 679000 -- (-1010.806) [-1009.421] (-1010.619) (-1010.349) * (-1013.435) [-1014.454] (-1007.753) (-1009.648) -- 0:00:20 679500 -- (-1011.416) (-1011.071) [-1011.259] (-1013.458) * (-1010.686) (-1014.843) (-1008.145) [-1011.870] -- 0:00:20 680000 -- (-1011.194) [-1008.601] (-1012.307) (-1010.669) * (-1008.894) [-1009.416] (-1009.551) (-1010.747) -- 0:00:20 Average standard deviation of split frequencies: 0.011644 680500 -- (-1012.082) (-1009.339) [-1011.027] (-1011.079) * (-1008.316) (-1010.441) [-1007.763] (-1008.977) -- 0:00:20 681000 -- (-1011.150) [-1008.746] (-1011.056) (-1010.783) * (-1008.185) (-1006.766) (-1007.594) [-1008.426] -- 0:00:20 681500 -- (-1008.360) (-1009.110) [-1010.063] (-1008.767) * (-1006.962) (-1013.219) [-1010.474] (-1008.174) -- 0:00:20 682000 -- [-1007.775] (-1014.027) (-1009.505) (-1007.704) * (-1006.690) (-1009.156) [-1012.400] (-1014.033) -- 0:00:20 682500 -- [-1007.814] (-1010.264) (-1014.687) (-1008.390) * (-1007.349) (-1009.136) (-1008.205) [-1008.774] -- 0:00:20 683000 -- (-1008.089) (-1010.201) (-1006.919) [-1006.847] * (-1009.950) (-1007.028) [-1007.800] (-1009.900) -- 0:00:19 683500 -- (-1007.150) (-1008.496) [-1007.313] (-1007.302) * [-1007.647] (-1012.415) (-1007.135) (-1009.459) -- 0:00:19 684000 -- [-1009.160] (-1009.109) (-1009.281) (-1009.704) * (-1009.290) (-1007.982) (-1007.219) [-1007.989] -- 0:00:19 684500 -- (-1008.615) (-1008.393) [-1008.836] (-1008.776) * (-1010.356) (-1008.268) (-1007.881) [-1009.094] -- 0:00:19 685000 -- (-1009.068) [-1010.586] (-1007.817) (-1009.884) * (-1008.059) (-1014.045) (-1009.567) [-1007.825] -- 0:00:19 Average standard deviation of split frequencies: 0.011424 685500 -- [-1007.365] (-1008.444) (-1008.602) (-1009.916) * (-1006.901) [-1014.253] (-1009.243) (-1008.716) -- 0:00:19 686000 -- (-1007.463) (-1007.442) [-1010.229] (-1007.642) * (-1011.520) (-1013.465) [-1013.124] (-1008.759) -- 0:00:19 686500 -- (-1008.255) (-1007.642) (-1010.465) [-1008.213] * [-1010.766] (-1008.305) (-1013.394) (-1007.882) -- 0:00:19 687000 -- (-1012.858) (-1008.241) [-1006.654] (-1014.214) * (-1012.370) (-1010.873) (-1011.762) [-1008.455] -- 0:00:19 687500 -- (-1007.697) (-1009.044) [-1007.330] (-1008.207) * [-1011.842] (-1008.002) (-1009.714) (-1009.667) -- 0:00:19 688000 -- (-1008.282) (-1010.542) [-1007.567] (-1008.917) * (-1007.752) [-1007.704] (-1012.658) (-1012.020) -- 0:00:19 688500 -- (-1007.770) (-1012.249) [-1007.692] (-1011.938) * [-1008.051] (-1015.095) (-1009.735) (-1007.417) -- 0:00:19 689000 -- (-1008.924) (-1008.636) (-1009.934) [-1012.544] * (-1007.093) (-1012.077) [-1008.309] (-1007.506) -- 0:00:19 689500 -- (-1008.048) (-1007.703) (-1011.272) [-1008.323] * [-1010.880] (-1010.868) (-1008.416) (-1007.607) -- 0:00:19 690000 -- (-1008.259) (-1007.703) (-1014.246) [-1008.428] * (-1011.749) [-1012.478] (-1007.870) (-1010.925) -- 0:00:19 Average standard deviation of split frequencies: 0.011688 690500 -- (-1008.344) [-1008.414] (-1012.765) (-1012.009) * (-1014.613) [-1009.627] (-1007.567) (-1010.188) -- 0:00:19 691000 -- (-1008.509) (-1007.235) (-1010.629) [-1007.731] * (-1009.674) (-1006.827) [-1012.332] (-1012.284) -- 0:00:19 691500 -- (-1012.523) (-1007.868) (-1007.783) [-1007.373] * (-1012.608) (-1008.081) [-1007.503] (-1007.859) -- 0:00:19 692000 -- (-1009.248) [-1007.669] (-1009.558) (-1007.629) * (-1007.469) [-1008.622] (-1010.572) (-1012.954) -- 0:00:19 692500 -- [-1008.157] (-1011.241) (-1007.607) (-1007.715) * (-1008.333) (-1010.162) [-1007.106] (-1009.532) -- 0:00:19 693000 -- (-1008.136) (-1006.621) (-1009.577) [-1007.676] * (-1006.894) (-1007.976) (-1009.393) [-1009.373] -- 0:00:19 693500 -- [-1008.148] (-1009.251) (-1007.119) (-1007.360) * (-1006.856) [-1008.064] (-1009.015) (-1010.329) -- 0:00:19 694000 -- [-1008.206] (-1008.033) (-1007.490) (-1010.715) * (-1007.664) [-1010.384] (-1008.337) (-1007.825) -- 0:00:19 694500 -- (-1008.194) (-1014.375) (-1009.242) [-1007.526] * (-1007.478) (-1011.245) (-1010.153) [-1007.011] -- 0:00:19 695000 -- (-1008.137) (-1015.454) [-1011.262] (-1006.757) * (-1011.197) (-1007.792) (-1008.957) [-1008.379] -- 0:00:19 Average standard deviation of split frequencies: 0.011599 695500 -- [-1009.850] (-1010.228) (-1009.042) (-1013.789) * [-1009.502] (-1008.545) (-1009.839) (-1009.074) -- 0:00:19 696000 -- (-1012.913) [-1008.357] (-1006.931) (-1006.728) * (-1009.262) [-1008.479] (-1009.850) (-1008.531) -- 0:00:19 696500 -- (-1009.458) (-1008.512) [-1007.706] (-1009.160) * (-1011.130) [-1010.135] (-1013.357) (-1011.336) -- 0:00:19 697000 -- (-1013.712) (-1009.760) [-1008.679] (-1011.531) * (-1013.345) [-1008.922] (-1008.766) (-1011.807) -- 0:00:19 697500 -- (-1011.266) (-1013.823) (-1009.824) [-1007.528] * [-1011.479] (-1008.609) (-1007.487) (-1011.344) -- 0:00:19 698000 -- (-1009.182) (-1009.790) [-1008.134] (-1007.225) * (-1012.812) (-1008.190) [-1009.580] (-1009.964) -- 0:00:19 698500 -- [-1007.194] (-1008.674) (-1007.358) (-1009.663) * (-1012.075) (-1008.850) [-1008.671] (-1011.273) -- 0:00:18 699000 -- (-1006.923) (-1007.963) [-1007.947] (-1009.149) * (-1009.901) [-1008.544] (-1009.730) (-1007.474) -- 0:00:18 699500 -- (-1007.261) [-1008.082] (-1010.030) (-1008.363) * (-1012.785) (-1011.363) [-1008.108] (-1007.914) -- 0:00:18 700000 -- (-1011.358) (-1007.739) [-1009.129] (-1008.404) * (-1013.525) [-1007.925] (-1008.207) (-1008.768) -- 0:00:18 Average standard deviation of split frequencies: 0.011395 700500 -- (-1006.988) (-1010.253) [-1009.198] (-1008.627) * [-1011.422] (-1007.328) (-1008.476) (-1007.648) -- 0:00:18 701000 -- (-1007.724) [-1009.284] (-1008.914) (-1007.905) * (-1012.964) [-1008.894] (-1009.340) (-1007.692) -- 0:00:18 701500 -- (-1006.834) (-1009.331) [-1008.135] (-1008.305) * [-1009.783] (-1009.809) (-1009.441) (-1008.694) -- 0:00:18 702000 -- (-1007.685) [-1011.403] (-1008.460) (-1010.339) * (-1007.626) [-1007.634] (-1008.451) (-1008.851) -- 0:00:18 702500 -- [-1007.958] (-1008.737) (-1011.530) (-1007.107) * [-1008.685] (-1011.069) (-1006.642) (-1008.641) -- 0:00:18 703000 -- (-1008.449) (-1013.208) (-1010.935) [-1008.802] * [-1008.012] (-1007.575) (-1007.177) (-1007.485) -- 0:00:18 703500 -- [-1007.278] (-1008.551) (-1008.090) (-1010.587) * (-1009.639) [-1007.972] (-1007.560) (-1008.350) -- 0:00:18 704000 -- (-1010.188) [-1008.441] (-1008.208) (-1008.630) * (-1009.672) (-1008.626) (-1007.336) [-1009.351] -- 0:00:18 704500 -- (-1007.750) (-1007.842) [-1007.758] (-1010.400) * (-1012.000) (-1010.354) (-1008.056) [-1008.015] -- 0:00:18 705000 -- (-1008.894) (-1008.301) [-1013.185] (-1006.985) * (-1007.451) [-1008.303] (-1009.921) (-1008.997) -- 0:00:18 Average standard deviation of split frequencies: 0.010976 705500 -- [-1007.350] (-1008.155) (-1010.026) (-1007.206) * (-1008.840) (-1009.246) (-1013.894) [-1011.405] -- 0:00:18 706000 -- [-1007.664] (-1007.835) (-1013.878) (-1008.083) * (-1007.383) (-1011.710) [-1010.214] (-1007.560) -- 0:00:18 706500 -- (-1007.787) (-1009.664) (-1009.554) [-1011.111] * [-1008.632] (-1012.138) (-1008.702) (-1008.158) -- 0:00:18 707000 -- [-1006.455] (-1012.315) (-1011.165) (-1013.745) * (-1010.115) (-1009.982) [-1006.651] (-1007.257) -- 0:00:18 707500 -- [-1006.439] (-1010.526) (-1010.419) (-1011.030) * [-1012.092] (-1013.383) (-1009.475) (-1011.406) -- 0:00:18 708000 -- (-1008.414) [-1007.815] (-1009.804) (-1008.082) * (-1013.091) (-1010.342) [-1008.331] (-1007.529) -- 0:00:18 708500 -- (-1006.501) [-1008.960] (-1007.097) (-1009.222) * (-1007.733) (-1009.748) [-1008.194] (-1009.187) -- 0:00:18 709000 -- (-1008.082) [-1008.309] (-1008.700) (-1009.339) * (-1007.798) (-1008.394) (-1015.400) [-1009.917] -- 0:00:18 709500 -- (-1008.089) [-1009.242] (-1008.414) (-1008.030) * [-1008.528] (-1010.264) (-1009.240) (-1007.670) -- 0:00:18 710000 -- (-1008.221) [-1009.691] (-1009.173) (-1007.533) * (-1007.688) [-1008.820] (-1007.791) (-1009.377) -- 0:00:18 Average standard deviation of split frequencies: 0.010530 710500 -- [-1008.855] (-1008.928) (-1009.854) (-1006.950) * (-1007.593) [-1009.579] (-1007.635) (-1008.998) -- 0:00:18 711000 -- (-1008.946) (-1008.156) [-1009.902] (-1008.527) * (-1008.304) (-1009.650) [-1008.430] (-1010.230) -- 0:00:18 711500 -- (-1014.991) [-1007.918] (-1006.717) (-1010.519) * (-1008.274) [-1009.460] (-1011.088) (-1010.953) -- 0:00:18 712000 -- (-1009.516) [-1008.360] (-1008.867) (-1006.888) * [-1010.940] (-1011.508) (-1008.217) (-1010.297) -- 0:00:18 712500 -- [-1009.698] (-1010.316) (-1008.593) (-1008.914) * [-1007.390] (-1009.737) (-1009.642) (-1009.246) -- 0:00:18 713000 -- (-1010.040) (-1010.435) [-1008.013] (-1007.869) * (-1013.005) (-1009.448) [-1008.312] (-1008.612) -- 0:00:18 713500 -- (-1010.253) (-1009.038) (-1009.220) [-1008.042] * [-1013.813] (-1008.128) (-1007.884) (-1008.520) -- 0:00:18 714000 -- (-1012.187) [-1007.626] (-1008.002) (-1008.096) * [-1009.295] (-1008.703) (-1009.123) (-1010.146) -- 0:00:18 714500 -- [-1011.129] (-1006.812) (-1009.654) (-1008.741) * [-1008.519] (-1006.569) (-1008.787) (-1010.942) -- 0:00:17 715000 -- (-1007.604) [-1006.923] (-1007.290) (-1009.274) * (-1009.744) (-1012.876) (-1007.599) [-1008.486] -- 0:00:17 Average standard deviation of split frequencies: 0.010164 715500 -- [-1011.331] (-1009.515) (-1007.999) (-1011.771) * [-1007.515] (-1009.705) (-1006.620) (-1007.581) -- 0:00:17 716000 -- (-1011.394) (-1008.612) [-1010.000] (-1008.754) * [-1007.707] (-1012.041) (-1008.444) (-1008.304) -- 0:00:17 716500 -- [-1007.781] (-1009.333) (-1008.059) (-1010.498) * [-1008.378] (-1011.416) (-1013.050) (-1011.435) -- 0:00:17 717000 -- (-1006.652) [-1009.340] (-1008.744) (-1011.392) * (-1010.966) (-1010.913) [-1012.316] (-1009.555) -- 0:00:17 717500 -- (-1010.249) [-1008.728] (-1008.648) (-1009.430) * [-1007.783] (-1011.098) (-1007.556) (-1008.271) -- 0:00:17 718000 -- (-1008.196) [-1009.484] (-1008.722) (-1008.345) * [-1006.972] (-1014.178) (-1010.036) (-1007.853) -- 0:00:17 718500 -- [-1007.421] (-1010.302) (-1010.324) (-1009.138) * [-1006.760] (-1010.212) (-1013.001) (-1011.518) -- 0:00:17 719000 -- [-1010.295] (-1009.545) (-1010.455) (-1006.865) * (-1007.779) [-1007.088] (-1010.173) (-1008.449) -- 0:00:17 719500 -- [-1009.337] (-1007.698) (-1007.191) (-1007.549) * [-1009.843] (-1008.279) (-1013.708) (-1011.154) -- 0:00:17 720000 -- (-1007.700) (-1009.572) [-1007.318] (-1007.204) * (-1007.841) [-1010.208] (-1011.889) (-1010.338) -- 0:00:17 Average standard deviation of split frequencies: 0.010507 720500 -- [-1008.265] (-1013.608) (-1009.174) (-1007.134) * (-1007.576) (-1008.389) [-1010.618] (-1007.914) -- 0:00:17 721000 -- (-1008.459) [-1009.660] (-1013.757) (-1009.317) * (-1008.167) [-1011.079] (-1008.085) (-1009.641) -- 0:00:17 721500 -- (-1014.168) [-1007.164] (-1010.488) (-1007.746) * (-1007.593) [-1008.788] (-1007.287) (-1009.794) -- 0:00:17 722000 -- (-1010.340) (-1006.748) [-1009.733] (-1007.805) * [-1007.398] (-1007.924) (-1007.444) (-1011.201) -- 0:00:17 722500 -- [-1007.360] (-1010.986) (-1008.784) (-1007.599) * (-1008.801) (-1007.163) [-1008.704] (-1010.479) -- 0:00:17 723000 -- (-1007.537) [-1008.192] (-1014.333) (-1011.257) * (-1012.982) (-1010.186) [-1007.591] (-1009.306) -- 0:00:17 723500 -- [-1008.366] (-1007.196) (-1012.853) (-1012.369) * (-1008.968) (-1011.793) [-1007.185] (-1010.133) -- 0:00:17 724000 -- (-1008.503) (-1007.988) (-1013.581) [-1010.092] * (-1008.110) [-1010.319] (-1008.345) (-1008.431) -- 0:00:17 724500 -- (-1008.036) (-1008.036) [-1007.197] (-1011.454) * (-1012.828) (-1007.831) (-1009.831) [-1008.473] -- 0:00:17 725000 -- (-1007.836) (-1007.970) [-1009.013] (-1009.420) * (-1010.035) [-1008.727] (-1012.254) (-1007.064) -- 0:00:17 Average standard deviation of split frequencies: 0.010105 725500 -- (-1009.432) (-1006.759) [-1008.893] (-1010.414) * (-1009.674) [-1011.534] (-1013.766) (-1009.899) -- 0:00:17 726000 -- (-1007.241) (-1007.769) [-1007.740] (-1006.886) * (-1011.618) (-1010.973) [-1010.941] (-1008.409) -- 0:00:17 726500 -- (-1007.996) [-1010.278] (-1006.966) (-1008.004) * (-1008.272) (-1011.075) [-1008.011] (-1007.952) -- 0:00:17 727000 -- [-1012.356] (-1007.758) (-1007.761) (-1007.423) * [-1006.863] (-1008.115) (-1010.575) (-1010.392) -- 0:00:17 727500 -- (-1008.740) (-1012.974) (-1008.700) [-1006.843] * (-1006.846) (-1012.219) (-1011.146) [-1007.093] -- 0:00:17 728000 -- (-1007.576) (-1009.532) (-1009.167) [-1006.851] * [-1009.910] (-1010.667) (-1009.413) (-1009.477) -- 0:00:17 728500 -- (-1006.682) (-1008.309) (-1009.300) [-1007.635] * [-1009.111] (-1008.866) (-1007.859) (-1008.476) -- 0:00:17 729000 -- (-1006.779) (-1009.981) (-1009.284) [-1009.152] * (-1007.982) (-1010.819) (-1012.019) [-1011.269] -- 0:00:17 729500 -- (-1008.648) (-1009.164) [-1009.657] (-1009.539) * (-1013.149) (-1009.391) (-1008.475) [-1009.685] -- 0:00:17 730000 -- (-1013.249) (-1010.773) (-1008.132) [-1007.595] * (-1011.925) [-1008.280] (-1011.623) (-1009.528) -- 0:00:17 Average standard deviation of split frequencies: 0.010282 730500 -- [-1007.787] (-1007.418) (-1010.972) (-1008.979) * [-1009.037] (-1010.714) (-1007.688) (-1012.022) -- 0:00:16 731000 -- (-1008.306) (-1006.846) (-1008.954) [-1008.487] * (-1008.129) [-1008.765] (-1009.489) (-1011.225) -- 0:00:16 731500 -- (-1009.453) [-1008.231] (-1007.974) (-1008.396) * (-1008.588) (-1009.023) [-1010.908] (-1007.048) -- 0:00:16 732000 -- [-1007.480] (-1007.340) (-1008.271) (-1007.393) * (-1009.574) (-1011.119) (-1009.482) [-1012.405] -- 0:00:16 732500 -- (-1017.869) (-1010.288) [-1007.168] (-1008.548) * (-1010.545) [-1012.437] (-1011.804) (-1011.388) -- 0:00:16 733000 -- [-1009.423] (-1011.759) (-1007.057) (-1008.398) * (-1009.456) (-1009.775) (-1009.064) [-1009.069] -- 0:00:16 733500 -- (-1006.704) (-1007.124) (-1008.391) [-1008.598] * (-1013.126) (-1010.527) (-1011.427) [-1009.006] -- 0:00:16 734000 -- (-1006.754) [-1008.002] (-1007.380) (-1008.591) * (-1007.110) (-1008.704) (-1011.463) [-1008.585] -- 0:00:16 734500 -- (-1006.586) (-1008.488) (-1009.968) [-1007.446] * (-1007.422) (-1008.978) [-1008.149] (-1007.363) -- 0:00:16 735000 -- (-1009.186) (-1008.580) [-1009.074] (-1008.347) * (-1009.705) [-1008.662] (-1009.098) (-1007.408) -- 0:00:16 Average standard deviation of split frequencies: 0.009968 735500 -- (-1008.801) [-1009.402] (-1008.903) (-1011.452) * [-1007.735] (-1011.417) (-1006.997) (-1007.625) -- 0:00:16 736000 -- (-1007.519) [-1011.689] (-1008.167) (-1007.371) * [-1007.904] (-1011.554) (-1007.853) (-1010.259) -- 0:00:16 736500 -- [-1007.649] (-1007.770) (-1010.699) (-1009.340) * (-1010.008) (-1009.000) [-1012.854] (-1009.370) -- 0:00:16 737000 -- (-1008.788) (-1011.475) (-1011.653) [-1008.975] * [-1009.138] (-1010.072) (-1009.275) (-1008.987) -- 0:00:16 737500 -- (-1008.478) [-1009.709] (-1011.572) (-1008.003) * (-1010.567) (-1008.616) (-1007.805) [-1007.191] -- 0:00:16 738000 -- (-1009.448) [-1007.978] (-1009.204) (-1010.828) * [-1007.893] (-1006.745) (-1008.177) (-1007.610) -- 0:00:16 738500 -- (-1007.847) (-1007.519) [-1007.675] (-1016.342) * [-1007.096] (-1009.599) (-1008.227) (-1007.410) -- 0:00:16 739000 -- (-1008.714) (-1009.477) (-1007.655) [-1010.447] * (-1011.002) (-1013.415) [-1007.710] (-1008.232) -- 0:00:16 739500 -- (-1009.306) (-1007.429) [-1011.539] (-1007.957) * (-1007.418) (-1010.960) (-1007.552) [-1009.406] -- 0:00:16 740000 -- [-1007.902] (-1008.332) (-1008.816) (-1009.487) * [-1006.666] (-1007.977) (-1007.950) (-1009.147) -- 0:00:16 Average standard deviation of split frequencies: 0.009428 740500 -- (-1006.612) [-1007.746] (-1009.553) (-1007.896) * (-1007.540) (-1008.679) (-1009.171) [-1008.454] -- 0:00:16 741000 -- (-1007.848) (-1008.869) [-1011.443] (-1007.189) * (-1011.250) (-1009.644) [-1011.108] (-1008.003) -- 0:00:16 741500 -- [-1008.972] (-1011.103) (-1010.644) (-1010.792) * (-1010.065) (-1008.252) [-1008.388] (-1009.076) -- 0:00:16 742000 -- (-1008.519) (-1010.344) [-1009.448] (-1010.482) * (-1012.381) (-1013.601) [-1008.788] (-1009.988) -- 0:00:16 742500 -- (-1006.646) [-1010.145] (-1007.822) (-1010.060) * [-1009.094] (-1008.297) (-1008.679) (-1008.934) -- 0:00:16 743000 -- (-1007.579) (-1011.792) [-1007.565] (-1008.484) * (-1008.499) (-1008.410) [-1007.442] (-1009.489) -- 0:00:16 743500 -- [-1006.884] (-1014.391) (-1009.026) (-1007.542) * (-1011.338) [-1008.106] (-1010.608) (-1010.917) -- 0:00:16 744000 -- (-1008.583) [-1006.937] (-1017.085) (-1009.252) * [-1009.209] (-1009.696) (-1008.116) (-1010.487) -- 0:00:16 744500 -- (-1012.040) (-1009.014) (-1011.781) [-1009.252] * (-1013.903) [-1007.697] (-1008.747) (-1011.937) -- 0:00:16 745000 -- (-1010.760) (-1010.028) [-1009.697] (-1007.852) * (-1008.251) (-1007.090) [-1009.289] (-1011.634) -- 0:00:16 Average standard deviation of split frequencies: 0.009597 745500 -- (-1010.288) (-1008.283) (-1008.148) [-1008.550] * [-1008.198] (-1009.157) (-1007.497) (-1012.803) -- 0:00:16 746000 -- (-1012.866) (-1010.224) [-1010.155] (-1008.026) * [-1008.193] (-1009.764) (-1007.290) (-1012.058) -- 0:00:16 746500 -- (-1007.157) (-1011.047) (-1010.046) [-1008.241] * (-1006.992) (-1008.685) (-1011.410) [-1010.360] -- 0:00:15 747000 -- (-1010.064) (-1011.478) [-1011.275] (-1009.215) * (-1008.149) [-1008.271] (-1007.338) (-1013.342) -- 0:00:15 747500 -- [-1009.964] (-1007.352) (-1010.644) (-1008.981) * (-1011.191) (-1008.368) [-1010.365] (-1008.490) -- 0:00:15 748000 -- (-1012.508) [-1008.870] (-1009.597) (-1010.232) * (-1008.919) [-1007.304] (-1007.928) (-1008.296) -- 0:00:15 748500 -- (-1009.678) [-1008.093] (-1008.758) (-1007.326) * (-1009.099) (-1008.160) (-1008.650) [-1006.783] -- 0:00:15 749000 -- (-1009.087) (-1007.552) (-1006.786) [-1008.798] * [-1007.975] (-1014.917) (-1008.573) (-1007.949) -- 0:00:15 749500 -- [-1013.518] (-1012.443) (-1007.087) (-1018.703) * [-1008.900] (-1014.992) (-1011.688) (-1008.455) -- 0:00:15 750000 -- [-1010.943] (-1008.353) (-1008.465) (-1010.073) * (-1007.744) [-1007.054] (-1012.375) (-1007.089) -- 0:00:15 Average standard deviation of split frequencies: 0.009773 750500 -- (-1012.942) (-1009.952) (-1012.285) [-1011.388] * [-1008.599] (-1012.490) (-1009.748) (-1009.376) -- 0:00:15 751000 -- [-1011.431] (-1007.065) (-1015.645) (-1010.132) * [-1007.694] (-1010.708) (-1009.541) (-1006.895) -- 0:00:15 751500 -- [-1010.337] (-1007.699) (-1009.617) (-1007.460) * [-1008.218] (-1014.449) (-1008.510) (-1015.292) -- 0:00:15 752000 -- (-1007.604) [-1008.041] (-1007.503) (-1008.414) * (-1010.063) (-1010.671) [-1008.149] (-1011.526) -- 0:00:15 752500 -- [-1009.101] (-1011.470) (-1008.682) (-1011.294) * (-1012.587) (-1010.126) (-1013.039) [-1008.676] -- 0:00:15 753000 -- (-1009.752) (-1009.606) (-1007.280) [-1008.956] * [-1012.219] (-1011.347) (-1007.790) (-1010.259) -- 0:00:15 753500 -- [-1012.326] (-1008.440) (-1010.837) (-1007.344) * (-1008.197) (-1009.384) (-1011.864) [-1011.117] -- 0:00:15 754000 -- [-1008.916] (-1014.437) (-1009.685) (-1009.183) * (-1009.540) (-1007.588) (-1007.338) [-1007.505] -- 0:00:15 754500 -- (-1007.611) (-1007.726) [-1007.535] (-1010.586) * (-1008.050) (-1008.213) [-1009.982] (-1012.029) -- 0:00:15 755000 -- (-1008.058) (-1007.775) (-1010.401) [-1009.435] * (-1008.115) (-1008.061) (-1007.596) [-1007.488] -- 0:00:15 Average standard deviation of split frequencies: 0.009392 755500 -- (-1008.006) (-1007.807) (-1012.084) [-1008.961] * (-1014.368) (-1012.020) [-1012.492] (-1007.019) -- 0:00:15 756000 -- (-1008.463) (-1007.418) [-1009.006] (-1009.018) * (-1008.546) (-1008.130) [-1007.621] (-1006.709) -- 0:00:15 756500 -- [-1008.492] (-1010.399) (-1007.718) (-1008.114) * (-1009.686) [-1009.126] (-1009.529) (-1012.370) -- 0:00:15 757000 -- [-1008.393] (-1006.745) (-1010.423) (-1011.350) * (-1009.163) (-1010.588) (-1008.809) [-1009.105] -- 0:00:15 757500 -- (-1006.950) (-1006.977) (-1009.461) [-1011.120] * (-1010.043) (-1010.272) (-1012.224) [-1008.198] -- 0:00:15 758000 -- (-1009.359) [-1009.270] (-1010.344) (-1009.418) * (-1007.301) (-1014.107) [-1009.011] (-1010.025) -- 0:00:15 758500 -- (-1012.232) (-1009.586) [-1013.288] (-1010.316) * [-1009.955] (-1010.772) (-1008.092) (-1008.480) -- 0:00:15 759000 -- (-1008.862) [-1009.341] (-1011.418) (-1008.820) * (-1009.661) [-1008.255] (-1009.253) (-1007.980) -- 0:00:15 759500 -- (-1012.710) (-1009.225) [-1008.331] (-1011.488) * (-1008.753) (-1007.329) [-1009.270] (-1006.969) -- 0:00:15 760000 -- (-1008.505) (-1008.227) [-1008.680] (-1013.194) * (-1007.159) (-1010.724) (-1009.469) [-1008.975] -- 0:00:15 Average standard deviation of split frequencies: 0.009379 760500 -- (-1008.028) [-1008.324] (-1008.664) (-1009.703) * [-1007.234] (-1009.823) (-1010.838) (-1011.320) -- 0:00:15 761000 -- (-1010.969) (-1009.394) (-1009.668) [-1012.456] * (-1009.331) (-1013.193) (-1010.340) [-1008.606] -- 0:00:15 761500 -- [-1010.950] (-1009.050) (-1011.805) (-1012.519) * (-1007.039) [-1008.198] (-1010.258) (-1015.634) -- 0:00:15 762000 -- (-1008.746) (-1008.856) (-1007.062) [-1007.375] * (-1008.246) (-1009.395) (-1008.693) [-1010.492] -- 0:00:14 762500 -- (-1008.037) (-1008.388) (-1007.315) [-1011.285] * [-1007.029] (-1006.683) (-1007.227) (-1014.057) -- 0:00:14 763000 -- (-1008.543) (-1009.116) [-1013.676] (-1012.730) * (-1007.051) (-1009.256) (-1010.568) [-1007.807] -- 0:00:14 763500 -- (-1009.118) [-1009.945] (-1008.559) (-1006.699) * [-1006.970] (-1006.825) (-1007.321) (-1007.378) -- 0:00:14 764000 -- (-1009.134) [-1007.614] (-1008.745) (-1006.787) * (-1013.488) (-1011.108) [-1011.752] (-1008.738) -- 0:00:14 764500 -- [-1007.263] (-1009.020) (-1008.842) (-1007.190) * (-1011.871) [-1007.206] (-1008.090) (-1006.841) -- 0:00:14 765000 -- [-1008.551] (-1009.092) (-1008.373) (-1007.942) * (-1011.984) [-1008.025] (-1014.036) (-1008.476) -- 0:00:14 Average standard deviation of split frequencies: 0.009308 765500 -- (-1009.207) (-1008.851) (-1007.197) [-1008.435] * (-1007.830) (-1008.439) [-1009.850] (-1006.906) -- 0:00:14 766000 -- (-1007.030) [-1008.658] (-1007.197) (-1010.006) * [-1009.045] (-1008.641) (-1010.631) (-1007.063) -- 0:00:14 766500 -- (-1010.890) (-1013.354) [-1007.720] (-1010.244) * [-1008.064] (-1012.635) (-1009.265) (-1009.192) -- 0:00:14 767000 -- (-1011.955) (-1010.041) [-1008.551] (-1009.299) * (-1010.161) (-1008.246) [-1007.161] (-1011.356) -- 0:00:14 767500 -- (-1009.887) (-1010.438) [-1011.929] (-1010.509) * (-1010.355) (-1007.169) [-1007.884] (-1009.744) -- 0:00:14 768000 -- (-1008.837) [-1009.008] (-1018.572) (-1009.603) * (-1006.863) [-1007.910] (-1012.064) (-1012.425) -- 0:00:14 768500 -- [-1012.180] (-1008.240) (-1015.879) (-1009.545) * (-1010.556) [-1008.139] (-1013.213) (-1014.234) -- 0:00:14 769000 -- (-1009.959) (-1006.685) [-1008.872] (-1014.352) * (-1008.061) [-1009.044] (-1007.849) (-1010.903) -- 0:00:14 769500 -- (-1007.937) (-1007.647) (-1007.430) [-1007.514] * [-1007.455] (-1010.472) (-1013.182) (-1010.178) -- 0:00:14 770000 -- (-1011.115) (-1008.007) (-1007.205) [-1007.460] * [-1007.545] (-1015.580) (-1007.066) (-1008.629) -- 0:00:14 Average standard deviation of split frequencies: 0.009298 770500 -- (-1010.313) [-1008.869] (-1007.849) (-1008.935) * (-1009.776) (-1011.044) [-1006.976] (-1009.128) -- 0:00:14 771000 -- (-1009.511) (-1008.930) (-1007.731) [-1007.155] * (-1009.573) (-1008.943) [-1006.528] (-1010.547) -- 0:00:14 771500 -- [-1008.992] (-1008.442) (-1007.304) (-1008.032) * [-1009.097] (-1009.155) (-1008.899) (-1011.342) -- 0:00:14 772000 -- (-1008.675) (-1009.577) (-1007.108) [-1007.368] * (-1008.035) (-1008.633) (-1009.642) [-1009.451] -- 0:00:14 772500 -- (-1007.418) (-1009.826) (-1007.741) [-1007.334] * (-1007.371) (-1007.885) (-1010.318) [-1007.928] -- 0:00:14 773000 -- [-1006.700] (-1007.095) (-1009.726) (-1008.420) * (-1007.599) (-1008.536) (-1007.450) [-1010.807] -- 0:00:14 773500 -- (-1007.031) (-1007.215) (-1007.483) [-1007.657] * (-1010.064) [-1008.720] (-1007.329) (-1013.748) -- 0:00:14 774000 -- (-1011.090) (-1008.733) (-1009.286) [-1007.616] * (-1009.074) (-1007.053) [-1007.971] (-1007.902) -- 0:00:14 774500 -- (-1008.427) (-1007.669) [-1008.429] (-1008.613) * [-1006.961] (-1009.092) (-1008.568) (-1013.044) -- 0:00:14 775000 -- (-1008.153) (-1009.105) [-1006.919] (-1010.490) * (-1008.886) [-1007.305] (-1007.428) (-1008.581) -- 0:00:14 Average standard deviation of split frequencies: 0.009315 775500 -- [-1007.661] (-1015.974) (-1008.221) (-1008.259) * (-1008.029) (-1007.239) (-1008.695) [-1006.815] -- 0:00:14 776000 -- (-1007.709) (-1014.487) [-1007.507] (-1009.555) * (-1007.903) (-1007.745) [-1009.613] (-1015.742) -- 0:00:14 776500 -- (-1007.585) (-1014.307) (-1010.824) [-1007.652] * (-1006.967) (-1009.325) (-1008.518) [-1010.335] -- 0:00:14 777000 -- (-1007.706) (-1013.192) [-1008.707] (-1006.719) * [-1008.237] (-1011.348) (-1006.916) (-1007.361) -- 0:00:14 777500 -- (-1008.391) (-1009.758) (-1012.054) [-1006.677] * (-1008.686) (-1015.904) [-1007.240] (-1008.906) -- 0:00:14 778000 -- [-1008.176] (-1009.522) (-1011.673) (-1006.696) * [-1010.929] (-1011.917) (-1009.034) (-1008.291) -- 0:00:13 778500 -- (-1007.955) (-1010.253) [-1007.353] (-1007.880) * [-1006.602] (-1008.883) (-1007.841) (-1008.918) -- 0:00:13 779000 -- [-1007.596] (-1006.653) (-1008.477) (-1012.721) * (-1011.149) (-1013.560) (-1006.750) [-1008.195] -- 0:00:13 779500 -- [-1008.248] (-1007.634) (-1011.180) (-1009.435) * [-1011.676] (-1009.507) (-1007.670) (-1008.412) -- 0:00:13 780000 -- (-1008.532) (-1007.010) (-1010.195) [-1008.840] * [-1007.803] (-1014.269) (-1010.065) (-1008.293) -- 0:00:13 Average standard deviation of split frequencies: 0.009380 780500 -- (-1006.911) (-1007.602) [-1009.250] (-1008.668) * (-1009.985) (-1010.991) (-1010.315) [-1014.146] -- 0:00:13 781000 -- (-1006.911) (-1009.683) (-1010.966) [-1008.325] * (-1009.264) [-1009.371] (-1009.036) (-1010.958) -- 0:00:13 781500 -- (-1006.873) [-1008.073] (-1011.857) (-1009.911) * [-1007.992] (-1010.999) (-1010.767) (-1008.193) -- 0:00:13 782000 -- [-1006.862] (-1008.381) (-1009.010) (-1009.775) * (-1007.553) (-1009.210) (-1008.933) [-1009.823] -- 0:00:13 782500 -- (-1006.718) (-1009.180) [-1010.474] (-1012.556) * (-1007.837) [-1007.418] (-1008.284) (-1008.084) -- 0:00:13 783000 -- (-1007.600) [-1008.032] (-1008.847) (-1012.547) * (-1009.510) (-1007.867) [-1011.885] (-1011.737) -- 0:00:13 783500 -- (-1011.604) (-1008.280) (-1006.696) [-1007.686] * (-1010.295) (-1010.698) [-1011.329] (-1010.537) -- 0:00:13 784000 -- (-1013.055) [-1008.236] (-1010.134) (-1007.042) * (-1010.532) [-1009.484] (-1009.281) (-1007.889) -- 0:00:13 784500 -- (-1008.320) [-1008.036] (-1011.414) (-1008.764) * (-1013.242) [-1012.217] (-1008.163) (-1010.567) -- 0:00:13 785000 -- (-1007.582) (-1013.466) (-1008.989) [-1011.651] * (-1008.993) (-1015.194) [-1011.805] (-1007.689) -- 0:00:13 Average standard deviation of split frequencies: 0.009156 785500 -- (-1007.832) [-1008.530] (-1007.840) (-1009.147) * [-1007.431] (-1009.316) (-1010.319) (-1010.469) -- 0:00:13 786000 -- (-1008.163) (-1012.507) (-1009.457) [-1010.381] * (-1007.813) (-1012.453) [-1008.856] (-1006.912) -- 0:00:13 786500 -- [-1007.414] (-1010.808) (-1010.481) (-1009.210) * [-1008.634] (-1009.808) (-1009.587) (-1007.957) -- 0:00:13 787000 -- (-1007.686) (-1009.468) [-1009.485] (-1011.600) * (-1008.291) (-1008.395) (-1009.849) [-1008.254] -- 0:00:13 787500 -- [-1011.201] (-1007.870) (-1009.249) (-1017.267) * [-1007.608] (-1007.618) (-1009.688) (-1008.781) -- 0:00:13 788000 -- (-1012.956) (-1009.383) [-1009.423] (-1008.125) * [-1009.004] (-1007.107) (-1008.257) (-1007.502) -- 0:00:13 788500 -- (-1018.266) (-1012.830) (-1015.940) [-1008.050] * [-1007.369] (-1008.644) (-1010.666) (-1008.253) -- 0:00:13 789000 -- (-1007.828) (-1009.916) (-1007.286) [-1009.834] * (-1006.677) (-1010.289) [-1010.171] (-1009.862) -- 0:00:13 789500 -- [-1008.591] (-1009.662) (-1008.915) (-1009.930) * (-1006.871) [-1007.558] (-1007.551) (-1008.658) -- 0:00:13 790000 -- (-1008.050) [-1007.538] (-1008.986) (-1007.367) * (-1008.448) (-1009.959) (-1007.857) [-1009.437] -- 0:00:13 Average standard deviation of split frequencies: 0.009062 790500 -- (-1011.202) [-1010.869] (-1008.873) (-1007.270) * (-1008.516) [-1007.722] (-1009.013) (-1012.868) -- 0:00:12 791000 -- (-1008.836) (-1009.317) (-1009.970) [-1008.609] * [-1008.793] (-1011.198) (-1011.732) (-1007.718) -- 0:00:13 791500 -- [-1008.294] (-1008.200) (-1009.057) (-1008.508) * (-1009.292) (-1009.346) (-1014.569) [-1007.421] -- 0:00:13 792000 -- (-1010.309) (-1008.553) [-1008.276] (-1011.941) * (-1010.620) [-1007.834] (-1012.689) (-1010.100) -- 0:00:13 792500 -- (-1009.800) [-1008.646] (-1010.785) (-1009.659) * (-1007.915) [-1009.911] (-1010.903) (-1009.303) -- 0:00:13 793000 -- (-1011.674) [-1007.051] (-1011.376) (-1012.250) * (-1010.082) (-1007.837) (-1009.480) [-1008.992] -- 0:00:13 793500 -- (-1010.947) (-1008.420) (-1012.165) [-1008.044] * [-1014.534] (-1008.517) (-1010.746) (-1010.640) -- 0:00:13 794000 -- (-1008.644) [-1008.091] (-1011.269) (-1008.056) * (-1010.961) (-1009.297) (-1011.981) [-1013.318] -- 0:00:12 794500 -- (-1007.773) [-1008.042] (-1010.235) (-1007.704) * (-1009.734) [-1010.854] (-1007.894) (-1012.740) -- 0:00:12 795000 -- (-1011.593) [-1009.173] (-1009.261) (-1006.933) * [-1010.874] (-1009.078) (-1009.669) (-1013.270) -- 0:00:12 Average standard deviation of split frequencies: 0.009278 795500 -- (-1008.901) [-1008.947] (-1011.391) (-1007.638) * (-1013.002) [-1007.384] (-1010.669) (-1011.345) -- 0:00:12 796000 -- (-1009.320) (-1009.365) [-1008.116] (-1006.753) * (-1006.920) (-1013.093) [-1007.533] (-1011.959) -- 0:00:12 796500 -- (-1009.299) (-1011.954) [-1009.331] (-1006.990) * [-1007.494] (-1013.303) (-1009.619) (-1010.617) -- 0:00:12 797000 -- (-1015.841) (-1011.021) (-1007.112) [-1013.787] * (-1009.706) [-1007.361] (-1014.274) (-1010.278) -- 0:00:12 797500 -- (-1008.665) (-1010.540) [-1007.308] (-1009.822) * (-1013.350) (-1006.823) (-1008.716) [-1006.809] -- 0:00:12 798000 -- [-1008.445] (-1009.176) (-1013.820) (-1012.906) * (-1009.026) [-1007.257] (-1010.693) (-1006.716) -- 0:00:12 798500 -- (-1012.279) (-1011.492) (-1014.079) [-1007.574] * (-1012.319) [-1008.784] (-1006.941) (-1008.518) -- 0:00:12 799000 -- [-1008.051] (-1009.113) (-1010.800) (-1008.473) * [-1011.065] (-1011.326) (-1013.157) (-1007.867) -- 0:00:12 799500 -- (-1008.873) (-1014.842) [-1008.642] (-1008.348) * [-1008.184] (-1007.931) (-1009.150) (-1007.614) -- 0:00:12 800000 -- (-1010.584) (-1013.059) (-1008.456) [-1007.861] * (-1008.717) [-1007.638] (-1009.464) (-1007.818) -- 0:00:12 Average standard deviation of split frequencies: 0.009145 800500 -- (-1011.222) [-1008.858] (-1010.856) (-1009.022) * (-1007.536) (-1008.482) [-1009.382] (-1011.201) -- 0:00:12 801000 -- [-1010.895] (-1010.284) (-1007.289) (-1014.420) * [-1007.900] (-1009.446) (-1009.629) (-1011.888) -- 0:00:12 801500 -- (-1008.445) (-1009.512) [-1008.137] (-1008.909) * [-1009.111] (-1009.161) (-1012.142) (-1008.819) -- 0:00:12 802000 -- (-1009.155) [-1011.704] (-1009.400) (-1008.844) * (-1007.078) [-1009.481] (-1007.015) (-1010.324) -- 0:00:12 802500 -- (-1007.783) (-1006.791) [-1010.488] (-1014.377) * (-1009.028) (-1012.842) [-1007.130] (-1009.675) -- 0:00:12 803000 -- (-1010.876) (-1009.257) [-1008.304] (-1008.625) * (-1011.871) (-1006.749) [-1009.437] (-1008.114) -- 0:00:12 803500 -- (-1012.989) (-1010.546) [-1008.244] (-1010.213) * (-1008.801) (-1006.868) [-1016.767] (-1011.430) -- 0:00:12 804000 -- (-1014.785) [-1007.579] (-1008.701) (-1010.653) * (-1008.932) (-1012.679) (-1008.196) [-1009.769] -- 0:00:12 804500 -- (-1013.648) (-1011.938) [-1007.857] (-1013.054) * (-1010.966) [-1011.141] (-1008.272) (-1007.798) -- 0:00:12 805000 -- [-1011.849] (-1010.611) (-1009.901) (-1011.413) * (-1009.121) (-1009.001) (-1013.350) [-1008.046] -- 0:00:12 Average standard deviation of split frequencies: 0.009124 805500 -- (-1012.973) (-1013.371) (-1006.717) [-1007.247] * (-1009.875) (-1007.538) [-1010.102] (-1007.971) -- 0:00:12 806000 -- (-1009.017) (-1011.215) (-1011.610) [-1006.669] * (-1008.453) (-1009.510) [-1008.431] (-1007.707) -- 0:00:12 806500 -- (-1010.411) (-1009.248) [-1010.209] (-1008.249) * (-1009.097) (-1007.799) (-1015.619) [-1007.871] -- 0:00:11 807000 -- (-1009.765) [-1009.524] (-1008.746) (-1008.785) * (-1008.482) (-1009.739) [-1009.104] (-1014.633) -- 0:00:12 807500 -- (-1011.719) (-1007.428) (-1010.527) [-1007.878] * (-1008.756) (-1010.341) (-1008.131) [-1009.358] -- 0:00:12 808000 -- (-1010.484) (-1010.425) [-1007.906] (-1010.021) * (-1008.056) [-1009.935] (-1007.228) (-1014.391) -- 0:00:12 808500 -- [-1006.705] (-1011.549) (-1007.967) (-1008.191) * [-1008.027] (-1010.269) (-1006.516) (-1010.807) -- 0:00:12 809000 -- (-1006.705) [-1009.687] (-1009.810) (-1007.404) * [-1008.383] (-1011.450) (-1007.988) (-1009.583) -- 0:00:12 809500 -- (-1007.680) (-1010.312) (-1009.144) [-1008.324] * [-1008.534] (-1007.987) (-1008.567) (-1009.759) -- 0:00:12 810000 -- (-1007.452) [-1008.751] (-1009.162) (-1012.076) * (-1011.184) (-1008.329) [-1008.235] (-1010.341) -- 0:00:11 Average standard deviation of split frequencies: 0.009343 810500 -- [-1007.396] (-1010.422) (-1008.172) (-1009.930) * (-1011.127) (-1007.479) [-1009.029] (-1010.537) -- 0:00:11 811000 -- (-1009.743) (-1009.165) [-1006.690] (-1008.621) * [-1007.886] (-1010.571) (-1009.020) (-1009.144) -- 0:00:11 811500 -- [-1010.319] (-1011.052) (-1007.575) (-1007.534) * (-1008.078) (-1010.234) [-1009.877] (-1009.019) -- 0:00:11 812000 -- (-1009.958) [-1007.690] (-1007.114) (-1007.224) * (-1007.782) (-1010.017) [-1007.306] (-1011.597) -- 0:00:11 812500 -- (-1011.233) [-1008.173] (-1010.826) (-1009.935) * (-1008.583) (-1007.779) (-1007.271) [-1007.853] -- 0:00:11 813000 -- (-1008.166) (-1008.793) (-1010.704) [-1006.964] * [-1009.202] (-1008.773) (-1007.646) (-1007.508) -- 0:00:11 813500 -- (-1006.649) (-1007.558) (-1010.709) [-1010.513] * [-1007.012] (-1007.930) (-1009.259) (-1006.978) -- 0:00:11 814000 -- (-1006.859) [-1011.196] (-1009.930) (-1009.228) * [-1007.003] (-1006.873) (-1010.013) (-1017.249) -- 0:00:11 814500 -- (-1008.124) [-1007.707] (-1010.002) (-1007.744) * [-1007.069] (-1007.220) (-1012.307) (-1011.125) -- 0:00:11 815000 -- (-1009.105) (-1008.070) [-1008.127] (-1007.616) * (-1008.622) (-1008.200) (-1008.819) [-1009.059] -- 0:00:11 Average standard deviation of split frequencies: 0.009513 815500 -- [-1009.176] (-1013.183) (-1009.899) (-1008.377) * (-1009.592) (-1007.522) (-1009.205) [-1008.454] -- 0:00:11 816000 -- [-1008.515] (-1011.769) (-1011.705) (-1008.221) * (-1009.986) [-1008.034] (-1011.034) (-1010.257) -- 0:00:11 816500 -- (-1007.629) [-1009.141] (-1011.519) (-1008.698) * (-1009.775) (-1008.875) [-1008.295] (-1008.872) -- 0:00:11 817000 -- (-1006.905) [-1009.481] (-1008.209) (-1009.994) * [-1011.088] (-1010.476) (-1008.542) (-1009.506) -- 0:00:11 817500 -- (-1007.883) (-1007.690) (-1010.178) [-1012.317] * (-1008.516) (-1008.379) (-1008.080) [-1009.081] -- 0:00:11 818000 -- [-1008.166] (-1007.869) (-1010.719) (-1012.382) * [-1007.872] (-1007.680) (-1008.461) (-1009.553) -- 0:00:11 818500 -- (-1011.547) (-1008.179) (-1012.019) [-1007.126] * [-1010.287] (-1007.881) (-1007.961) (-1012.993) -- 0:00:11 819000 -- (-1010.801) (-1007.448) (-1008.402) [-1007.787] * (-1006.985) (-1010.273) [-1008.598] (-1009.844) -- 0:00:11 819500 -- (-1014.419) [-1007.413] (-1009.646) (-1009.180) * (-1008.724) [-1015.932] (-1007.794) (-1010.373) -- 0:00:11 820000 -- (-1010.487) (-1008.787) (-1007.408) [-1007.670] * (-1010.367) (-1009.038) [-1008.310] (-1009.238) -- 0:00:11 Average standard deviation of split frequencies: 0.009344 820500 -- (-1009.526) [-1008.653] (-1007.997) (-1010.571) * [-1009.097] (-1009.765) (-1007.835) (-1008.282) -- 0:00:11 821000 -- (-1007.830) [-1008.037] (-1014.248) (-1009.443) * (-1008.715) (-1010.278) (-1010.222) [-1007.126] -- 0:00:11 821500 -- (-1007.450) [-1010.284] (-1012.700) (-1011.037) * (-1010.705) (-1010.409) (-1011.567) [-1010.226] -- 0:00:11 822000 -- (-1008.387) (-1010.236) [-1008.221] (-1010.184) * [-1010.096] (-1011.274) (-1008.860) (-1012.672) -- 0:00:11 822500 -- [-1009.676] (-1010.725) (-1010.148) (-1011.361) * (-1010.520) (-1009.293) (-1011.386) [-1009.515] -- 0:00:11 823000 -- (-1010.036) (-1008.867) (-1008.065) [-1009.039] * [-1007.684] (-1008.468) (-1009.207) (-1008.526) -- 0:00:10 823500 -- (-1008.607) [-1013.508] (-1010.506) (-1010.154) * (-1009.572) (-1008.667) (-1009.888) [-1008.769] -- 0:00:11 824000 -- (-1008.734) (-1011.578) [-1009.592] (-1009.434) * (-1007.602) [-1007.690] (-1009.888) (-1007.400) -- 0:00:11 824500 -- (-1010.358) (-1009.839) (-1007.159) [-1008.567] * (-1008.940) [-1008.590] (-1012.973) (-1011.590) -- 0:00:11 825000 -- (-1011.234) (-1011.769) (-1012.793) [-1008.871] * (-1009.599) (-1011.760) [-1010.451] (-1007.494) -- 0:00:11 Average standard deviation of split frequencies: 0.009550 825500 -- (-1010.202) (-1010.450) [-1009.188] (-1014.317) * (-1009.602) (-1012.216) [-1008.140] (-1008.159) -- 0:00:10 826000 -- (-1010.305) (-1012.589) [-1007.277] (-1012.108) * [-1010.217] (-1008.463) (-1009.056) (-1007.100) -- 0:00:10 826500 -- (-1008.245) [-1007.674] (-1007.163) (-1009.431) * (-1007.840) (-1009.107) (-1010.888) [-1007.169] -- 0:00:10 827000 -- (-1007.404) [-1014.340] (-1009.221) (-1010.186) * (-1008.352) [-1008.636] (-1007.477) (-1006.704) -- 0:00:10 827500 -- (-1009.763) (-1011.025) [-1014.652] (-1009.698) * (-1007.720) [-1009.024] (-1010.646) (-1006.687) -- 0:00:10 828000 -- (-1013.946) (-1009.164) (-1010.618) [-1009.193] * (-1010.073) (-1007.933) [-1010.540] (-1010.575) -- 0:00:10 828500 -- (-1010.186) (-1009.256) (-1007.037) [-1008.942] * [-1008.072] (-1009.532) (-1009.893) (-1008.728) -- 0:00:10 829000 -- (-1008.951) (-1008.158) (-1010.823) [-1008.484] * [-1007.445] (-1008.171) (-1010.455) (-1007.873) -- 0:00:10 829500 -- (-1010.382) [-1008.216] (-1007.594) (-1007.623) * (-1010.211) (-1010.561) (-1009.157) [-1008.041] -- 0:00:10 830000 -- (-1011.018) (-1012.199) [-1007.374] (-1007.742) * (-1010.437) (-1007.413) (-1011.528) [-1007.065] -- 0:00:10 Average standard deviation of split frequencies: 0.009648 830500 -- (-1008.817) (-1011.296) (-1011.081) [-1008.313] * [-1007.944] (-1006.740) (-1007.936) (-1007.111) -- 0:00:10 831000 -- (-1010.896) (-1007.338) [-1008.293] (-1006.991) * (-1007.946) [-1007.471] (-1006.956) (-1007.657) -- 0:00:10 831500 -- (-1010.603) [-1009.312] (-1008.477) (-1009.889) * [-1008.349] (-1009.633) (-1008.156) (-1009.295) -- 0:00:10 832000 -- (-1007.543) (-1010.541) [-1007.246] (-1010.753) * [-1008.692] (-1009.305) (-1006.940) (-1008.692) -- 0:00:10 832500 -- [-1008.184] (-1007.945) (-1007.017) (-1011.627) * [-1010.245] (-1008.325) (-1009.387) (-1011.044) -- 0:00:10 833000 -- (-1007.432) [-1007.632] (-1009.082) (-1010.122) * (-1012.427) (-1007.923) [-1008.950] (-1010.985) -- 0:00:10 833500 -- (-1007.827) (-1006.613) [-1008.454] (-1008.106) * (-1008.449) [-1008.741] (-1009.626) (-1007.504) -- 0:00:10 834000 -- [-1008.031] (-1008.266) (-1009.786) (-1008.393) * (-1011.486) (-1012.116) [-1015.135] (-1008.717) -- 0:00:10 834500 -- [-1008.460] (-1007.913) (-1011.710) (-1009.330) * [-1007.961] (-1008.162) (-1012.063) (-1009.604) -- 0:00:10 835000 -- [-1007.040] (-1007.568) (-1014.272) (-1012.555) * (-1011.908) (-1009.362) [-1012.899] (-1009.074) -- 0:00:10 Average standard deviation of split frequencies: 0.009887 835500 -- (-1008.630) (-1008.977) [-1008.010] (-1011.713) * (-1015.227) (-1007.825) [-1008.648] (-1008.128) -- 0:00:10 836000 -- (-1009.514) (-1006.970) (-1010.034) [-1011.331] * (-1007.335) (-1007.819) (-1007.237) [-1008.773] -- 0:00:10 836500 -- [-1008.899] (-1007.357) (-1010.877) (-1007.222) * (-1007.909) (-1009.219) (-1007.866) [-1007.765] -- 0:00:10 837000 -- [-1008.289] (-1009.316) (-1011.860) (-1009.916) * (-1010.100) [-1006.675] (-1009.766) (-1007.932) -- 0:00:10 837500 -- [-1010.185] (-1009.071) (-1008.426) (-1008.051) * (-1008.954) (-1007.084) (-1010.887) [-1007.252] -- 0:00:10 838000 -- [-1009.025] (-1007.101) (-1009.993) (-1007.116) * [-1007.999] (-1008.028) (-1012.942) (-1007.134) -- 0:00:10 838500 -- (-1010.107) [-1008.726] (-1008.450) (-1006.597) * [-1008.065] (-1010.294) (-1008.026) (-1007.134) -- 0:00:10 839000 -- (-1009.702) [-1007.309] (-1007.091) (-1008.400) * (-1008.001) (-1009.565) (-1008.274) [-1009.931] -- 0:00:09 839500 -- (-1007.463) (-1008.500) [-1007.279] (-1010.894) * (-1006.897) (-1009.238) [-1009.646] (-1008.206) -- 0:00:09 840000 -- (-1006.946) (-1007.839) [-1007.312] (-1007.753) * (-1010.973) (-1008.820) [-1008.556] (-1007.793) -- 0:00:10 Average standard deviation of split frequencies: 0.009421 840500 -- (-1007.118) [-1008.322] (-1008.345) (-1008.715) * [-1009.405] (-1007.612) (-1008.456) (-1007.381) -- 0:00:10 841000 -- (-1008.404) [-1007.881] (-1009.871) (-1013.263) * (-1007.360) [-1007.889] (-1011.430) (-1007.113) -- 0:00:10 841500 -- (-1010.428) (-1010.169) (-1012.869) [-1008.756] * (-1007.187) (-1008.965) (-1009.404) [-1008.804] -- 0:00:09 842000 -- (-1008.930) [-1011.191] (-1009.492) (-1009.721) * (-1012.482) (-1008.070) (-1009.951) [-1010.950] -- 0:00:09 842500 -- [-1007.056] (-1008.854) (-1008.374) (-1008.880) * (-1010.078) (-1007.618) (-1011.067) [-1013.561] -- 0:00:09 843000 -- (-1008.913) (-1011.451) (-1011.593) [-1008.938] * (-1011.715) [-1011.973] (-1014.290) (-1012.441) -- 0:00:09 843500 -- (-1007.260) (-1012.376) (-1007.654) [-1008.184] * (-1012.587) (-1009.068) (-1009.629) [-1007.700] -- 0:00:09 844000 -- (-1009.337) [-1009.349] (-1010.939) (-1010.805) * (-1009.436) (-1010.690) (-1008.666) [-1007.652] -- 0:00:09 844500 -- (-1016.359) (-1007.791) (-1010.331) [-1012.733] * (-1009.089) (-1010.186) [-1008.459] (-1010.077) -- 0:00:09 845000 -- [-1013.301] (-1007.389) (-1008.692) (-1010.611) * (-1015.103) (-1015.080) [-1007.722] (-1015.190) -- 0:00:09 Average standard deviation of split frequencies: 0.010030 845500 -- (-1008.585) (-1008.295) [-1009.609] (-1010.587) * (-1017.914) (-1011.920) [-1009.518] (-1009.462) -- 0:00:09 846000 -- (-1009.400) (-1011.948) (-1009.225) [-1010.129] * (-1011.872) (-1008.549) (-1007.865) [-1009.344] -- 0:00:09 846500 -- [-1009.703] (-1007.858) (-1010.243) (-1008.286) * (-1010.119) (-1008.449) [-1007.317] (-1009.740) -- 0:00:09 847000 -- (-1007.847) (-1007.239) (-1009.677) [-1006.775] * (-1007.343) [-1008.270] (-1008.942) (-1007.803) -- 0:00:09 847500 -- (-1012.344) (-1008.434) (-1013.952) [-1008.197] * (-1008.275) (-1008.054) (-1007.428) [-1012.421] -- 0:00:09 848000 -- [-1007.998] (-1010.926) (-1007.358) (-1008.443) * [-1007.887] (-1009.562) (-1007.360) (-1007.719) -- 0:00:09 848500 -- (-1010.832) (-1009.214) (-1010.010) [-1008.705] * (-1007.995) [-1007.005] (-1008.237) (-1006.558) -- 0:00:09 849000 -- [-1007.693] (-1008.744) (-1009.954) (-1011.483) * [-1008.283] (-1006.998) (-1008.424) (-1007.780) -- 0:00:09 849500 -- (-1009.029) (-1009.845) [-1009.364] (-1009.731) * (-1007.380) [-1007.650] (-1015.795) (-1009.121) -- 0:00:09 850000 -- (-1008.416) (-1009.386) (-1009.260) [-1008.913] * (-1009.264) [-1008.996] (-1007.859) (-1009.126) -- 0:00:09 Average standard deviation of split frequencies: 0.010233 850500 -- (-1012.255) (-1011.063) [-1008.583] (-1008.684) * (-1009.736) (-1009.049) [-1007.453] (-1009.113) -- 0:00:09 851000 -- (-1013.971) (-1010.995) [-1010.726] (-1013.497) * (-1009.350) [-1009.208] (-1007.908) (-1008.258) -- 0:00:09 851500 -- [-1007.228] (-1009.021) (-1010.580) (-1008.883) * (-1008.213) (-1008.704) (-1007.116) [-1009.611] -- 0:00:09 852000 -- [-1008.920] (-1008.495) (-1007.654) (-1007.703) * (-1006.994) [-1008.529] (-1009.902) (-1007.851) -- 0:00:09 852500 -- (-1012.414) (-1007.490) (-1011.675) [-1011.765] * (-1009.192) [-1009.503] (-1008.332) (-1012.703) -- 0:00:09 853000 -- (-1009.252) [-1007.021] (-1011.611) (-1008.455) * [-1011.706] (-1015.414) (-1010.298) (-1011.954) -- 0:00:09 853500 -- (-1008.841) (-1008.019) [-1009.388] (-1008.543) * (-1010.087) (-1012.949) (-1008.747) [-1010.577] -- 0:00:09 854000 -- [-1008.989] (-1009.277) (-1007.543) (-1011.863) * [-1008.701] (-1007.231) (-1008.099) (-1007.031) -- 0:00:09 854500 -- (-1011.772) (-1010.960) (-1007.475) [-1006.993] * (-1013.456) (-1008.743) [-1008.644] (-1010.790) -- 0:00:09 855000 -- (-1008.109) [-1007.379] (-1007.443) (-1009.986) * (-1007.989) (-1008.678) [-1008.947] (-1009.211) -- 0:00:08 Average standard deviation of split frequencies: 0.010133 855500 -- [-1007.259] (-1008.319) (-1007.352) (-1007.501) * (-1012.149) (-1008.212) [-1008.507] (-1009.804) -- 0:00:08 856000 -- [-1007.954] (-1008.152) (-1007.183) (-1011.735) * (-1008.875) (-1008.117) [-1010.612] (-1009.231) -- 0:00:09 856500 -- (-1007.310) (-1010.213) (-1010.783) [-1012.137] * (-1007.664) (-1007.958) [-1007.810] (-1013.254) -- 0:00:09 857000 -- (-1008.567) (-1009.188) (-1007.258) [-1010.095] * (-1009.337) [-1007.498] (-1007.780) (-1012.124) -- 0:00:09 857500 -- [-1010.167] (-1008.809) (-1007.211) (-1008.116) * (-1006.911) (-1008.619) (-1008.732) [-1010.019] -- 0:00:08 858000 -- (-1008.325) [-1007.620] (-1009.601) (-1009.244) * [-1009.731] (-1011.778) (-1010.589) (-1007.331) -- 0:00:08 858500 -- (-1008.439) (-1007.186) (-1007.822) [-1007.585] * (-1010.129) (-1008.914) (-1009.777) [-1010.329] -- 0:00:08 859000 -- [-1008.504] (-1008.516) (-1010.015) (-1011.992) * (-1012.393) (-1012.902) (-1006.701) [-1015.378] -- 0:00:08 859500 -- (-1010.827) (-1013.101) [-1009.286] (-1012.684) * (-1011.738) (-1019.206) [-1009.537] (-1012.634) -- 0:00:08 860000 -- (-1007.346) [-1007.672] (-1010.854) (-1009.045) * (-1017.426) [-1007.975] (-1008.302) (-1008.165) -- 0:00:08 Average standard deviation of split frequencies: 0.009603 860500 -- (-1007.648) (-1007.116) [-1007.827] (-1008.685) * [-1015.898] (-1010.350) (-1007.989) (-1010.475) -- 0:00:08 861000 -- (-1007.152) (-1007.214) (-1008.061) [-1007.174] * [-1011.768] (-1008.721) (-1007.765) (-1009.529) -- 0:00:08 861500 -- (-1008.353) [-1006.648] (-1006.777) (-1007.157) * (-1012.359) (-1012.105) [-1007.698] (-1009.960) -- 0:00:08 862000 -- (-1008.804) (-1007.052) [-1008.548] (-1007.851) * (-1008.133) (-1011.577) [-1009.504] (-1009.421) -- 0:00:08 862500 -- [-1007.228] (-1010.386) (-1007.855) (-1009.550) * (-1010.382) (-1011.068) [-1010.653] (-1007.894) -- 0:00:08 863000 -- [-1009.080] (-1011.131) (-1010.819) (-1008.357) * (-1007.214) [-1007.957] (-1007.697) (-1007.098) -- 0:00:08 863500 -- [-1008.785] (-1013.439) (-1011.353) (-1009.967) * (-1011.718) (-1009.123) (-1017.156) [-1007.208] -- 0:00:08 864000 -- (-1008.523) (-1009.257) [-1008.299] (-1008.355) * [-1010.429] (-1007.966) (-1007.322) (-1007.705) -- 0:00:08 864500 -- (-1010.111) (-1008.041) (-1007.323) [-1008.699] * (-1010.960) (-1009.630) [-1007.521] (-1006.809) -- 0:00:08 865000 -- (-1009.725) (-1008.176) [-1008.238] (-1007.312) * (-1009.175) [-1007.788] (-1011.492) (-1008.072) -- 0:00:08 Average standard deviation of split frequencies: 0.009726 865500 -- (-1010.309) [-1010.139] (-1009.564) (-1010.501) * (-1011.502) [-1007.316] (-1006.934) (-1007.939) -- 0:00:08 866000 -- [-1007.177] (-1008.490) (-1007.849) (-1011.589) * (-1010.829) (-1008.944) (-1007.011) [-1008.788] -- 0:00:08 866500 -- (-1007.996) [-1007.877] (-1008.901) (-1012.368) * [-1009.726] (-1008.374) (-1010.686) (-1009.996) -- 0:00:08 867000 -- (-1006.724) (-1009.914) (-1013.023) [-1008.240] * (-1007.536) (-1011.620) [-1011.714] (-1011.417) -- 0:00:08 867500 -- (-1011.025) [-1010.076] (-1010.149) (-1007.840) * (-1007.005) (-1010.419) [-1009.413] (-1007.786) -- 0:00:08 868000 -- (-1010.246) (-1010.236) (-1008.176) [-1008.481] * (-1010.129) (-1010.369) (-1009.629) [-1007.115] -- 0:00:08 868500 -- (-1011.403) (-1009.843) (-1008.406) [-1007.277] * [-1008.729] (-1009.132) (-1007.506) (-1008.834) -- 0:00:08 869000 -- (-1014.373) [-1010.551] (-1013.080) (-1010.377) * (-1007.785) (-1007.648) [-1009.005] (-1006.802) -- 0:00:08 869500 -- (-1010.450) (-1010.143) (-1009.773) [-1008.470] * (-1008.395) (-1007.252) [-1008.392] (-1008.570) -- 0:00:08 870000 -- (-1008.978) [-1009.713] (-1008.601) (-1007.296) * [-1012.535] (-1009.560) (-1007.928) (-1010.609) -- 0:00:08 Average standard deviation of split frequencies: 0.009890 870500 -- [-1011.210] (-1009.540) (-1012.485) (-1007.580) * (-1007.420) (-1010.025) (-1009.143) [-1007.849] -- 0:00:08 871000 -- [-1011.326] (-1009.095) (-1010.014) (-1011.498) * (-1008.350) [-1008.006] (-1011.103) (-1008.665) -- 0:00:07 871500 -- (-1009.358) [-1009.757] (-1013.245) (-1012.023) * (-1009.345) (-1010.167) (-1009.218) [-1009.869] -- 0:00:07 872000 -- [-1006.541] (-1008.907) (-1008.342) (-1011.734) * (-1007.363) [-1008.405] (-1011.079) (-1007.096) -- 0:00:07 872500 -- (-1011.349) (-1011.443) [-1007.240] (-1009.859) * (-1007.454) [-1008.664] (-1009.230) (-1008.250) -- 0:00:08 873000 -- (-1008.027) [-1009.021] (-1010.349) (-1008.278) * [-1007.630] (-1007.730) (-1009.219) (-1007.235) -- 0:00:08 873500 -- (-1010.856) (-1013.234) (-1012.605) [-1008.199] * (-1008.429) (-1008.563) [-1014.572] (-1008.064) -- 0:00:07 874000 -- (-1012.898) (-1009.748) (-1009.095) [-1009.639] * (-1009.844) (-1008.182) [-1013.364] (-1008.561) -- 0:00:07 874500 -- [-1008.835] (-1007.279) (-1015.335) (-1008.848) * (-1008.066) (-1010.736) (-1018.955) [-1007.988] -- 0:00:07 875000 -- (-1009.046) [-1009.043] (-1014.750) (-1009.838) * [-1008.854] (-1007.016) (-1009.735) (-1009.196) -- 0:00:07 Average standard deviation of split frequencies: 0.009830 875500 -- [-1009.007] (-1007.288) (-1010.577) (-1009.084) * (-1007.940) (-1007.889) (-1009.874) [-1008.184] -- 0:00:07 876000 -- (-1011.470) [-1007.916] (-1009.343) (-1010.456) * (-1009.862) [-1009.523] (-1008.581) (-1015.463) -- 0:00:07 876500 -- (-1009.071) [-1007.000] (-1009.780) (-1007.196) * (-1007.434) [-1009.741] (-1011.617) (-1010.628) -- 0:00:07 877000 -- (-1008.051) (-1011.642) (-1009.358) [-1007.967] * (-1011.371) (-1009.507) [-1007.446] (-1010.371) -- 0:00:07 877500 -- (-1007.537) (-1010.170) (-1008.584) [-1009.015] * (-1010.853) (-1007.604) (-1007.410) [-1007.049] -- 0:00:07 878000 -- (-1006.810) (-1011.849) (-1008.396) [-1008.506] * [-1008.814] (-1011.341) (-1007.701) (-1008.554) -- 0:00:07 878500 -- [-1008.007] (-1010.584) (-1009.527) (-1007.142) * (-1006.939) (-1008.145) (-1009.451) [-1008.709] -- 0:00:07 879000 -- (-1011.888) (-1008.525) [-1010.091] (-1009.985) * [-1008.849] (-1012.080) (-1011.203) (-1009.221) -- 0:00:07 879500 -- (-1008.321) (-1007.209) [-1008.019] (-1009.093) * [-1007.263] (-1008.522) (-1016.646) (-1008.803) -- 0:00:07 880000 -- (-1012.763) [-1011.712] (-1011.042) (-1011.666) * [-1007.787] (-1008.833) (-1012.363) (-1010.204) -- 0:00:07 Average standard deviation of split frequencies: 0.009457 880500 -- (-1015.146) [-1011.854] (-1010.648) (-1009.015) * (-1008.641) (-1008.177) (-1007.269) [-1008.279] -- 0:00:07 881000 -- (-1009.407) (-1006.559) (-1009.245) [-1008.799] * (-1009.485) [-1008.418] (-1007.598) (-1007.141) -- 0:00:07 881500 -- (-1010.671) [-1008.614] (-1010.397) (-1010.431) * (-1009.238) (-1011.317) [-1007.558] (-1010.390) -- 0:00:07 882000 -- (-1011.150) (-1009.327) (-1013.614) [-1008.179] * (-1010.582) (-1011.769) (-1011.473) [-1009.997] -- 0:00:07 882500 -- [-1007.013] (-1007.647) (-1010.353) (-1008.388) * (-1010.128) (-1011.457) [-1009.101] (-1012.941) -- 0:00:07 883000 -- (-1009.474) (-1009.800) (-1009.644) [-1009.159] * [-1009.622] (-1008.668) (-1011.897) (-1013.311) -- 0:00:07 883500 -- (-1008.798) (-1009.040) [-1008.897] (-1012.595) * (-1010.616) (-1009.233) (-1010.356) [-1007.221] -- 0:00:07 884000 -- [-1007.286] (-1007.391) (-1011.548) (-1011.312) * (-1012.265) (-1007.778) (-1008.952) [-1006.940] -- 0:00:07 884500 -- (-1012.364) [-1007.116] (-1008.270) (-1009.078) * (-1016.218) [-1010.990] (-1007.548) (-1009.149) -- 0:00:07 885000 -- (-1018.958) (-1007.438) [-1007.776] (-1011.243) * (-1007.570) (-1007.637) [-1007.691] (-1007.912) -- 0:00:07 Average standard deviation of split frequencies: 0.009683 885500 -- (-1018.004) (-1007.027) (-1008.226) [-1008.067] * (-1011.030) (-1007.091) [-1009.832] (-1009.342) -- 0:00:07 886000 -- [-1010.076] (-1011.799) (-1012.570) (-1008.580) * [-1013.605] (-1007.990) (-1007.111) (-1011.148) -- 0:00:07 886500 -- [-1008.220] (-1007.797) (-1010.158) (-1010.293) * (-1009.382) (-1008.348) (-1008.985) [-1010.579] -- 0:00:07 887000 -- (-1011.489) [-1009.387] (-1009.673) (-1008.739) * [-1007.060] (-1008.199) (-1009.018) (-1012.255) -- 0:00:07 887500 -- (-1007.702) (-1011.379) [-1009.522] (-1013.335) * [-1010.026] (-1008.757) (-1008.134) (-1010.112) -- 0:00:06 888000 -- (-1010.248) [-1008.902] (-1007.627) (-1020.117) * (-1007.279) (-1010.319) [-1008.039] (-1013.664) -- 0:00:06 888500 -- (-1008.650) (-1008.268) (-1008.079) [-1008.867] * (-1009.021) (-1010.844) [-1007.004] (-1007.997) -- 0:00:06 889000 -- (-1010.271) [-1009.320] (-1009.444) (-1009.849) * [-1009.900] (-1008.523) (-1011.475) (-1010.996) -- 0:00:06 889500 -- (-1010.948) (-1007.075) (-1006.935) [-1007.253] * (-1009.228) [-1007.619] (-1008.347) (-1009.294) -- 0:00:06 890000 -- (-1008.315) (-1007.055) [-1009.560] (-1007.374) * (-1008.810) (-1009.554) (-1007.587) [-1007.290] -- 0:00:06 Average standard deviation of split frequencies: 0.009668 890500 -- (-1007.118) (-1007.907) [-1010.384] (-1006.668) * (-1007.688) (-1010.929) (-1010.458) [-1007.038] -- 0:00:06 891000 -- [-1007.057] (-1008.226) (-1012.936) (-1009.230) * (-1007.601) (-1007.463) (-1010.007) [-1008.842] -- 0:00:06 891500 -- (-1008.066) (-1012.516) [-1007.092] (-1012.695) * (-1012.341) (-1008.676) [-1008.157] (-1008.174) -- 0:00:06 892000 -- (-1009.083) (-1009.620) [-1007.136] (-1013.765) * [-1008.117] (-1008.450) (-1010.261) (-1011.848) -- 0:00:06 892500 -- (-1007.511) (-1008.607) [-1010.177] (-1007.886) * (-1010.103) [-1008.378] (-1013.006) (-1007.985) -- 0:00:06 893000 -- (-1007.996) [-1008.786] (-1008.315) (-1008.992) * (-1009.697) (-1011.751) [-1010.487] (-1009.559) -- 0:00:06 893500 -- (-1006.703) [-1008.668] (-1009.250) (-1008.206) * (-1008.570) [-1008.095] (-1007.428) (-1009.853) -- 0:00:06 894000 -- (-1007.569) (-1009.627) (-1015.797) [-1006.475] * [-1007.277] (-1006.921) (-1008.754) (-1008.385) -- 0:00:06 894500 -- (-1010.659) (-1009.405) (-1012.547) [-1008.881] * (-1010.763) (-1008.524) [-1008.557] (-1011.945) -- 0:00:06 895000 -- [-1009.988] (-1008.644) (-1007.681) (-1009.158) * [-1009.183] (-1008.932) (-1008.775) (-1008.947) -- 0:00:06 Average standard deviation of split frequencies: 0.009435 895500 -- [-1009.065] (-1009.377) (-1010.594) (-1008.979) * [-1008.387] (-1007.646) (-1007.314) (-1010.123) -- 0:00:06 896000 -- [-1009.189] (-1009.256) (-1008.281) (-1008.444) * (-1013.118) (-1010.170) [-1009.916] (-1014.344) -- 0:00:06 896500 -- (-1006.817) (-1008.913) (-1009.051) [-1008.686] * (-1010.137) (-1011.015) [-1007.025] (-1009.040) -- 0:00:06 897000 -- (-1009.153) (-1008.546) (-1010.314) [-1007.509] * (-1009.708) (-1012.249) [-1008.717] (-1011.164) -- 0:00:06 897500 -- (-1011.659) (-1009.607) [-1010.433] (-1007.969) * [-1007.008] (-1009.266) (-1009.048) (-1009.198) -- 0:00:06 898000 -- (-1008.832) (-1010.918) [-1009.517] (-1011.245) * (-1009.323) (-1009.893) (-1007.999) [-1007.421] -- 0:00:06 898500 -- [-1009.037] (-1008.090) (-1011.457) (-1013.655) * (-1010.327) (-1010.027) (-1008.953) [-1007.601] -- 0:00:06 899000 -- [-1010.490] (-1007.981) (-1007.680) (-1009.405) * (-1012.458) (-1007.778) (-1008.552) [-1007.138] -- 0:00:06 899500 -- (-1010.046) [-1008.454] (-1007.649) (-1009.467) * [-1008.615] (-1009.012) (-1007.371) (-1007.321) -- 0:00:06 900000 -- (-1011.170) [-1011.654] (-1007.987) (-1008.041) * (-1009.087) (-1007.270) [-1011.813] (-1007.796) -- 0:00:06 Average standard deviation of split frequencies: 0.009247 900500 -- (-1007.250) (-1007.269) [-1009.413] (-1007.907) * (-1011.885) (-1007.210) [-1010.914] (-1007.023) -- 0:00:06 901000 -- [-1006.953] (-1008.336) (-1009.261) (-1008.550) * (-1012.201) (-1008.805) [-1010.862] (-1008.847) -- 0:00:06 901500 -- (-1008.822) (-1007.738) (-1009.987) [-1009.432] * [-1006.971] (-1011.343) (-1010.491) (-1010.014) -- 0:00:06 902000 -- (-1009.265) (-1006.978) [-1008.660] (-1010.171) * [-1010.040] (-1010.538) (-1011.132) (-1008.816) -- 0:00:06 902500 -- (-1009.992) [-1006.763] (-1007.787) (-1010.508) * [-1009.609] (-1008.532) (-1009.738) (-1007.556) -- 0:00:06 903000 -- (-1007.599) (-1007.926) [-1008.482] (-1007.513) * (-1011.421) (-1009.526) (-1008.081) [-1007.438] -- 0:00:06 903500 -- (-1008.085) (-1007.131) (-1007.222) [-1009.285] * (-1011.273) (-1008.053) (-1007.663) [-1009.760] -- 0:00:05 904000 -- (-1007.601) (-1007.212) (-1007.368) [-1008.338] * (-1007.754) [-1008.864] (-1008.473) (-1008.106) -- 0:00:05 904500 -- (-1008.057) [-1007.481] (-1007.920) (-1009.045) * (-1010.787) (-1007.858) (-1007.880) [-1008.004] -- 0:00:05 905000 -- (-1007.379) (-1007.137) [-1007.856] (-1008.010) * (-1011.978) (-1009.646) [-1010.181] (-1009.708) -- 0:00:05 Average standard deviation of split frequencies: 0.009262 905500 -- (-1006.792) (-1010.167) (-1009.920) [-1008.123] * (-1008.494) (-1008.534) (-1010.446) [-1016.927] -- 0:00:05 906000 -- (-1006.947) [-1011.023] (-1007.372) (-1012.085) * (-1007.967) (-1008.345) [-1007.962] (-1013.383) -- 0:00:05 906500 -- (-1012.700) (-1010.663) (-1006.983) [-1009.901] * (-1007.949) (-1011.515) [-1010.913] (-1010.347) -- 0:00:05 907000 -- [-1009.057] (-1010.150) (-1007.256) (-1007.994) * (-1007.454) (-1006.800) (-1007.246) [-1007.283] -- 0:00:05 907500 -- (-1012.081) (-1008.797) (-1010.205) [-1010.814] * (-1007.729) [-1008.390] (-1007.154) (-1008.996) -- 0:00:05 908000 -- (-1009.522) (-1008.381) (-1014.819) [-1008.909] * (-1007.360) (-1009.451) (-1009.002) [-1009.526] -- 0:00:05 908500 -- (-1006.980) (-1007.927) (-1006.966) [-1007.889] * (-1007.319) [-1007.469] (-1009.025) (-1009.575) -- 0:00:05 909000 -- (-1015.892) (-1016.749) [-1008.197] (-1009.485) * (-1007.434) [-1011.518] (-1015.030) (-1008.565) -- 0:00:05 909500 -- (-1009.297) (-1008.439) (-1007.947) [-1007.974] * [-1009.801] (-1007.045) (-1010.084) (-1007.359) -- 0:00:05 910000 -- (-1007.604) (-1010.533) (-1007.612) [-1010.021] * (-1008.075) (-1006.818) [-1006.935] (-1007.424) -- 0:00:05 Average standard deviation of split frequencies: 0.009559 910500 -- (-1007.333) (-1007.700) [-1008.583] (-1009.162) * (-1009.160) [-1007.050] (-1008.555) (-1010.885) -- 0:00:05 911000 -- (-1007.191) (-1009.666) [-1012.466] (-1008.402) * (-1013.346) [-1006.695] (-1007.892) (-1010.835) -- 0:00:05 911500 -- (-1011.462) [-1009.524] (-1008.692) (-1008.469) * (-1012.129) (-1010.988) [-1007.177] (-1008.443) -- 0:00:05 912000 -- (-1008.277) [-1011.111] (-1008.430) (-1008.025) * (-1011.015) (-1010.349) (-1007.591) [-1008.011] -- 0:00:05 912500 -- (-1010.177) [-1010.689] (-1011.841) (-1012.646) * (-1013.602) (-1007.211) (-1007.303) [-1008.503] -- 0:00:05 913000 -- [-1009.585] (-1007.379) (-1010.100) (-1009.832) * [-1012.842] (-1007.937) (-1012.935) (-1009.253) -- 0:00:05 913500 -- [-1008.953] (-1008.183) (-1008.246) (-1011.229) * (-1014.093) [-1006.995] (-1009.276) (-1007.621) -- 0:00:05 914000 -- (-1007.462) [-1010.137] (-1011.853) (-1009.217) * (-1008.158) [-1008.243] (-1007.402) (-1008.297) -- 0:00:05 914500 -- [-1007.575] (-1009.740) (-1007.432) (-1010.910) * [-1007.801] (-1007.813) (-1007.531) (-1007.261) -- 0:00:05 915000 -- (-1007.509) [-1007.946] (-1012.310) (-1008.315) * (-1011.689) (-1011.924) [-1009.808] (-1007.584) -- 0:00:05 Average standard deviation of split frequencies: 0.009847 915500 -- [-1007.578] (-1008.787) (-1007.791) (-1009.999) * [-1009.480] (-1008.980) (-1008.819) (-1012.991) -- 0:00:05 916000 -- [-1008.219] (-1009.453) (-1009.207) (-1007.482) * (-1007.615) [-1009.140] (-1013.636) (-1008.362) -- 0:00:05 916500 -- (-1008.515) [-1010.461] (-1012.055) (-1007.604) * [-1007.525] (-1008.350) (-1009.281) (-1008.945) -- 0:00:05 917000 -- (-1009.530) (-1010.692) [-1009.956] (-1008.795) * [-1010.987] (-1008.772) (-1007.842) (-1011.487) -- 0:00:05 917500 -- (-1008.307) [-1007.257] (-1010.212) (-1012.404) * (-1010.575) (-1010.825) (-1012.983) [-1012.872] -- 0:00:05 918000 -- (-1007.298) [-1010.419] (-1009.769) (-1016.293) * (-1009.604) (-1006.944) (-1011.389) [-1008.344] -- 0:00:05 918500 -- [-1009.996] (-1008.547) (-1009.332) (-1015.017) * (-1009.042) (-1007.078) (-1008.143) [-1008.056] -- 0:00:05 919000 -- (-1013.264) (-1009.807) [-1008.045] (-1014.599) * (-1008.781) (-1007.578) (-1008.931) [-1008.603] -- 0:00:05 919500 -- [-1007.642] (-1009.394) (-1008.160) (-1010.974) * [-1015.649] (-1010.478) (-1007.416) (-1010.456) -- 0:00:04 920000 -- [-1008.831] (-1007.817) (-1009.201) (-1008.564) * (-1008.422) (-1006.816) (-1009.755) [-1008.402] -- 0:00:04 Average standard deviation of split frequencies: 0.009490 920500 -- (-1008.136) (-1008.728) (-1008.344) [-1009.885] * (-1009.528) (-1008.418) (-1008.218) [-1009.046] -- 0:00:04 921000 -- (-1011.847) (-1011.989) [-1008.696] (-1013.089) * (-1008.372) [-1010.471] (-1007.341) (-1010.130) -- 0:00:04 921500 -- (-1010.108) (-1009.843) [-1006.879] (-1009.557) * (-1008.986) (-1009.652) (-1007.981) [-1010.451] -- 0:00:04 922000 -- [-1008.914] (-1009.114) (-1012.458) (-1015.145) * (-1007.037) (-1010.270) (-1008.336) [-1007.051] -- 0:00:04 922500 -- (-1007.846) [-1008.366] (-1009.374) (-1009.606) * [-1008.388] (-1009.074) (-1008.748) (-1010.013) -- 0:00:04 923000 -- [-1007.794] (-1007.412) (-1009.824) (-1013.513) * [-1007.043] (-1011.198) (-1007.258) (-1011.456) -- 0:00:04 923500 -- (-1008.753) (-1008.439) (-1011.643) [-1007.802] * [-1007.881] (-1010.846) (-1006.835) (-1013.400) -- 0:00:04 924000 -- (-1006.821) (-1012.489) [-1008.336] (-1009.630) * (-1010.927) (-1012.880) [-1008.657] (-1010.577) -- 0:00:04 924500 -- [-1007.008] (-1013.387) (-1008.518) (-1009.893) * (-1010.749) [-1007.004] (-1018.464) (-1010.101) -- 0:00:04 925000 -- (-1010.228) [-1008.405] (-1007.812) (-1009.478) * (-1007.801) (-1008.011) [-1008.130] (-1010.315) -- 0:00:04 Average standard deviation of split frequencies: 0.009163 925500 -- (-1008.465) [-1007.917] (-1007.952) (-1008.968) * (-1008.323) (-1008.080) (-1008.617) [-1007.135] -- 0:00:04 926000 -- (-1009.501) (-1009.317) [-1011.445] (-1009.074) * (-1008.510) [-1008.266] (-1007.954) (-1011.459) -- 0:00:04 926500 -- (-1009.295) [-1011.761] (-1008.159) (-1008.730) * (-1008.878) [-1009.034] (-1010.369) (-1008.399) -- 0:00:04 927000 -- (-1009.363) (-1008.771) [-1008.150] (-1008.937) * [-1009.164] (-1010.005) (-1009.355) (-1007.138) -- 0:00:04 927500 -- (-1008.188) (-1008.855) [-1009.069] (-1008.945) * (-1007.330) [-1011.492] (-1007.224) (-1007.738) -- 0:00:04 928000 -- (-1008.500) (-1008.017) [-1010.150] (-1015.257) * (-1008.550) (-1010.754) [-1009.492] (-1007.754) -- 0:00:04 928500 -- (-1008.047) (-1009.538) [-1008.017] (-1015.531) * [-1009.362] (-1011.399) (-1009.537) (-1007.508) -- 0:00:04 929000 -- (-1007.226) (-1008.687) [-1007.564] (-1008.690) * (-1009.566) (-1007.836) [-1010.004] (-1007.856) -- 0:00:04 929500 -- (-1007.590) [-1008.578] (-1010.235) (-1010.601) * (-1007.944) (-1010.600) [-1008.223] (-1008.594) -- 0:00:04 930000 -- (-1013.309) [-1008.839] (-1009.063) (-1008.350) * (-1009.176) (-1010.038) [-1008.812] (-1008.953) -- 0:00:04 Average standard deviation of split frequencies: 0.009421 930500 -- (-1008.276) (-1009.421) (-1009.165) [-1008.623] * (-1010.046) (-1007.327) [-1008.163] (-1007.818) -- 0:00:04 931000 -- [-1007.183] (-1007.600) (-1009.184) (-1008.987) * (-1008.389) (-1009.271) (-1008.081) [-1007.625] -- 0:00:04 931500 -- (-1011.962) [-1009.248] (-1008.535) (-1008.239) * (-1007.276) (-1009.663) [-1006.533] (-1011.551) -- 0:00:04 932000 -- (-1009.020) [-1009.076] (-1011.585) (-1009.175) * (-1010.277) [-1008.968] (-1012.523) (-1010.737) -- 0:00:04 932500 -- (-1011.492) [-1007.935] (-1008.285) (-1008.266) * (-1010.695) (-1010.079) [-1008.101] (-1008.070) -- 0:00:04 933000 -- (-1008.356) [-1007.189] (-1008.011) (-1008.834) * (-1007.393) (-1010.463) [-1007.534] (-1008.057) -- 0:00:04 933500 -- (-1008.725) [-1008.439] (-1011.023) (-1008.249) * [-1008.428] (-1007.773) (-1008.657) (-1013.741) -- 0:00:04 934000 -- (-1008.690) (-1010.316) [-1008.584] (-1007.773) * [-1011.714] (-1011.141) (-1007.924) (-1009.596) -- 0:00:04 934500 -- (-1014.080) (-1008.110) (-1006.766) [-1007.992] * (-1011.471) (-1009.074) (-1009.366) [-1008.532] -- 0:00:04 935000 -- (-1010.802) [-1006.819] (-1012.728) (-1007.911) * (-1009.215) (-1007.713) (-1012.168) [-1010.101] -- 0:00:04 Average standard deviation of split frequencies: 0.009233 935500 -- (-1009.605) [-1006.676] (-1011.041) (-1010.461) * (-1011.063) [-1008.265] (-1012.251) (-1009.523) -- 0:00:03 936000 -- (-1007.482) (-1011.316) [-1009.705] (-1008.068) * [-1007.649] (-1010.370) (-1007.915) (-1008.641) -- 0:00:03 936500 -- (-1007.673) [-1013.604] (-1009.626) (-1009.201) * (-1010.686) (-1007.562) [-1007.030] (-1010.237) -- 0:00:03 937000 -- [-1008.398] (-1008.446) (-1008.451) (-1007.340) * (-1012.855) (-1011.721) (-1008.555) [-1009.269] -- 0:00:03 937500 -- (-1007.063) (-1008.214) [-1007.807] (-1008.654) * [-1008.204] (-1009.132) (-1007.805) (-1009.810) -- 0:00:03 938000 -- (-1008.521) (-1007.948) [-1008.391] (-1008.714) * (-1007.724) [-1009.031] (-1009.772) (-1008.115) -- 0:00:03 938500 -- [-1008.870] (-1007.664) (-1008.749) (-1007.625) * (-1007.922) [-1009.041] (-1011.815) (-1008.250) -- 0:00:03 939000 -- (-1007.887) (-1007.562) (-1006.961) [-1009.434] * [-1008.735] (-1007.274) (-1007.785) (-1006.606) -- 0:00:03 939500 -- (-1011.132) [-1007.521] (-1010.882) (-1008.156) * (-1010.104) (-1007.543) (-1006.882) [-1007.806] -- 0:00:03 940000 -- (-1007.573) (-1011.212) [-1011.481] (-1008.350) * (-1011.114) (-1007.480) (-1010.470) [-1008.389] -- 0:00:03 Average standard deviation of split frequencies: 0.009321 940500 -- (-1008.210) (-1007.585) (-1009.579) [-1007.357] * (-1011.937) [-1007.141] (-1011.960) (-1007.654) -- 0:00:03 941000 -- (-1009.876) [-1007.428] (-1009.146) (-1009.585) * (-1007.687) [-1006.522] (-1008.466) (-1007.883) -- 0:00:03 941500 -- [-1008.480] (-1010.234) (-1009.205) (-1008.124) * (-1009.340) [-1007.017] (-1007.407) (-1007.805) -- 0:00:03 942000 -- (-1008.801) (-1011.910) (-1010.517) [-1008.258] * (-1010.234) (-1009.949) [-1008.357] (-1007.968) -- 0:00:03 942500 -- (-1009.807) [-1009.780] (-1011.462) (-1007.883) * (-1015.689) (-1008.037) (-1011.645) [-1011.389] -- 0:00:03 943000 -- [-1008.078] (-1007.626) (-1010.989) (-1008.103) * [-1008.684] (-1009.082) (-1010.014) (-1008.736) -- 0:00:03 943500 -- (-1008.930) [-1008.447] (-1012.939) (-1007.492) * [-1008.300] (-1008.750) (-1009.356) (-1007.773) -- 0:00:03 944000 -- (-1007.025) (-1008.824) (-1007.335) [-1008.203] * [-1009.219] (-1008.337) (-1013.009) (-1010.778) -- 0:00:03 944500 -- (-1009.995) [-1009.864] (-1007.307) (-1010.422) * (-1010.083) [-1010.491] (-1007.350) (-1011.456) -- 0:00:03 945000 -- [-1009.124] (-1009.006) (-1008.138) (-1009.576) * [-1007.294] (-1008.330) (-1007.338) (-1011.113) -- 0:00:03 Average standard deviation of split frequencies: 0.009103 945500 -- [-1008.013] (-1008.040) (-1009.766) (-1007.654) * [-1008.109] (-1009.310) (-1008.199) (-1008.079) -- 0:00:03 946000 -- (-1007.792) [-1008.563] (-1008.698) (-1008.284) * (-1010.509) (-1011.362) [-1008.813] (-1009.719) -- 0:00:03 946500 -- (-1007.512) [-1007.738] (-1009.893) (-1008.053) * (-1012.418) (-1008.137) [-1010.401] (-1008.453) -- 0:00:03 947000 -- (-1012.738) (-1009.792) (-1012.632) [-1008.513] * (-1009.247) [-1008.803] (-1007.440) (-1008.926) -- 0:00:03 947500 -- (-1010.127) (-1008.340) (-1008.583) [-1008.054] * (-1009.206) (-1008.679) (-1008.608) [-1008.061] -- 0:00:03 948000 -- (-1007.424) (-1011.354) [-1012.498] (-1008.571) * (-1008.203) (-1011.691) [-1008.167] (-1007.631) -- 0:00:03 948500 -- (-1010.794) (-1006.731) [-1010.337] (-1010.962) * (-1008.028) (-1009.519) [-1008.443] (-1008.343) -- 0:00:03 949000 -- (-1010.833) [-1007.307] (-1007.887) (-1009.237) * (-1008.971) (-1011.107) [-1007.782] (-1006.622) -- 0:00:03 949500 -- (-1009.276) (-1011.525) [-1009.359] (-1011.747) * (-1011.058) (-1008.659) (-1007.012) [-1007.444] -- 0:00:03 950000 -- [-1008.216] (-1009.444) (-1013.434) (-1010.060) * (-1008.171) [-1008.612] (-1007.001) (-1007.262) -- 0:00:03 Average standard deviation of split frequencies: 0.008992 950500 -- (-1008.014) (-1010.746) (-1009.659) [-1009.045] * (-1011.594) (-1011.490) [-1007.082] (-1011.400) -- 0:00:03 951000 -- (-1009.024) [-1009.199] (-1009.256) (-1016.942) * (-1010.167) (-1011.536) (-1009.739) [-1009.691] -- 0:00:03 951500 -- (-1009.428) (-1008.826) [-1008.876] (-1010.860) * [-1009.659] (-1008.665) (-1010.160) (-1008.093) -- 0:00:03 952000 -- (-1011.520) (-1011.421) [-1010.581] (-1007.949) * [-1009.764] (-1010.401) (-1008.118) (-1010.429) -- 0:00:02 952500 -- (-1011.228) (-1009.345) [-1010.249] (-1007.912) * [-1007.632] (-1008.562) (-1009.007) (-1007.740) -- 0:00:02 953000 -- [-1011.342] (-1008.005) (-1008.170) (-1012.661) * (-1008.401) (-1007.958) (-1009.532) [-1007.689] -- 0:00:02 953500 -- (-1010.201) (-1007.105) (-1008.816) [-1007.456] * [-1011.746] (-1012.106) (-1010.358) (-1008.557) -- 0:00:02 954000 -- (-1010.820) (-1008.205) (-1008.027) [-1008.932] * (-1011.800) (-1012.459) (-1011.170) [-1008.074] -- 0:00:02 954500 -- (-1009.762) (-1008.696) [-1008.470] (-1007.271) * [-1008.833] (-1007.952) (-1009.731) (-1008.177) -- 0:00:02 955000 -- (-1009.864) [-1009.709] (-1010.534) (-1007.229) * [-1009.885] (-1011.262) (-1009.006) (-1011.248) -- 0:00:02 Average standard deviation of split frequencies: 0.008974 955500 -- (-1007.705) [-1007.630] (-1011.317) (-1012.317) * (-1009.657) (-1010.037) (-1007.808) [-1008.731] -- 0:00:02 956000 -- (-1008.931) (-1008.420) (-1009.418) [-1008.862] * [-1010.195] (-1009.833) (-1013.053) (-1007.963) -- 0:00:02 956500 -- [-1011.504] (-1008.056) (-1008.449) (-1009.506) * (-1011.160) [-1008.943] (-1012.606) (-1006.887) -- 0:00:02 957000 -- (-1007.758) [-1006.657] (-1006.998) (-1009.389) * [-1007.860] (-1007.925) (-1011.320) (-1007.218) -- 0:00:02 957500 -- [-1008.286] (-1007.500) (-1007.797) (-1013.116) * [-1010.876] (-1008.080) (-1012.574) (-1007.216) -- 0:00:02 958000 -- [-1007.609] (-1009.705) (-1009.785) (-1009.140) * (-1008.463) (-1007.452) [-1007.230] (-1009.503) -- 0:00:02 958500 -- [-1007.609] (-1010.266) (-1007.941) (-1007.304) * (-1007.595) (-1011.576) (-1008.297) [-1011.063] -- 0:00:02 959000 -- [-1011.096] (-1007.970) (-1006.953) (-1008.369) * (-1007.606) [-1010.990] (-1007.835) (-1010.716) -- 0:00:02 959500 -- (-1009.251) (-1008.238) (-1007.239) [-1013.739] * (-1009.362) (-1008.825) [-1007.627] (-1009.575) -- 0:00:02 960000 -- (-1008.548) [-1009.359] (-1006.814) (-1008.103) * (-1009.939) (-1011.772) (-1012.815) [-1008.172] -- 0:00:02 Average standard deviation of split frequencies: 0.008767 960500 -- [-1007.040] (-1009.714) (-1009.872) (-1009.567) * (-1008.124) (-1007.968) [-1007.871] (-1007.729) -- 0:00:02 961000 -- (-1007.996) (-1007.799) (-1013.689) [-1008.977] * [-1008.280] (-1007.263) (-1011.853) (-1009.709) -- 0:00:02 961500 -- (-1010.453) (-1008.191) [-1008.654] (-1009.609) * (-1011.270) (-1007.263) (-1014.146) [-1007.217] -- 0:00:02 962000 -- [-1008.656] (-1007.910) (-1010.386) (-1007.471) * (-1011.863) (-1008.672) (-1009.335) [-1007.106] -- 0:00:02 962500 -- [-1009.609] (-1008.716) (-1012.602) (-1006.802) * (-1014.341) [-1008.700] (-1009.701) (-1008.022) -- 0:00:02 963000 -- (-1007.252) [-1009.797] (-1011.739) (-1008.090) * [-1008.694] (-1008.872) (-1007.890) (-1008.220) -- 0:00:02 963500 -- [-1008.980] (-1009.305) (-1008.908) (-1007.410) * (-1009.229) [-1010.331] (-1008.659) (-1009.342) -- 0:00:02 964000 -- (-1008.985) (-1008.275) [-1009.214] (-1007.124) * [-1009.902] (-1007.322) (-1009.697) (-1008.915) -- 0:00:02 964500 -- (-1007.223) [-1007.057] (-1010.152) (-1007.342) * [-1008.383] (-1007.550) (-1009.273) (-1008.414) -- 0:00:02 965000 -- (-1014.923) (-1014.454) [-1008.083] (-1007.214) * (-1008.403) [-1007.191] (-1007.695) (-1007.304) -- 0:00:02 Average standard deviation of split frequencies: 0.008589 965500 -- [-1010.768] (-1007.325) (-1009.310) (-1009.959) * (-1008.034) (-1007.649) (-1009.304) [-1007.623] -- 0:00:02 966000 -- (-1008.638) (-1007.127) (-1012.058) [-1012.434] * (-1009.096) (-1008.313) (-1008.765) [-1008.649] -- 0:00:02 966500 -- (-1011.936) [-1007.074] (-1007.236) (-1015.908) * [-1008.486] (-1010.385) (-1008.639) (-1008.651) -- 0:00:02 967000 -- (-1008.392) [-1007.863] (-1007.623) (-1009.333) * [-1009.925] (-1009.629) (-1008.065) (-1010.973) -- 0:00:02 967500 -- (-1012.421) [-1006.773] (-1008.233) (-1009.267) * [-1008.150] (-1008.234) (-1007.365) (-1011.683) -- 0:00:02 968000 -- (-1011.814) [-1007.113] (-1008.808) (-1010.378) * [-1009.554] (-1007.760) (-1013.284) (-1008.482) -- 0:00:01 968500 -- (-1012.256) (-1008.352) [-1006.812] (-1007.778) * (-1006.820) (-1009.076) (-1010.059) [-1008.326] -- 0:00:01 969000 -- (-1007.765) (-1009.876) (-1011.844) [-1008.038] * [-1008.258] (-1009.851) (-1011.121) (-1008.034) -- 0:00:01 969500 -- (-1010.390) (-1010.903) (-1010.642) [-1008.571] * (-1007.963) (-1010.299) (-1013.790) [-1010.752] -- 0:00:01 970000 -- [-1012.835] (-1011.847) (-1009.408) (-1011.537) * [-1007.088] (-1008.934) (-1011.619) (-1007.673) -- 0:00:01 Average standard deviation of split frequencies: 0.008677 970500 -- (-1007.143) (-1007.727) [-1007.293] (-1009.989) * (-1007.606) (-1010.150) (-1007.765) [-1007.600] -- 0:00:01 971000 -- (-1008.896) (-1008.116) [-1007.087] (-1011.713) * [-1008.335] (-1010.088) (-1016.543) (-1011.972) -- 0:00:01 971500 -- [-1009.034] (-1010.852) (-1009.756) (-1007.763) * [-1009.496] (-1013.250) (-1013.065) (-1012.099) -- 0:00:01 972000 -- (-1007.117) (-1010.394) (-1012.004) [-1014.262] * (-1009.829) [-1009.534] (-1011.119) (-1008.653) -- 0:00:01 972500 -- [-1012.264] (-1009.826) (-1010.039) (-1010.043) * (-1009.621) (-1008.883) [-1010.836] (-1007.409) -- 0:00:01 973000 -- [-1008.056] (-1008.481) (-1010.883) (-1007.335) * (-1009.794) [-1010.159] (-1007.397) (-1007.901) -- 0:00:01 973500 -- (-1008.599) [-1007.067] (-1009.155) (-1008.608) * (-1010.475) (-1015.472) (-1008.113) [-1010.336] -- 0:00:01 974000 -- (-1009.522) (-1010.407) (-1011.049) [-1012.598] * (-1009.245) [-1010.008] (-1012.893) (-1007.376) -- 0:00:01 974500 -- (-1007.487) (-1007.931) (-1012.685) [-1011.208] * (-1008.489) (-1009.391) (-1009.712) [-1009.067] -- 0:00:01 975000 -- (-1006.580) [-1007.447] (-1006.899) (-1009.233) * (-1008.281) [-1008.012] (-1013.816) (-1007.887) -- 0:00:01 Average standard deviation of split frequencies: 0.008726 975500 -- (-1008.316) (-1010.268) (-1009.179) [-1010.421] * (-1007.960) [-1009.484] (-1017.445) (-1009.347) -- 0:00:01 976000 -- (-1011.777) (-1016.606) (-1006.988) [-1010.053] * (-1008.265) [-1007.138] (-1017.720) (-1009.073) -- 0:00:01 976500 -- (-1007.277) (-1009.263) [-1008.450] (-1014.570) * (-1007.765) [-1009.295] (-1011.142) (-1008.238) -- 0:00:01 977000 -- [-1007.413] (-1007.898) (-1008.822) (-1009.035) * (-1007.159) [-1007.602] (-1011.723) (-1009.084) -- 0:00:01 977500 -- (-1008.637) (-1008.827) [-1006.854] (-1008.512) * (-1008.528) (-1007.418) [-1008.647] (-1008.160) -- 0:00:01 978000 -- (-1012.289) (-1012.895) [-1007.191] (-1007.730) * (-1006.873) (-1009.134) [-1007.700] (-1007.907) -- 0:00:01 978500 -- (-1007.532) (-1010.276) [-1009.671] (-1008.078) * (-1009.289) [-1008.149] (-1011.846) (-1009.554) -- 0:00:01 979000 -- [-1010.909] (-1007.732) (-1009.543) (-1010.278) * (-1010.966) (-1009.030) (-1007.638) [-1008.895] -- 0:00:01 979500 -- (-1008.844) (-1009.596) (-1008.346) [-1006.533] * [-1008.764] (-1009.514) (-1007.485) (-1008.913) -- 0:00:01 980000 -- (-1014.612) [-1007.513] (-1010.754) (-1010.695) * (-1009.151) [-1010.099] (-1009.299) (-1009.231) -- 0:00:01 Average standard deviation of split frequencies: 0.008588 980500 -- (-1009.247) [-1007.229] (-1007.875) (-1007.510) * (-1006.682) [-1009.330] (-1010.414) (-1009.262) -- 0:00:01 981000 -- (-1010.337) [-1007.250] (-1007.493) (-1014.853) * (-1007.310) (-1007.675) (-1007.391) [-1008.469] -- 0:00:01 981500 -- (-1012.573) (-1008.301) [-1009.746] (-1010.859) * [-1009.731] (-1008.049) (-1012.581) (-1009.030) -- 0:00:01 982000 -- (-1012.242) (-1009.256) [-1012.485] (-1009.531) * (-1010.468) (-1007.709) (-1014.481) [-1007.339] -- 0:00:01 982500 -- [-1007.170] (-1008.808) (-1012.490) (-1015.463) * (-1011.040) (-1013.853) (-1010.539) [-1007.341] -- 0:00:01 983000 -- [-1007.852] (-1009.029) (-1010.596) (-1008.903) * (-1008.547) (-1012.251) (-1016.661) [-1006.528] -- 0:00:01 983500 -- [-1006.930] (-1007.924) (-1008.768) (-1007.903) * (-1007.595) [-1009.608] (-1015.664) (-1007.888) -- 0:00:01 984000 -- [-1006.869] (-1009.267) (-1007.250) (-1009.666) * (-1009.299) (-1009.546) [-1009.836] (-1008.075) -- 0:00:01 984500 -- (-1008.175) (-1007.928) [-1007.330] (-1008.892) * (-1009.084) (-1010.555) (-1009.960) [-1009.030] -- 0:00:00 985000 -- [-1009.492] (-1008.444) (-1009.460) (-1008.499) * (-1007.913) (-1009.273) (-1007.948) [-1008.355] -- 0:00:00 Average standard deviation of split frequencies: 0.008829 985500 -- (-1009.311) [-1008.415] (-1007.604) (-1010.283) * (-1009.232) [-1007.154] (-1007.952) (-1008.314) -- 0:00:00 986000 -- (-1009.843) [-1008.444] (-1010.265) (-1007.733) * (-1009.196) (-1007.424) [-1008.214] (-1008.272) -- 0:00:00 986500 -- (-1011.950) (-1009.797) (-1011.616) [-1008.077] * (-1008.215) (-1010.167) [-1007.122] (-1007.472) -- 0:00:00 987000 -- (-1008.575) (-1008.940) (-1011.759) [-1007.443] * (-1007.796) (-1009.376) [-1008.809] (-1008.182) -- 0:00:00 987500 -- [-1009.765] (-1008.980) (-1007.096) (-1006.929) * (-1009.675) [-1007.118] (-1011.126) (-1008.618) -- 0:00:00 988000 -- (-1009.683) (-1012.022) (-1007.097) [-1007.139] * [-1007.535] (-1008.405) (-1008.851) (-1010.750) -- 0:00:00 988500 -- [-1006.577] (-1008.482) (-1009.436) (-1010.695) * [-1007.669] (-1010.459) (-1008.646) (-1010.286) -- 0:00:00 989000 -- (-1008.515) (-1008.679) [-1008.187] (-1010.390) * [-1008.892] (-1008.094) (-1008.589) (-1009.564) -- 0:00:00 989500 -- (-1007.296) (-1008.206) (-1007.552) [-1012.756] * [-1008.519] (-1009.755) (-1009.168) (-1010.878) -- 0:00:00 990000 -- (-1007.749) (-1010.328) (-1009.901) [-1007.146] * [-1009.623] (-1009.912) (-1006.935) (-1013.196) -- 0:00:00 Average standard deviation of split frequencies: 0.009073 990500 -- (-1009.029) (-1012.542) [-1007.068] (-1007.653) * [-1007.630] (-1009.039) (-1007.696) (-1011.978) -- 0:00:00 991000 -- [-1007.618] (-1008.973) (-1007.529) (-1008.505) * [-1007.350] (-1011.306) (-1009.809) (-1012.195) -- 0:00:00 991500 -- (-1006.853) (-1007.155) (-1008.854) [-1006.969] * (-1008.749) (-1011.229) (-1009.153) [-1007.783] -- 0:00:00 992000 -- (-1013.662) [-1007.249] (-1012.443) (-1008.097) * (-1008.253) (-1007.965) [-1008.288] (-1011.391) -- 0:00:00 992500 -- [-1011.344] (-1008.407) (-1011.830) (-1006.823) * (-1013.564) (-1007.895) (-1008.131) [-1007.818] -- 0:00:00 993000 -- [-1011.748] (-1011.745) (-1010.049) (-1007.138) * (-1007.864) (-1010.067) [-1007.482] (-1008.061) -- 0:00:00 993500 -- (-1008.547) [-1008.843] (-1009.493) (-1008.959) * (-1010.676) (-1007.205) [-1008.488] (-1007.857) -- 0:00:00 994000 -- (-1008.122) (-1009.845) [-1008.808] (-1015.416) * (-1010.485) [-1009.668] (-1009.464) (-1007.342) -- 0:00:00 994500 -- (-1008.494) (-1009.521) [-1010.586] (-1009.931) * (-1007.173) (-1012.891) [-1010.226] (-1007.944) -- 0:00:00 995000 -- [-1007.286] (-1009.566) (-1007.474) (-1010.126) * [-1007.913] (-1012.134) (-1009.256) (-1008.325) -- 0:00:00 Average standard deviation of split frequencies: 0.008803 995500 -- (-1007.339) [-1011.649] (-1007.556) (-1008.981) * (-1010.288) [-1009.834] (-1008.455) (-1012.449) -- 0:00:00 996000 -- (-1008.869) (-1010.695) [-1007.652] (-1009.027) * (-1013.037) [-1015.068] (-1009.605) (-1008.846) -- 0:00:00 996500 -- (-1007.667) [-1008.960] (-1008.061) (-1009.137) * (-1009.350) [-1007.857] (-1009.044) (-1011.800) -- 0:00:00 997000 -- (-1008.909) (-1007.496) (-1007.980) [-1007.833] * (-1009.723) (-1007.105) (-1007.185) [-1007.774] -- 0:00:00 997500 -- (-1011.679) (-1008.357) [-1010.164] (-1011.152) * (-1009.001) [-1008.432] (-1007.605) (-1007.094) -- 0:00:00 998000 -- (-1011.759) (-1011.766) (-1012.149) [-1009.082] * [-1009.247] (-1007.356) (-1006.885) (-1008.583) -- 0:00:00 998500 -- (-1012.460) (-1006.856) [-1008.581] (-1008.708) * (-1009.561) (-1009.300) (-1006.746) [-1008.338] -- 0:00:00 999000 -- (-1011.708) (-1006.815) [-1009.132] (-1008.877) * (-1013.525) (-1009.753) [-1007.360] (-1009.849) -- 0:00:00 999500 -- (-1013.699) (-1009.268) [-1008.334] (-1007.802) * [-1010.516] (-1008.456) (-1007.256) (-1011.158) -- 0:00:00 1000000 -- (-1011.446) (-1007.582) (-1008.878) [-1010.045] * [-1009.978] (-1008.159) (-1008.059) (-1008.747) -- 0:00:00 Average standard deviation of split frequencies: 0.009359 Analysis completed in 1 mins 3 seconds Analysis used 61.58 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1006.44 Likelihood of best state for "cold" chain of run 2 was -1006.44 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.6 % ( 62 %) Dirichlet(Revmat{all}) 99.9 % ( 99 %) Slider(Revmat{all}) 27.1 % ( 21 %) Dirichlet(Pi{all}) 29.4 % ( 24 %) Slider(Pi{all}) 78.6 % ( 46 %) Multiplier(Alpha{1,2}) 78.2 % ( 59 %) Multiplier(Alpha{3}) 20.7 % ( 19 %) Slider(Pinvar{all}) 98.7 % ( 96 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 23 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.4 % ( 33 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.2 % ( 66 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 27.5 % ( 29 %) Dirichlet(Pi{all}) 30.1 % ( 22 %) Slider(Pi{all}) 78.8 % ( 60 %) Multiplier(Alpha{1,2}) 77.9 % ( 52 %) Multiplier(Alpha{3}) 20.4 % ( 32 %) Slider(Pinvar{all}) 98.6 % ( 96 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 87 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 28 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.7 % ( 18 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166806 0.82 0.67 3 | 166635 166607 0.84 4 | 166470 166610 166872 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166081 0.82 0.67 3 | 166679 166884 0.84 4 | 166432 166679 167245 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1008.21 | 2 1 21 2 1 | | 1 2 2 | | 2 111 2 | | 112 1 1 1 1 22 1 1 | | 2 1 2 2 1 11 1 1 1 121 2| | 2 1 22 2 2 2 * 1 2 2 1 121 1 2 1| |2 2 2 12 2 2 2** | | 1 1 * 2 1 21 2 1 2 | | 11 2 11 2 2 12 11 | | 1 2 1 1 1 * 1 2 1 2 2 | |12 2 * 2 | | 2 2 2 1 2 | | | | 1 2 1 | | 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1009.86 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1008.14 -1011.08 2 -1008.15 -1011.64 -------------------------------------- TOTAL -1008.15 -1011.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000 r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003 r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000 r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008 r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000 r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010 r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002 pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001 pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001 pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000 pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000 alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000 alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000 pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .****. 8 -- ...*.* 9 -- ..*.*. 10 -- .*..*. 11 -- ..*..* 12 -- .*...* 13 -- .**.** 14 -- ....** 15 -- .*.*.. 16 -- ...**. 17 -- .***.* 18 -- ..**.. 19 -- .*.*** 20 -- .**... 21 -- ..**** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 468 0.155896 0.010364 0.148568 0.163225 2 8 464 0.154564 0.000000 0.154564 0.154564 2 9 462 0.153897 0.014133 0.143904 0.163891 2 10 448 0.149234 0.021670 0.133911 0.164557 2 11 436 0.145237 0.015075 0.134577 0.155896 2 12 432 0.143904 0.015075 0.133245 0.154564 2 13 431 0.143571 0.002355 0.141905 0.145237 2 14 427 0.142239 0.006124 0.137908 0.146569 2 15 423 0.140906 0.004240 0.137908 0.143904 2 16 423 0.140906 0.002355 0.139241 0.142572 2 17 415 0.138241 0.008951 0.131912 0.144570 2 18 413 0.137575 0.010835 0.129913 0.145237 2 19 410 0.136576 0.005653 0.132578 0.140573 2 20 410 0.136576 0.016959 0.124584 0.148568 2 21 386 0.128581 0.006595 0.123917 0.133245 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097549 0.009487 0.000045 0.300630 0.068225 1.000 2 length{all}[2] 0.098930 0.010254 0.000004 0.305026 0.067871 1.000 2 length{all}[3] 0.098104 0.010017 0.000032 0.294744 0.066033 1.000 2 length{all}[4] 0.100910 0.010623 0.000086 0.306993 0.068170 1.000 2 length{all}[5] 0.100304 0.009838 0.000036 0.309264 0.068138 1.000 2 length{all}[6] 0.101686 0.010543 0.000071 0.308534 0.070414 1.000 2 length{all}[7] 0.097394 0.008597 0.000286 0.281807 0.070656 1.002 2 length{all}[8] 0.103212 0.011865 0.000144 0.320664 0.063165 1.000 2 length{all}[9] 0.088549 0.008695 0.000059 0.283778 0.061761 1.003 2 length{all}[10] 0.103926 0.010937 0.000721 0.344535 0.069789 0.998 2 length{all}[11] 0.100597 0.011735 0.000600 0.292328 0.070720 1.005 2 length{all}[12] 0.107074 0.012664 0.000269 0.322183 0.074984 0.998 2 length{all}[13] 0.100873 0.011262 0.000080 0.313296 0.068023 0.999 2 length{all}[14] 0.100156 0.011401 0.000360 0.309129 0.070983 1.001 2 length{all}[15] 0.104215 0.010384 0.001497 0.306389 0.073102 0.998 2 length{all}[16] 0.091368 0.008774 0.000338 0.282669 0.057493 0.998 2 length{all}[17] 0.096033 0.009393 0.000200 0.265243 0.068987 0.999 2 length{all}[18] 0.097267 0.009693 0.000311 0.301371 0.067064 1.005 2 length{all}[19] 0.090093 0.009613 0.000927 0.289612 0.057334 0.998 2 length{all}[20] 0.099672 0.009728 0.000002 0.297403 0.067012 0.998 2 length{all}[21] 0.102579 0.010989 0.000370 0.312010 0.071625 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.009359 Maximum standard deviation of split frequencies = 0.021670 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.005 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /---------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |---------------------------------------------------------------------- C4 (4) | |---------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 741 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 51 patterns at 247 / 247 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 51 patterns at 247 / 247 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 49776 bytes for conP 4488 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.089666 0.080017 0.101542 0.100546 0.026829 0.068319 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1071.308972 Iterating by ming2 Initial: fx= 1071.308972 x= 0.08967 0.08002 0.10154 0.10055 0.02683 0.06832 0.30000 1.30000 1 h-m-p 0.0000 0.0001 591.3795 ++ 1032.749861 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0045 79.6168 ++ 1030.518502 m 0.0045 24 | 2/8 3 h-m-p 0.0018 0.0092 28.7183 ------------.. | 2/8 4 h-m-p 0.0000 0.0001 538.7676 ++ 987.651514 m 0.0001 56 | 3/8 5 h-m-p 0.0012 0.0182 60.3637 -----------.. | 3/8 6 h-m-p 0.0000 0.0001 485.4299 ++ 973.506411 m 0.0001 87 | 4/8 7 h-m-p 0.0005 0.0222 49.6612 -----------.. | 4/8 8 h-m-p 0.0000 0.0000 421.3535 ++ 964.718243 m 0.0000 118 | 5/8 9 h-m-p 0.0005 0.0292 37.6989 -----------.. | 5/8 10 h-m-p 0.0000 0.0001 344.6558 ++ 958.084704 m 0.0001 149 | 6/8 11 h-m-p 0.0005 0.0433 25.4467 -----------.. | 6/8 12 h-m-p 0.0000 0.0000 244.4910 ++ 957.779970 m 0.0000 180 | 7/8 13 h-m-p 1.6000 8.0000 0.0000 C 957.779970 0 1.6000 191 | 7/8 14 h-m-p 0.0160 8.0000 0.0000 +Y 957.779970 0 0.0640 204 Out.. lnL = -957.779970 205 lfun, 205 eigenQcodon, 1230 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.014816 0.048499 0.107652 0.026552 0.014078 0.090203 0.000100 0.551063 0.214986 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.329429 np = 9 lnL0 = -1026.615281 Iterating by ming2 Initial: fx= 1026.615281 x= 0.01482 0.04850 0.10765 0.02655 0.01408 0.09020 0.00011 0.55106 0.21499 1 h-m-p 0.0000 0.0000 531.9234 ++ 1026.143236 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 332.8226 +++ 1006.991847 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0000 173.1982 ++ 1006.366967 m 0.0000 39 | 3/9 4 h-m-p 0.0000 0.0003 133.9985 +++ 999.301887 m 0.0003 52 | 4/9 5 h-m-p 0.0000 0.0002 209.9735 ++ 989.168629 m 0.0002 64 | 5/9 6 h-m-p 0.0000 0.0001 1580.1884 ++ 969.464140 m 0.0001 76 | 6/9 7 h-m-p 0.0000 0.0002 494.9600 ++ 957.779769 m 0.0002 88 | 7/9 8 h-m-p 1.6000 8.0000 0.0002 ++ 957.779768 m 8.0000 100 | 7/9 9 h-m-p 0.0001 0.0221 10.6060 ++++ 957.779669 m 0.0221 116 | 8/9 10 h-m-p 0.1264 0.6322 0.1817 ++ 957.779453 m 0.6322 128 | 9/9 11 h-m-p 0.0160 8.0000 0.0000 C 957.779453 0 0.0160 141 Out.. lnL = -957.779453 142 lfun, 426 eigenQcodon, 1704 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.102703 0.015812 0.067286 0.083532 0.025924 0.078525 0.000100 1.008683 0.371649 0.125248 1.224430 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 12.114352 np = 11 lnL0 = -1039.601247 Iterating by ming2 Initial: fx= 1039.601247 x= 0.10270 0.01581 0.06729 0.08353 0.02592 0.07852 0.00011 1.00868 0.37165 0.12525 1.22443 1 h-m-p 0.0000 0.0000 487.8335 ++ 1039.343392 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0002 358.5258 +++ 1018.737144 m 0.0002 31 | 2/11 3 h-m-p 0.0000 0.0001 159.1225 ++ 1010.299060 m 0.0001 45 | 3/11 4 h-m-p 0.0002 0.0008 87.9311 ++ 999.210173 m 0.0008 59 | 4/11 5 h-m-p 0.0002 0.0011 141.2818 ++ 985.462510 m 0.0011 73 | 5/11 6 h-m-p 0.0001 0.0003 570.1439 ++ 981.223563 m 0.0003 87 | 6/11 7 h-m-p 0.0000 0.0002 376.0659 ++ 972.601059 m 0.0002 101 | 7/11 8 h-m-p 0.0001 0.0011 909.4326 ++ 957.779792 m 0.0011 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0001 ++ 957.779792 m 8.0000 129 | 8/11 10 h-m-p 0.0160 8.0000 0.7295 +++++ 957.779457 m 8.0000 149 | 8/11 11 h-m-p 1.6000 8.0000 0.1577 ++ 957.779454 m 8.0000 166 | 8/11 12 h-m-p 1.6000 8.0000 0.5881 ++ 957.779453 m 8.0000 183 | 8/11 13 h-m-p 1.6000 8.0000 0.0661 ++ 957.779453 m 8.0000 200 | 8/11 14 h-m-p 0.5775 8.0000 0.9151 ++ 957.779453 m 8.0000 217 | 8/11 15 h-m-p 1.6000 8.0000 0.0000 C 957.779453 0 1.6000 234 | 8/11 16 h-m-p 0.0160 8.0000 0.0000 Y 957.779453 0 0.0160 251 Out.. lnL = -957.779453 252 lfun, 1008 eigenQcodon, 4536 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -957.848389 S = -957.780854 -0.026205 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:02 did 20 / 51 patterns 0:02 did 30 / 51 patterns 0:02 did 40 / 51 patterns 0:02 did 50 / 51 patterns 0:02 did 51 / 51 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.040406 0.090083 0.047355 0.107557 0.085044 0.093697 0.000100 0.223387 1.335580 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 27.252902 np = 9 lnL0 = -1054.517061 Iterating by ming2 Initial: fx= 1054.517061 x= 0.04041 0.09008 0.04736 0.10756 0.08504 0.09370 0.00011 0.22339 1.33558 1 h-m-p 0.0000 0.0000 462.9890 ++ 1054.440580 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0050 54.5210 +++++ 1045.276816 m 0.0050 29 | 2/9 3 h-m-p 0.0001 0.0006 910.2748 ++ 1008.605699 m 0.0006 41 | 3/9 4 h-m-p 0.0008 0.0038 193.0642 ++ 980.138645 m 0.0038 53 | 4/9 5 h-m-p 0.0000 0.0001 233.5969 ++ 979.700350 m 0.0001 65 | 5/9 6 h-m-p 0.0000 0.0001 743.7401 ++ 977.363966 m 0.0001 77 | 6/9 7 h-m-p 0.0004 0.0019 74.6797 ++ 975.010833 m 0.0019 89 | 7/9 8 h-m-p 0.0570 8.0000 2.2853 --------------.. | 7/9 9 h-m-p 0.0000 0.0004 200.1196 +++ 957.779453 m 0.0004 126 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 Y 957.779453 0 1.6000 138 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 Y 957.779453 0 0.0160 151 Out.. lnL = -957.779453 152 lfun, 1672 eigenQcodon, 9120 P(t) Time used: 0:04 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.028212 0.028386 0.020697 0.050443 0.086356 0.018100 0.000100 0.900000 0.890410 1.898365 1.101388 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 15.803406 np = 11 lnL0 = -1010.807554 Iterating by ming2 Initial: fx= 1010.807554 x= 0.02821 0.02839 0.02070 0.05044 0.08636 0.01810 0.00011 0.90000 0.89041 1.89837 1.10139 1 h-m-p 0.0000 0.0000 536.2466 ++ 1010.277886 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0048 83.1419 +++++ 980.907721 m 0.0048 33 | 2/11 3 h-m-p 0.0000 0.0000 7816.9360 ++ 978.004486 m 0.0000 47 | 3/11 4 h-m-p 0.0002 0.0011 81.7986 ++ 975.788286 m 0.0011 61 | 4/11 5 h-m-p 0.0000 0.0000 70901.4968 ++ 975.760047 m 0.0000 75 | 5/11 6 h-m-p 0.0000 0.0001 1337.9059 ++ 972.419266 m 0.0001 89 | 6/11 7 h-m-p 0.0000 0.0000 44082.9014 ++ 966.259169 m 0.0000 103 | 7/11 8 h-m-p 0.0018 0.0091 51.2802 ++ 961.645660 m 0.0091 117 | 8/11 9 h-m-p 0.0073 0.0365 38.5506 -------------.. | 8/11 10 h-m-p 0.0000 0.0001 238.4151 ++ 957.779867 m 0.0001 156 | 9/11 11 h-m-p 1.0109 8.0000 0.0000 ++ 957.779867 m 8.0000 170 | 9/11 12 h-m-p 0.1167 8.0000 0.0003 ++++ 957.779867 m 8.0000 188 | 9/11 13 h-m-p 0.0160 8.0000 0.8771 +++++ 957.779861 m 8.0000 207 | 9/11 14 h-m-p 1.6000 8.0000 0.4202 ++ 957.779861 m 8.0000 223 | 9/11 15 h-m-p 0.8536 8.0000 3.9379 ++ 957.779860 m 8.0000 239 | 9/11 16 h-m-p 0.3099 1.5495 49.6482 ++ 957.779860 m 1.5495 253 | 10/11 17 h-m-p 0.2240 1.1198 26.2708 ------------Y 957.779860 0 0.0000 279 | 10/11 18 h-m-p 0.0160 8.0000 0.0000 ------------N 957.779860 0 0.0000 305 Out.. lnL = -957.779860 306 lfun, 3672 eigenQcodon, 20196 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -957.806690 S = -957.776399 -0.013357 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:10 did 20 / 51 patterns 0:10 did 30 / 51 patterns 0:10 did 40 / 51 patterns 0:10 did 50 / 51 patterns 0:10 did 51 / 51 patterns 0:10 Time used: 0:10 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247 NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE NC_002677_1_NP_302142_1_1014_ML1661 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE ************************************************** NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD NC_002677_1_NP_302142_1_1014_ML1661 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD ************************************************** NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD NC_002677_1_NP_302142_1_1014_ML1661 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD ************************************************** NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD NC_002677_1_NP_302142_1_1014_ML1661 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD ************************************************** NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR NC_002677_1_NP_302142_1_1014_ML1661 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR ***********************************************
>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NC_002677_1_NP_302142_1_1014_ML1661 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC >NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NC_002677_1_NP_302142_1_1014_ML1661 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR >NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
#NEXUS [ID: 5597914545] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 NC_002677_1_NP_302142_1_1014_ML1661 NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 ; end; begin trees; translate 1 NC_011896_1_WP_010908463_1_1764_MLBR_RS08360, 2 NC_002677_1_NP_302142_1_1014_ML1661, 3 NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965, 4 NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680, 5 NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125, 6 NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382); end;
Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1008.14 -1011.08 2 -1008.15 -1011.64 -------------------------------------- TOTAL -1008.15 -1011.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892381 0.087024 0.371087 1.471015 0.860947 1501.00 1501.00 1.000 r(A<->C){all} 0.163758 0.020486 0.000031 0.465426 0.126773 96.55 173.30 1.003 r(A<->G){all} 0.178784 0.021452 0.000076 0.464542 0.138304 112.74 156.09 1.000 r(A<->T){all} 0.162939 0.020033 0.000145 0.454404 0.121681 101.46 134.51 1.008 r(C<->G){all} 0.167028 0.021859 0.000027 0.475773 0.123339 165.38 230.79 1.000 r(C<->T){all} 0.162384 0.020731 0.000032 0.458304 0.120614 168.66 183.90 1.010 r(G<->T){all} 0.165106 0.019836 0.000354 0.448175 0.125252 205.47 288.83 1.002 pi(A){all} 0.215222 0.000228 0.188876 0.246685 0.214923 1330.99 1404.25 1.001 pi(C){all} 0.276730 0.000257 0.244619 0.308080 0.276846 1266.75 1271.80 1.001 pi(G){all} 0.331115 0.000284 0.298472 0.365147 0.330630 1314.64 1368.83 1.000 pi(T){all} 0.176934 0.000205 0.150090 0.205454 0.176736 1225.67 1293.22 1.000 alpha{1,2} 0.428076 0.237010 0.000141 1.428335 0.265852 1169.45 1307.66 1.000 alpha{3} 0.448949 0.222485 0.000130 1.402621 0.297875 1362.39 1374.85 1.000 pinvar{all} 0.997929 0.000006 0.993294 0.999999 0.998719 1246.19 1331.24 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1661/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 247 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1 TTC 1 1 1 1 1 1 | TCC 5 5 5 5 5 5 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2 Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 6 6 6 6 6 6 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5 CTC 7 7 7 7 7 7 | CCC 0 0 0 0 0 0 | CAC 5 5 5 5 5 5 | CGC 9 9 9 9 9 9 CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2 CTG 6 6 6 6 6 6 | CCG 2 2 2 2 2 2 | CAG 6 6 6 6 6 6 | CGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2 ATC 11 11 11 11 11 11 | ACC 3 3 3 3 3 3 | AAC 8 8 8 8 8 8 | AGC 2 2 2 2 2 2 ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 13 13 13 13 13 13 | Gly GGT 4 4 4 4 4 4 GTC 3 3 3 3 3 3 | GCC 12 12 12 12 12 12 | GAC 9 9 9 9 9 9 | GGC 8 8 8 8 8 8 GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 9 9 9 9 9 9 | GGA 0 0 0 0 0 0 GTG 9 9 9 9 9 9 | GCG 16 16 16 16 16 16 | GAG 18 18 18 18 18 18 | GGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 #2: NC_002677_1_NP_302142_1_1014_ML1661 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 #3: NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 #4: NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 #5: NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 #6: NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350 position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6 TTC 6 | TCC 30 | TAC 24 | TGC 12 Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 36 | TCG 30 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 30 CTC 42 | CCC 0 | CAC 30 | CGC 54 CTA 0 | CCA 0 | Gln Q CAA 24 | CGA 12 CTG 36 | CCG 12 | CAG 36 | CGG 42 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 12 ATC 66 | ACC 18 | AAC 48 | AGC 12 ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 36 | ACG 24 | AAG 24 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 30 | Asp D GAT 78 | Gly G GGT 24 GTC 18 | GCC 72 | GAC 54 | GGC 48 GTA 18 | GCA 6 | Glu E GAA 54 | GGA 0 GTG 54 | GCG 96 | GAG 108 | GGG 6 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12146 C:0.22672 A:0.19433 G:0.45749 position 2: T:0.23887 C:0.24291 A:0.34413 G:0.17409 position 3: T:0.17004 C:0.36032 A:0.10526 G:0.36437 Average T:0.17679 C:0.27665 A:0.21457 G:0.33198 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -957.779970 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.101388 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 1.10139 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 7..2 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 7..3 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 7..4 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 7..5 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 7..6 0.000 610.9 130.1 1.1014 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -957.779453 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -957.779453 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 2.931380 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 2.93138 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -957.779453 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.513254 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.51325 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 610.9 130.1 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:04 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -957.779860 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 69.581196 99.000000 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 69.58120 q = 99.00000 (p1 = 0.00001) w = 1.00000 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.35113 0.37348 0.38697 0.39782 0.40763 0.41718 0.42708 0.43815 0.45206 0.47554 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 7..2 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 7..3 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 7..4 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 7..5 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 7..6 0.000 610.9 130.1 0.4127 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Time used: 0:10
Model 1: NearlyNeutral -957.779453 Model 2: PositiveSelection -957.779453 Model 0: one-ratio -957.77997 Model 7: beta -957.779453 Model 8: beta&w>1 -957.77986 Model 0 vs 1 0.001034000000117885 Model 2 vs 1 0.0 Model 8 vs 7 8.139999999912106E-4