--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:15:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1661/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1008.14         -1011.08
2      -1008.15         -1011.64
--------------------------------------
TOTAL    -1008.15         -1011.40
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892381    0.087024    0.371087    1.471015    0.860947   1501.00   1501.00    1.000
r(A<->C){all}   0.163758    0.020486    0.000031    0.465426    0.126773     96.55    173.30    1.003
r(A<->G){all}   0.178784    0.021452    0.000076    0.464542    0.138304    112.74    156.09    1.000
r(A<->T){all}   0.162939    0.020033    0.000145    0.454404    0.121681    101.46    134.51    1.008
r(C<->G){all}   0.167028    0.021859    0.000027    0.475773    0.123339    165.38    230.79    1.000
r(C<->T){all}   0.162384    0.020731    0.000032    0.458304    0.120614    168.66    183.90    1.010
r(G<->T){all}   0.165106    0.019836    0.000354    0.448175    0.125252    205.47    288.83    1.002
pi(A){all}      0.215222    0.000228    0.188876    0.246685    0.214923   1330.99   1404.25    1.001
pi(C){all}      0.276730    0.000257    0.244619    0.308080    0.276846   1266.75   1271.80    1.001
pi(G){all}      0.331115    0.000284    0.298472    0.365147    0.330630   1314.64   1368.83    1.000
pi(T){all}      0.176934    0.000205    0.150090    0.205454    0.176736   1225.67   1293.22    1.000
alpha{1,2}      0.428076    0.237010    0.000141    1.428335    0.265852   1169.45   1307.66    1.000
alpha{3}        0.448949    0.222485    0.000130    1.402621    0.297875   1362.39   1374.85    1.000
pinvar{all}     0.997929    0.000006    0.993294    0.999999    0.998719   1246.19   1331.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-957.779453
Model 2: PositiveSelection	-957.779453
Model 0: one-ratio	-957.77997
Model 7: beta	-957.779453
Model 8: beta&w>1	-957.77986


Model 0 vs 1	0.001034000000117885

Model 2 vs 1	0.0

Model 8 vs 7	8.139999999912106E-4
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247 

C1              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
                **************************************************

C1              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
                **************************************************

C1              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
                **************************************************

C1              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
                **************************************************

C1              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7410]--->[7410]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
                **************************************************

C1              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
                **************************************************

C1              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
                **************************************************

C1              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
                **************************************************

C1              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C2              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C3              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C4              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C5              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C6              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
                **************************************************

C1              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C2              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C3              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C4              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C5              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C6              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
                **************************************************

C1              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C2              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C3              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C4              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C5              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C6              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
                **************************************************

C1              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C2              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C3              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C4              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C5              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C6              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
                **************************************************

C1              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C2              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C3              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C4              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C5              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C6              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
                **************************************************

C1              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C2              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C3              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C4              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C5              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C6              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
                **************************************************

C1              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C2              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C3              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C4              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C5              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C6              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
                **************************************************

C1              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C2              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C3              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C4              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C5              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C6              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
                **************************************************

C1              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C2              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C3              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C4              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C5              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C6              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
                **************************************************

C1              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C2              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C3              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C4              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C5              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C6              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
                **************************************************

C1              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C2              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C3              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C4              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C5              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C6              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
                **************************************************

C1              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C2              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C3              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C4              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C5              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C6              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
                **************************************************

C1              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C2              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C3              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C4              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C5              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C6              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
                **************************************************

C1              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C2              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C3              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C4              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C5              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C6              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
                **************************************************

C1              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C2              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C3              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C4              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C5              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C6              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
                *****************************************



>C1
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C2
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C3
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C4
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C5
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C6
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 741 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857260
      Setting output file names to "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 353694223
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5597914545
      Seed = 1215641637
      Swapseed = 1579857260
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1658.393524 -- -24.965149
         Chain 2 -- -1658.393271 -- -24.965149
         Chain 3 -- -1658.393524 -- -24.965149
         Chain 4 -- -1658.393524 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1658.393524 -- -24.965149
         Chain 2 -- -1658.393524 -- -24.965149
         Chain 3 -- -1658.393524 -- -24.965149
         Chain 4 -- -1658.393429 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1658.394] (-1658.393) (-1658.394) (-1658.394) * [-1658.394] (-1658.394) (-1658.394) (-1658.393) 
        500 -- (-1031.861) (-1017.553) (-1025.933) [-1013.843] * (-1022.038) (-1021.999) [-1017.748] (-1027.858) -- 0:00:00
       1000 -- (-1019.737) [-1016.194] (-1019.724) (-1012.420) * (-1029.613) (-1017.330) [-1013.435] (-1022.888) -- 0:00:00
       1500 -- (-1025.184) (-1022.315) (-1020.040) [-1021.493] * (-1022.802) (-1019.389) [-1016.565] (-1013.781) -- 0:00:00
       2000 -- (-1027.832) (-1018.352) (-1024.480) [-1014.107] * (-1015.329) (-1016.346) [-1014.961] (-1010.985) -- 0:00:00
       2500 -- (-1018.776) (-1019.959) (-1017.666) [-1017.948] * (-1014.853) (-1013.984) (-1017.008) [-1019.922] -- 0:00:00
       3000 -- (-1017.807) (-1025.490) [-1014.280] (-1013.657) * (-1022.261) (-1019.883) (-1016.423) [-1021.552] -- 0:00:00
       3500 -- (-1018.671) (-1013.350) (-1020.242) [-1012.357] * (-1028.295) (-1014.668) (-1021.011) [-1020.194] -- 0:00:00
       4000 -- (-1020.892) [-1012.713] (-1016.832) (-1015.869) * (-1015.899) [-1016.925] (-1020.170) (-1019.248) -- 0:00:00
       4500 -- (-1011.620) [-1018.927] (-1017.010) (-1019.621) * (-1019.297) (-1013.783) (-1016.549) [-1016.172] -- 0:00:00
       5000 -- [-1016.318] (-1022.782) (-1026.994) (-1022.346) * (-1023.831) [-1010.181] (-1027.321) (-1014.945) -- 0:00:00

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-1019.949) (-1021.553) [-1020.528] (-1019.217) * (-1014.935) (-1013.217) [-1020.748] (-1021.085) -- 0:00:00
       6000 -- (-1019.063) (-1017.075) [-1014.233] (-1022.006) * (-1019.914) (-1017.922) (-1018.926) [-1013.429] -- 0:00:00
       6500 -- (-1025.149) (-1012.710) (-1018.378) [-1017.860] * (-1022.149) [-1017.596] (-1020.942) (-1015.168) -- 0:00:00
       7000 -- [-1016.425] (-1022.237) (-1026.932) (-1026.760) * (-1016.963) (-1021.418) (-1019.391) [-1016.441] -- 0:00:00
       7500 -- (-1021.756) (-1020.507) (-1024.448) [-1010.243] * (-1013.651) (-1019.309) (-1024.956) [-1028.414] -- 0:00:00
       8000 -- (-1018.441) (-1017.572) [-1017.059] (-1017.054) * (-1021.656) (-1024.954) [-1014.236] (-1017.150) -- 0:00:00
       8500 -- (-1020.397) [-1020.814] (-1012.471) (-1016.754) * (-1023.180) (-1015.967) [-1016.897] (-1017.890) -- 0:00:00
       9000 -- (-1025.020) (-1016.627) [-1012.223] (-1020.792) * (-1026.815) (-1026.963) [-1013.462] (-1021.280) -- 0:00:00
       9500 -- (-1016.701) (-1024.922) (-1014.247) [-1013.569] * (-1019.400) (-1015.321) (-1016.743) [-1018.525] -- 0:01:44
      10000 -- (-1020.103) (-1020.865) (-1024.254) [-1019.817] * (-1015.924) (-1023.496) (-1013.020) [-1020.605] -- 0:01:39

      Average standard deviation of split frequencies: 0.062608

      10500 -- (-1015.403) (-1018.021) (-1014.188) [-1015.321] * (-1024.615) [-1016.872] (-1018.019) (-1018.565) -- 0:01:34
      11000 -- (-1019.308) (-1019.419) (-1017.915) [-1015.713] * [-1013.412] (-1015.330) (-1023.291) (-1020.454) -- 0:01:29
      11500 -- (-1015.677) (-1015.992) (-1015.457) [-1015.048] * (-1015.943) [-1016.058] (-1024.149) (-1018.433) -- 0:01:25
      12000 -- (-1025.918) (-1024.227) [-1010.495] (-1021.220) * (-1010.667) [-1019.708] (-1026.373) (-1014.577) -- 0:01:22
      12500 -- (-1019.380) (-1020.666) [-1019.156] (-1018.510) * (-1022.868) (-1017.359) [-1023.035] (-1021.873) -- 0:01:19
      13000 -- [-1020.284] (-1031.878) (-1019.499) (-1017.966) * (-1024.703) (-1014.961) (-1021.300) [-1013.739] -- 0:01:15
      13500 -- (-1013.822) (-1013.497) [-1017.896] (-1019.307) * (-1016.322) (-1020.403) (-1019.432) [-1022.382] -- 0:01:13
      14000 -- (-1027.269) (-1014.949) [-1018.670] (-1020.396) * (-1024.602) [-1018.802] (-1015.483) (-1017.588) -- 0:01:10
      14500 -- (-1018.774) [-1014.301] (-1023.402) (-1024.182) * [-1015.710] (-1024.996) (-1018.031) (-1020.127) -- 0:01:07
      15000 -- (-1014.604) [-1017.488] (-1020.045) (-1017.770) * (-1023.144) [-1015.507] (-1017.007) (-1028.564) -- 0:01:05

      Average standard deviation of split frequencies: 0.054274

      15500 -- [-1010.958] (-1024.317) (-1026.460) (-1014.537) * (-1017.261) (-1019.779) (-1015.869) [-1010.046] -- 0:01:03
      16000 -- (-1021.103) (-1015.456) (-1018.549) [-1017.040] * [-1016.505] (-1024.767) (-1012.719) (-1009.743) -- 0:01:01
      16500 -- (-1012.912) (-1014.180) [-1015.243] (-1024.702) * (-1025.080) (-1017.237) (-1017.276) [-1008.671] -- 0:00:59
      17000 -- [-1017.222] (-1013.087) (-1021.754) (-1018.880) * (-1020.544) (-1012.055) (-1021.385) [-1007.714] -- 0:00:57
      17500 -- (-1017.089) (-1021.846) (-1016.802) [-1016.323] * (-1019.105) [-1019.290] (-1030.213) (-1010.170) -- 0:00:56
      18000 -- (-1014.532) (-1018.071) (-1018.617) [-1010.704] * [-1020.211] (-1018.705) (-1019.793) (-1008.401) -- 0:00:54
      18500 -- (-1019.106) (-1017.435) (-1011.775) [-1018.658] * [-1013.868] (-1020.951) (-1027.657) (-1008.385) -- 0:00:53
      19000 -- (-1017.945) (-1019.031) [-1013.193] (-1021.436) * (-1014.480) (-1020.622) (-1023.178) [-1007.840] -- 0:00:51
      19500 -- [-1019.527] (-1017.754) (-1028.765) (-1016.455) * (-1019.604) (-1014.548) (-1012.619) [-1007.981] -- 0:00:50
      20000 -- (-1020.527) (-1015.087) (-1024.939) [-1019.945] * [-1013.947] (-1021.395) (-1008.903) (-1010.173) -- 0:00:49

      Average standard deviation of split frequencies: 0.051702

      20500 -- (-1021.857) [-1016.933] (-1021.689) (-1023.742) * (-1018.680) [-1020.149] (-1007.968) (-1009.291) -- 0:00:47
      21000 -- [-1018.744] (-1025.668) (-1020.450) (-1012.751) * (-1026.848) [-1018.905] (-1007.478) (-1008.307) -- 0:00:46
      21500 -- (-1025.876) [-1021.314] (-1018.060) (-1018.627) * (-1018.364) (-1015.794) [-1007.978] (-1008.741) -- 0:00:45
      22000 -- [-1017.946] (-1022.415) (-1027.012) (-1026.642) * (-1022.658) (-1020.022) (-1012.391) [-1009.357] -- 0:00:44
      22500 -- (-1026.391) (-1015.935) (-1017.011) [-1019.717] * (-1019.089) [-1015.796] (-1008.996) (-1010.553) -- 0:00:43
      23000 -- (-1024.010) [-1016.029] (-1036.604) (-1015.092) * [-1010.772] (-1012.482) (-1007.775) (-1009.276) -- 0:00:42
      23500 -- [-1013.441] (-1021.722) (-1009.163) (-1020.431) * (-1022.763) (-1028.709) [-1013.179] (-1007.053) -- 0:00:41
      24000 -- (-1011.740) [-1018.208] (-1013.471) (-1020.758) * (-1017.957) (-1014.711) (-1009.673) [-1009.398] -- 0:00:40
      24500 -- (-1010.689) [-1013.584] (-1010.198) (-1016.070) * [-1018.323] (-1010.096) (-1007.505) (-1006.965) -- 0:00:39
      25000 -- (-1007.720) [-1019.436] (-1012.522) (-1015.760) * (-1014.766) (-1008.879) (-1008.415) [-1007.321] -- 0:01:18

      Average standard deviation of split frequencies: 0.048624

      25500 -- (-1007.807) [-1018.732] (-1007.989) (-1026.984) * (-1023.115) (-1008.676) (-1009.225) [-1007.675] -- 0:01:16
      26000 -- (-1008.794) [-1017.736] (-1007.661) (-1019.309) * (-1013.203) [-1007.258] (-1008.394) (-1009.794) -- 0:01:14
      26500 -- [-1008.742] (-1024.023) (-1007.084) (-1017.714) * [-1016.403] (-1008.653) (-1013.414) (-1007.889) -- 0:01:13
      27000 -- [-1010.395] (-1014.579) (-1007.237) (-1015.577) * [-1014.643] (-1009.876) (-1009.148) (-1008.221) -- 0:01:12
      27500 -- (-1010.161) [-1014.885] (-1010.075) (-1018.387) * [-1018.831] (-1007.844) (-1008.125) (-1008.018) -- 0:01:10
      28000 -- (-1013.767) (-1014.352) (-1007.977) [-1016.860] * (-1022.134) (-1007.460) [-1008.018] (-1008.303) -- 0:01:09
      28500 -- (-1014.306) (-1017.202) [-1007.923] (-1019.918) * (-1014.168) [-1008.021] (-1008.858) (-1009.343) -- 0:01:08
      29000 -- [-1007.711] (-1017.352) (-1008.924) (-1018.298) * (-1025.199) (-1010.124) (-1011.215) [-1009.822] -- 0:01:06
      29500 -- (-1007.236) [-1020.813] (-1009.014) (-1012.674) * (-1011.414) [-1008.238] (-1008.709) (-1009.030) -- 0:01:05
      30000 -- (-1008.612) [-1018.921] (-1007.880) (-1013.853) * [-1020.252] (-1008.327) (-1008.092) (-1010.489) -- 0:01:04

      Average standard deviation of split frequencies: 0.042456

      30500 -- [-1007.820] (-1018.489) (-1006.895) (-1013.301) * (-1019.785) (-1008.825) [-1007.672] (-1011.919) -- 0:01:03
      31000 -- (-1007.775) (-1014.691) (-1008.654) [-1017.303] * (-1019.908) [-1008.311] (-1007.677) (-1007.668) -- 0:01:02
      31500 -- (-1007.030) (-1021.808) [-1010.122] (-1017.594) * (-1033.510) (-1007.396) (-1009.906) [-1008.116] -- 0:01:01
      32000 -- (-1006.999) (-1016.170) [-1009.283] (-1021.348) * (-1011.710) [-1007.428] (-1008.239) (-1008.242) -- 0:01:00
      32500 -- [-1007.464] (-1019.016) (-1009.671) (-1015.294) * (-1024.891) (-1011.209) (-1008.652) [-1008.291] -- 0:00:59
      33000 -- [-1007.936] (-1019.039) (-1008.592) (-1018.387) * [-1009.279] (-1008.746) (-1008.880) (-1007.366) -- 0:00:58
      33500 -- (-1007.326) (-1015.007) [-1007.789] (-1026.175) * (-1009.125) (-1010.352) [-1008.839] (-1008.013) -- 0:00:57
      34000 -- (-1010.456) (-1018.484) (-1007.983) [-1016.035] * (-1007.602) (-1010.254) (-1007.851) [-1007.538] -- 0:00:56
      34500 -- (-1009.524) (-1014.794) [-1008.978] (-1016.914) * [-1007.005] (-1012.338) (-1008.075) (-1010.755) -- 0:00:55
      35000 -- (-1011.129) (-1012.454) (-1008.471) [-1014.966] * (-1007.057) (-1010.178) [-1007.068] (-1014.092) -- 0:00:55

      Average standard deviation of split frequencies: 0.036166

      35500 -- (-1008.582) (-1014.762) (-1006.842) [-1013.330] * (-1011.612) (-1012.033) (-1010.429) [-1012.498] -- 0:00:54
      36000 -- (-1009.119) (-1020.794) (-1010.190) [-1014.151] * (-1010.479) (-1010.073) (-1008.260) [-1011.444] -- 0:00:53
      36500 -- [-1009.389] (-1016.776) (-1008.112) (-1020.449) * (-1009.109) [-1009.609] (-1009.158) (-1009.507) -- 0:00:52
      37000 -- [-1008.039] (-1016.966) (-1009.420) (-1021.153) * (-1008.092) (-1008.065) [-1013.153] (-1008.441) -- 0:00:52
      37500 -- [-1007.986] (-1017.007) (-1007.278) (-1008.241) * (-1009.320) (-1010.407) (-1008.650) [-1008.165] -- 0:00:51
      38000 -- (-1013.090) (-1031.439) (-1008.838) [-1008.607] * (-1008.512) (-1008.430) (-1009.199) [-1008.309] -- 0:00:50
      38500 -- (-1009.041) (-1020.147) (-1009.293) [-1007.971] * (-1007.759) (-1013.058) (-1008.592) [-1007.892] -- 0:00:49
      39000 -- [-1009.120] (-1013.157) (-1008.294) (-1010.516) * (-1016.217) (-1011.030) (-1009.028) [-1010.607] -- 0:00:49
      39500 -- (-1007.537) (-1020.001) [-1009.410] (-1008.469) * (-1012.653) (-1010.360) (-1016.394) [-1009.112] -- 0:00:48
      40000 -- (-1008.241) (-1015.849) [-1008.393] (-1007.361) * [-1007.682] (-1010.764) (-1013.721) (-1007.852) -- 0:00:48

      Average standard deviation of split frequencies: 0.032335

      40500 -- (-1007.793) (-1017.324) (-1010.521) [-1007.630] * [-1007.057] (-1013.695) (-1015.351) (-1006.821) -- 0:00:47
      41000 -- (-1008.990) (-1018.523) [-1007.520] (-1007.784) * (-1008.561) [-1014.687] (-1010.401) (-1007.487) -- 0:01:10
      41500 -- [-1009.661] (-1018.412) (-1008.192) (-1008.156) * (-1010.960) [-1014.729] (-1007.480) (-1008.281) -- 0:01:09
      42000 -- (-1008.799) (-1013.881) [-1007.278] (-1008.682) * (-1008.297) [-1011.797] (-1007.282) (-1009.304) -- 0:01:08
      42500 -- (-1009.935) (-1019.699) (-1008.059) [-1006.888] * (-1007.936) [-1007.876] (-1008.155) (-1010.213) -- 0:01:07
      43000 -- (-1014.065) (-1015.868) (-1008.334) [-1009.036] * [-1008.023] (-1007.655) (-1008.176) (-1009.568) -- 0:01:06
      43500 -- (-1012.864) (-1014.045) (-1008.727) [-1009.428] * (-1009.412) [-1010.490] (-1007.328) (-1008.204) -- 0:01:05
      44000 -- (-1011.761) (-1018.226) (-1007.558) [-1008.133] * (-1009.858) (-1013.945) [-1008.050] (-1007.627) -- 0:01:05
      44500 -- [-1011.764] (-1028.974) (-1009.912) (-1009.111) * (-1007.921) [-1010.428] (-1007.685) (-1007.070) -- 0:01:04
      45000 -- (-1011.028) (-1017.909) (-1007.306) [-1008.664] * (-1008.277) [-1008.777] (-1008.001) (-1007.629) -- 0:01:03

      Average standard deviation of split frequencies: 0.029768

      45500 -- (-1011.795) (-1013.680) [-1008.325] (-1008.083) * [-1009.430] (-1009.041) (-1009.963) (-1007.539) -- 0:01:02
      46000 -- (-1010.717) (-1020.771) [-1007.567] (-1007.935) * (-1008.118) (-1011.540) (-1010.960) [-1007.622] -- 0:01:02
      46500 -- (-1011.656) (-1017.346) (-1008.902) [-1007.354] * (-1007.903) (-1009.582) (-1009.263) [-1008.416] -- 0:01:01
      47000 -- (-1009.516) (-1017.957) [-1007.244] (-1009.850) * (-1008.426) (-1011.135) (-1007.953) [-1008.870] -- 0:01:00
      47500 -- (-1010.602) (-1020.084) [-1009.138] (-1010.782) * (-1007.913) (-1008.120) (-1009.402) [-1010.933] -- 0:01:00
      48000 -- (-1008.736) (-1012.583) [-1009.490] (-1010.458) * (-1007.915) (-1008.762) [-1010.090] (-1008.674) -- 0:00:59
      48500 -- (-1009.181) (-1017.381) (-1008.061) [-1009.707] * (-1007.981) (-1012.702) (-1008.544) [-1011.904] -- 0:00:58
      49000 -- (-1011.744) (-1024.465) [-1008.165] (-1009.622) * (-1007.340) (-1010.216) (-1010.348) [-1009.288] -- 0:00:58
      49500 -- (-1010.135) (-1023.564) (-1008.950) [-1009.538] * (-1010.723) (-1011.836) (-1008.480) [-1008.111] -- 0:00:57
      50000 -- [-1011.968] (-1014.907) (-1008.910) (-1012.070) * (-1011.500) (-1009.179) (-1009.057) [-1009.236] -- 0:00:57

      Average standard deviation of split frequencies: 0.029463

      50500 -- (-1009.355) (-1018.760) (-1008.276) [-1015.263] * (-1008.391) (-1008.172) (-1008.587) [-1008.450] -- 0:00:56
      51000 -- [-1010.615] (-1017.342) (-1009.057) (-1010.416) * (-1007.897) (-1008.780) (-1009.734) [-1009.003] -- 0:00:55
      51500 -- (-1012.779) [-1016.569] (-1009.495) (-1015.267) * [-1008.344] (-1007.052) (-1009.538) (-1007.583) -- 0:00:55
      52000 -- [-1012.241] (-1023.591) (-1010.371) (-1010.332) * (-1008.198) (-1007.392) (-1009.922) [-1009.973] -- 0:00:54
      52500 -- (-1009.046) (-1019.673) (-1013.605) [-1010.039] * (-1008.126) (-1010.352) (-1011.275) [-1009.343] -- 0:00:54
      53000 -- (-1011.340) [-1016.466] (-1015.856) (-1008.081) * (-1008.255) (-1011.626) [-1008.492] (-1008.043) -- 0:00:53
      53500 -- [-1008.144] (-1016.008) (-1010.436) (-1011.396) * (-1009.826) (-1011.891) (-1010.246) [-1010.068] -- 0:00:53
      54000 -- (-1009.098) [-1013.735] (-1008.085) (-1012.057) * [-1009.561] (-1011.196) (-1011.862) (-1010.075) -- 0:00:52
      54500 -- (-1007.637) (-1014.571) (-1009.180) [-1008.089] * (-1011.423) (-1008.643) (-1012.173) [-1014.235] -- 0:00:52
      55000 -- [-1007.753] (-1012.455) (-1009.501) (-1007.983) * (-1008.466) (-1007.097) (-1010.487) [-1009.654] -- 0:00:51

      Average standard deviation of split frequencies: 0.030398

      55500 -- (-1007.377) (-1020.988) (-1012.481) [-1008.853] * [-1010.613] (-1008.755) (-1011.446) (-1009.289) -- 0:00:51
      56000 -- (-1007.379) (-1029.476) (-1012.494) [-1010.693] * (-1008.013) [-1007.773] (-1008.482) (-1008.262) -- 0:00:50
      56500 -- (-1009.787) (-1013.576) (-1010.260) [-1008.231] * (-1009.346) [-1008.033] (-1008.043) (-1010.406) -- 0:00:50
      57000 -- (-1012.251) (-1020.332) [-1008.849] (-1007.389) * (-1008.638) [-1010.357] (-1009.657) (-1009.561) -- 0:01:06
      57500 -- (-1011.361) [-1023.089] (-1011.705) (-1008.944) * (-1011.835) (-1011.213) (-1012.970) [-1009.052] -- 0:01:05
      58000 -- (-1009.209) (-1022.272) [-1009.594] (-1008.514) * (-1012.752) (-1009.414) [-1012.525] (-1010.037) -- 0:01:04
      58500 -- (-1010.808) [-1021.209] (-1008.380) (-1008.501) * (-1010.184) (-1015.029) (-1014.101) [-1008.686] -- 0:01:04
      59000 -- (-1014.705) (-1012.486) [-1011.832] (-1012.586) * (-1008.227) [-1008.301] (-1007.092) (-1011.742) -- 0:01:03
      59500 -- (-1009.377) (-1014.303) [-1008.466] (-1012.336) * (-1007.817) (-1007.385) [-1009.039] (-1009.344) -- 0:01:03
      60000 -- (-1014.889) (-1018.685) (-1007.783) [-1011.554] * (-1009.028) (-1006.986) [-1010.411] (-1007.928) -- 0:01:02

      Average standard deviation of split frequencies: 0.030693

      60500 -- (-1008.406) [-1016.411] (-1007.562) (-1009.860) * (-1007.921) (-1008.163) [-1009.640] (-1008.100) -- 0:01:02
      61000 -- (-1009.555) (-1025.413) [-1006.982] (-1010.913) * (-1006.648) (-1008.306) (-1011.244) [-1010.163] -- 0:01:01
      61500 -- [-1008.694] (-1028.024) (-1007.110) (-1009.370) * (-1008.386) [-1008.073] (-1008.153) (-1011.027) -- 0:01:01
      62000 -- (-1008.043) (-1020.295) [-1008.377] (-1007.886) * [-1007.329] (-1007.223) (-1009.635) (-1011.482) -- 0:01:00
      62500 -- (-1009.014) (-1007.934) (-1007.437) [-1007.354] * [-1007.563] (-1007.840) (-1011.386) (-1011.765) -- 0:01:00
      63000 -- (-1008.445) (-1007.569) (-1008.045) [-1007.002] * [-1008.327] (-1008.461) (-1007.386) (-1007.775) -- 0:00:59
      63500 -- (-1009.068) [-1007.770] (-1008.174) (-1006.794) * (-1009.996) [-1007.415] (-1008.224) (-1007.096) -- 0:00:58
      64000 -- [-1012.269] (-1010.212) (-1007.812) (-1006.843) * (-1011.213) [-1009.110] (-1006.516) (-1012.797) -- 0:00:58
      64500 -- (-1009.227) (-1007.564) (-1007.585) [-1006.766] * (-1009.851) (-1011.846) (-1006.877) [-1009.354] -- 0:00:58
      65000 -- (-1010.153) (-1010.704) (-1007.857) [-1007.085] * (-1011.278) [-1011.569] (-1008.787) (-1010.119) -- 0:00:57

      Average standard deviation of split frequencies: 0.028570

      65500 -- (-1009.567) [-1006.531] (-1007.231) (-1009.485) * (-1012.020) (-1013.356) [-1011.132] (-1008.787) -- 0:00:57
      66000 -- (-1012.449) [-1006.744] (-1007.232) (-1006.757) * (-1009.584) (-1009.839) [-1007.019] (-1011.897) -- 0:00:56
      66500 -- [-1007.432] (-1008.389) (-1007.053) (-1007.468) * [-1011.861] (-1012.311) (-1008.935) (-1009.774) -- 0:00:56
      67000 -- (-1008.471) [-1009.037] (-1006.697) (-1006.931) * (-1012.236) (-1013.866) (-1007.257) [-1010.155] -- 0:00:55
      67500 -- (-1008.456) (-1013.728) [-1006.786] (-1015.025) * (-1012.388) (-1010.411) [-1007.777] (-1008.981) -- 0:00:55
      68000 -- [-1009.447] (-1007.013) (-1008.781) (-1009.344) * (-1007.432) (-1009.412) [-1008.392] (-1006.951) -- 0:00:54
      68500 -- [-1006.908] (-1007.827) (-1007.899) (-1009.623) * (-1010.383) (-1007.537) [-1008.001] (-1010.566) -- 0:00:54
      69000 -- (-1009.024) (-1010.421) [-1007.372] (-1009.056) * (-1009.564) [-1007.327] (-1007.342) (-1009.211) -- 0:00:53
      69500 -- [-1008.668] (-1008.026) (-1011.226) (-1009.195) * (-1012.202) (-1009.316) [-1007.376] (-1009.444) -- 0:00:53
      70000 -- (-1012.286) (-1007.132) [-1010.128] (-1007.293) * (-1015.857) (-1008.862) (-1008.281) [-1007.293] -- 0:00:53

      Average standard deviation of split frequencies: 0.025683

      70500 -- (-1013.131) (-1008.683) (-1010.409) [-1010.735] * (-1007.879) (-1008.523) [-1007.821] (-1007.685) -- 0:00:52
      71000 -- (-1009.706) (-1008.290) [-1009.712] (-1009.849) * (-1010.094) (-1008.831) (-1007.489) [-1007.823] -- 0:00:52
      71500 -- (-1011.546) [-1008.288] (-1008.643) (-1012.118) * (-1009.863) [-1010.265] (-1008.203) (-1008.102) -- 0:00:51
      72000 -- [-1011.026] (-1007.975) (-1012.981) (-1010.269) * (-1010.435) (-1012.016) (-1008.672) [-1009.435] -- 0:00:51
      72500 -- [-1007.965] (-1011.651) (-1008.496) (-1009.713) * (-1008.319) (-1012.171) (-1006.826) [-1009.292] -- 0:00:51
      73000 -- (-1008.193) (-1008.991) (-1008.981) [-1008.234] * (-1007.590) [-1011.642] (-1009.868) (-1008.556) -- 0:00:50
      73500 -- (-1007.505) (-1011.028) (-1007.500) [-1007.251] * (-1009.628) [-1009.991] (-1008.596) (-1009.872) -- 0:01:03
      74000 -- (-1010.656) (-1008.774) [-1007.529] (-1006.721) * (-1012.622) (-1007.577) (-1007.879) [-1008.940] -- 0:01:02
      74500 -- (-1011.011) (-1008.706) [-1008.451] (-1007.429) * [-1008.279] (-1007.451) (-1016.922) (-1010.029) -- 0:01:02
      75000 -- [-1008.174] (-1006.860) (-1009.260) (-1007.563) * (-1008.056) [-1008.121] (-1015.839) (-1010.811) -- 0:01:01

      Average standard deviation of split frequencies: 0.026770

      75500 -- [-1011.326] (-1006.990) (-1008.726) (-1007.996) * [-1008.230] (-1007.653) (-1014.426) (-1013.309) -- 0:01:01
      76000 -- (-1010.740) (-1008.020) (-1009.229) [-1014.613] * (-1009.136) (-1006.941) (-1009.508) [-1011.320] -- 0:01:00
      76500 -- (-1009.113) (-1009.877) [-1008.090] (-1010.186) * (-1010.087) [-1007.896] (-1010.385) (-1010.259) -- 0:01:00
      77000 -- (-1009.699) [-1007.104] (-1008.538) (-1012.082) * (-1010.119) (-1010.827) [-1010.940] (-1009.450) -- 0:00:59
      77500 -- (-1008.250) [-1007.653] (-1009.802) (-1012.326) * [-1010.830] (-1010.563) (-1009.259) (-1008.878) -- 0:00:59
      78000 -- [-1009.437] (-1008.295) (-1008.007) (-1009.477) * (-1010.040) [-1008.881] (-1010.415) (-1008.966) -- 0:00:59
      78500 -- (-1011.169) (-1008.754) (-1007.592) [-1010.547] * [-1010.697] (-1015.029) (-1010.332) (-1010.778) -- 0:00:58
      79000 -- [-1009.973] (-1009.827) (-1011.801) (-1009.543) * (-1008.748) (-1012.013) [-1012.330] (-1008.777) -- 0:00:58
      79500 -- (-1015.240) [-1008.107] (-1008.511) (-1010.768) * (-1008.205) [-1006.799] (-1010.311) (-1011.402) -- 0:00:57
      80000 -- (-1011.445) [-1008.534] (-1010.073) (-1015.462) * [-1008.103] (-1007.017) (-1011.868) (-1011.468) -- 0:00:57

      Average standard deviation of split frequencies: 0.024674

      80500 -- (-1010.644) (-1008.179) [-1007.204] (-1010.602) * (-1008.648) (-1008.084) [-1007.625] (-1010.084) -- 0:00:57
      81000 -- [-1006.858] (-1007.809) (-1009.132) (-1017.190) * (-1011.060) (-1007.267) (-1010.677) [-1008.580] -- 0:00:56
      81500 -- (-1008.807) (-1008.335) [-1007.647] (-1011.137) * [-1010.591] (-1009.321) (-1010.333) (-1010.241) -- 0:00:56
      82000 -- [-1008.327] (-1011.389) (-1009.810) (-1009.913) * [-1007.420] (-1007.414) (-1008.753) (-1014.382) -- 0:00:55
      82500 -- (-1008.326) (-1012.604) [-1009.248] (-1008.273) * [-1009.012] (-1012.665) (-1007.946) (-1009.925) -- 0:00:55
      83000 -- (-1006.594) (-1008.334) (-1008.110) [-1007.857] * (-1008.166) [-1008.312] (-1007.334) (-1008.324) -- 0:00:55
      83500 -- [-1006.646] (-1009.793) (-1008.669) (-1007.761) * (-1013.957) [-1007.879] (-1008.170) (-1010.916) -- 0:00:54
      84000 -- (-1006.915) (-1009.118) (-1011.340) [-1009.170] * (-1009.418) (-1009.627) [-1010.797] (-1011.310) -- 0:00:54
      84500 -- (-1006.688) [-1007.130] (-1011.616) (-1009.762) * (-1010.333) (-1009.285) [-1010.058] (-1010.030) -- 0:00:54
      85000 -- (-1008.264) (-1007.028) (-1009.215) [-1009.371] * [-1009.637] (-1011.098) (-1010.890) (-1008.712) -- 0:00:53

      Average standard deviation of split frequencies: 0.023753

      85500 -- (-1007.526) [-1007.896] (-1007.873) (-1010.550) * (-1008.672) (-1007.455) [-1008.496] (-1013.071) -- 0:00:53
      86000 -- (-1008.242) (-1011.145) [-1008.302] (-1006.531) * [-1009.794] (-1011.661) (-1006.770) (-1011.536) -- 0:00:53
      86500 -- (-1010.021) (-1013.695) [-1007.902] (-1006.479) * [-1008.772] (-1009.254) (-1008.902) (-1008.548) -- 0:00:52
      87000 -- (-1008.281) (-1010.391) [-1008.226] (-1006.572) * (-1009.754) (-1012.946) (-1013.637) [-1007.580] -- 0:00:52
      87500 -- (-1008.746) (-1009.925) [-1008.288] (-1008.286) * (-1007.840) (-1011.012) [-1010.803] (-1009.300) -- 0:00:52
      88000 -- [-1008.160] (-1008.909) (-1010.438) (-1009.926) * [-1009.194] (-1008.837) (-1012.833) (-1008.410) -- 0:00:51
      88500 -- (-1008.185) (-1008.489) [-1010.419] (-1006.913) * [-1009.260] (-1008.309) (-1009.912) (-1008.367) -- 0:00:51
      89000 -- (-1007.022) [-1008.035] (-1007.081) (-1013.393) * (-1011.073) (-1010.266) [-1012.633] (-1007.157) -- 0:00:51
      89500 -- (-1007.204) (-1007.684) [-1009.408] (-1007.946) * (-1010.390) (-1009.578) (-1016.191) [-1006.670] -- 0:00:50
      90000 -- [-1008.441] (-1008.623) (-1007.163) (-1008.987) * (-1009.209) (-1010.244) (-1010.563) [-1007.211] -- 0:01:00

      Average standard deviation of split frequencies: 0.027441

      90500 -- (-1012.771) (-1008.340) (-1009.106) [-1007.660] * (-1007.202) (-1008.456) (-1013.185) [-1006.859] -- 0:01:00
      91000 -- [-1008.543] (-1008.060) (-1007.792) (-1008.009) * (-1011.268) (-1006.567) [-1010.964] (-1006.995) -- 0:00:59
      91500 -- (-1009.283) (-1008.060) [-1008.660] (-1007.896) * (-1008.629) (-1007.307) (-1009.500) [-1007.451] -- 0:00:59
      92000 -- (-1006.813) (-1008.305) [-1006.959] (-1013.293) * (-1010.481) [-1008.642] (-1009.584) (-1007.190) -- 0:00:59
      92500 -- [-1006.733] (-1009.166) (-1009.649) (-1011.744) * (-1008.453) [-1008.457] (-1010.294) (-1007.776) -- 0:00:58
      93000 -- [-1007.900] (-1007.728) (-1007.988) (-1008.152) * [-1008.019] (-1008.415) (-1011.456) (-1008.867) -- 0:00:58
      93500 -- [-1007.774] (-1008.949) (-1011.414) (-1008.838) * (-1008.033) [-1007.495] (-1011.604) (-1011.475) -- 0:00:58
      94000 -- (-1009.858) [-1007.444] (-1012.298) (-1009.691) * (-1008.640) [-1008.982] (-1010.621) (-1012.436) -- 0:00:57
      94500 -- [-1008.221] (-1009.432) (-1008.192) (-1012.943) * (-1008.256) [-1007.579] (-1011.199) (-1011.872) -- 0:00:57
      95000 -- (-1009.124) (-1012.234) [-1010.429] (-1013.893) * [-1009.769] (-1009.157) (-1010.272) (-1010.170) -- 0:00:57

      Average standard deviation of split frequencies: 0.026574

      95500 -- (-1009.114) [-1009.416] (-1009.856) (-1011.850) * (-1007.881) [-1008.500] (-1009.759) (-1010.337) -- 0:00:56
      96000 -- (-1007.821) (-1009.334) [-1007.469] (-1013.932) * (-1008.501) (-1008.046) (-1008.645) [-1009.841] -- 0:00:56
      96500 -- [-1007.827] (-1009.579) (-1007.858) (-1013.302) * (-1007.627) [-1007.884] (-1008.753) (-1013.647) -- 0:00:56
      97000 -- (-1008.244) [-1008.582] (-1012.557) (-1012.915) * (-1007.679) (-1008.134) (-1009.149) [-1010.643] -- 0:00:55
      97500 -- (-1006.840) [-1007.862] (-1011.093) (-1010.702) * (-1010.180) [-1009.010] (-1010.120) (-1009.362) -- 0:00:55
      98000 -- (-1007.501) (-1012.188) [-1008.476] (-1012.045) * (-1009.794) [-1008.820] (-1008.347) (-1008.949) -- 0:00:55
      98500 -- [-1008.433] (-1007.598) (-1008.306) (-1009.806) * [-1007.444] (-1008.585) (-1008.748) (-1008.318) -- 0:00:54
      99000 -- (-1012.716) (-1009.320) (-1008.762) [-1010.197] * (-1011.883) (-1007.661) (-1009.489) [-1009.304] -- 0:00:54
      99500 -- [-1009.261] (-1009.376) (-1008.133) (-1011.514) * (-1009.440) (-1009.188) (-1006.798) [-1010.489] -- 0:00:54
      100000 -- (-1007.686) (-1013.489) [-1007.448] (-1011.897) * [-1007.098] (-1010.221) (-1007.674) (-1010.750) -- 0:00:54

      Average standard deviation of split frequencies: 0.027577

      100500 -- [-1009.561] (-1009.157) (-1012.562) (-1009.425) * (-1007.596) (-1007.300) (-1006.962) [-1008.937] -- 0:00:53
      101000 -- (-1007.405) (-1008.338) [-1007.745] (-1011.669) * [-1007.812] (-1008.678) (-1009.782) (-1011.380) -- 0:00:53
      101500 -- [-1007.877] (-1010.991) (-1010.121) (-1009.676) * (-1007.518) [-1007.992] (-1008.536) (-1010.545) -- 0:00:53
      102000 -- (-1009.923) [-1009.729] (-1013.381) (-1011.123) * (-1008.247) [-1009.697] (-1008.900) (-1010.285) -- 0:00:52
      102500 -- [-1009.664] (-1011.074) (-1009.662) (-1009.370) * (-1009.051) (-1007.897) [-1008.090] (-1009.392) -- 0:00:52
      103000 -- (-1011.038) [-1007.960] (-1009.229) (-1008.370) * (-1006.886) (-1007.803) [-1007.171] (-1008.557) -- 0:00:52
      103500 -- (-1011.068) (-1008.298) [-1010.588] (-1010.219) * (-1007.935) [-1007.590] (-1007.261) (-1009.668) -- 0:00:51
      104000 -- (-1010.661) (-1009.948) (-1008.087) [-1008.028] * (-1007.382) [-1009.080] (-1007.767) (-1017.825) -- 0:00:51
      104500 -- (-1007.637) [-1007.156] (-1007.549) (-1008.848) * (-1008.041) (-1010.706) [-1007.069] (-1013.503) -- 0:00:51
      105000 -- (-1009.085) [-1008.599] (-1008.118) (-1009.743) * (-1008.835) (-1007.836) (-1007.338) [-1008.907] -- 0:00:51

      Average standard deviation of split frequencies: 0.026449

      105500 -- (-1007.560) [-1008.579] (-1007.514) (-1010.331) * [-1008.453] (-1012.244) (-1008.384) (-1009.269) -- 0:00:50
      106000 -- (-1009.129) [-1008.949] (-1010.510) (-1011.308) * [-1010.887] (-1010.586) (-1009.081) (-1008.882) -- 0:00:59
      106500 -- (-1008.370) (-1008.029) (-1011.708) [-1011.997] * (-1009.422) [-1009.820] (-1008.038) (-1010.081) -- 0:00:58
      107000 -- (-1009.140) [-1007.595] (-1009.394) (-1010.515) * [-1009.047] (-1008.268) (-1010.039) (-1007.952) -- 0:00:58
      107500 -- [-1007.798] (-1011.475) (-1013.575) (-1008.206) * (-1009.949) (-1008.450) [-1009.172] (-1009.854) -- 0:00:58
      108000 -- (-1006.688) (-1011.964) (-1007.489) [-1008.588] * (-1009.612) (-1006.608) (-1011.224) [-1009.578] -- 0:00:57
      108500 -- [-1006.597] (-1011.770) (-1008.170) (-1008.528) * (-1007.967) [-1009.252] (-1011.313) (-1011.162) -- 0:00:57
      109000 -- (-1008.892) (-1009.420) [-1009.181] (-1011.480) * [-1011.416] (-1009.740) (-1007.832) (-1010.015) -- 0:00:57
      109500 -- (-1008.698) [-1010.611] (-1010.036) (-1009.200) * [-1008.985] (-1012.460) (-1010.329) (-1009.807) -- 0:00:56
      110000 -- [-1009.920] (-1008.501) (-1009.734) (-1009.631) * (-1011.043) [-1008.986] (-1013.439) (-1010.651) -- 0:00:56

      Average standard deviation of split frequencies: 0.026679

      110500 -- (-1015.006) (-1009.085) (-1012.632) [-1009.288] * (-1009.361) [-1010.175] (-1008.978) (-1013.596) -- 0:00:56
      111000 -- [-1009.427] (-1009.814) (-1014.859) (-1009.878) * (-1008.386) (-1010.121) [-1009.883] (-1008.204) -- 0:00:56
      111500 -- (-1007.574) (-1007.964) (-1009.353) [-1007.368] * (-1011.186) [-1007.115] (-1009.014) (-1008.210) -- 0:00:55
      112000 -- [-1008.145] (-1007.557) (-1009.838) (-1007.196) * [-1012.053] (-1009.621) (-1012.566) (-1009.299) -- 0:00:55
      112500 -- (-1013.362) (-1006.821) [-1007.917] (-1009.941) * (-1010.086) [-1006.961] (-1008.470) (-1008.775) -- 0:00:55
      113000 -- (-1008.187) (-1011.496) [-1007.010] (-1017.727) * (-1010.106) (-1009.642) [-1007.875] (-1010.428) -- 0:00:54
      113500 -- (-1007.694) [-1008.369] (-1011.110) (-1009.052) * (-1009.903) [-1010.363] (-1012.597) (-1009.896) -- 0:00:54
      114000 -- (-1012.451) (-1010.047) [-1008.293] (-1009.519) * (-1008.425) [-1008.296] (-1014.030) (-1008.827) -- 0:00:54
      114500 -- [-1007.534] (-1008.147) (-1008.409) (-1010.956) * (-1006.983) [-1007.040] (-1008.065) (-1010.306) -- 0:00:54
      115000 -- [-1008.927] (-1008.600) (-1011.657) (-1007.899) * (-1006.972) [-1008.645] (-1010.201) (-1014.028) -- 0:00:53

      Average standard deviation of split frequencies: 0.025060

      115500 -- (-1010.375) (-1009.475) (-1008.111) [-1009.560] * [-1007.288] (-1010.337) (-1009.163) (-1009.327) -- 0:00:53
      116000 -- (-1011.109) [-1009.067] (-1009.523) (-1009.741) * (-1007.661) (-1007.708) (-1008.270) [-1007.676] -- 0:00:53
      116500 -- (-1011.840) (-1010.294) [-1010.253] (-1010.143) * (-1007.360) (-1007.951) [-1007.400] (-1008.334) -- 0:00:53
      117000 -- (-1008.808) (-1010.350) [-1008.474] (-1010.437) * [-1009.597] (-1008.131) (-1009.515) (-1010.897) -- 0:00:52
      117500 -- [-1008.301] (-1007.420) (-1009.756) (-1008.469) * [-1006.858] (-1008.407) (-1008.845) (-1010.810) -- 0:00:52
      118000 -- (-1008.442) [-1007.465] (-1008.271) (-1010.894) * (-1007.416) (-1011.267) (-1009.288) [-1009.093] -- 0:00:52
      118500 -- (-1013.316) (-1007.867) [-1009.770] (-1009.731) * [-1007.606] (-1014.559) (-1008.909) (-1008.156) -- 0:00:52
      119000 -- (-1010.251) (-1009.754) (-1010.274) [-1009.968] * (-1011.344) (-1007.902) [-1009.298] (-1010.460) -- 0:00:51
      119500 -- (-1009.011) [-1012.318] (-1010.112) (-1011.747) * (-1012.366) (-1006.690) [-1007.211] (-1007.754) -- 0:00:51
      120000 -- (-1008.607) (-1010.262) [-1007.895] (-1008.783) * [-1009.629] (-1008.330) (-1008.253) (-1011.242) -- 0:00:51

      Average standard deviation of split frequencies: 0.023440

      120500 -- (-1008.481) (-1009.832) [-1007.329] (-1008.889) * [-1007.911] (-1008.531) (-1011.318) (-1006.957) -- 0:00:51
      121000 -- [-1008.964] (-1011.362) (-1006.541) (-1009.188) * (-1010.618) (-1007.727) [-1008.028] (-1009.402) -- 0:00:50
      121500 -- (-1007.631) (-1009.584) [-1006.821] (-1009.557) * (-1008.768) (-1012.600) [-1009.764] (-1008.088) -- 0:00:50
      122000 -- (-1009.111) (-1008.058) (-1007.364) [-1009.924] * (-1008.607) [-1014.618] (-1010.185) (-1007.862) -- 0:00:57
      122500 -- (-1012.031) [-1009.219] (-1008.673) (-1008.569) * (-1008.866) (-1013.112) (-1013.347) [-1007.798] -- 0:00:57
      123000 -- (-1010.187) [-1010.511] (-1008.781) (-1008.517) * (-1009.262) (-1008.887) (-1013.581) [-1008.118] -- 0:00:57
      123500 -- (-1009.830) (-1010.851) [-1007.557] (-1009.430) * (-1008.766) [-1008.462] (-1011.068) (-1010.178) -- 0:00:56
      124000 -- (-1010.052) (-1009.533) [-1008.282] (-1010.351) * [-1009.720] (-1008.638) (-1010.652) (-1007.632) -- 0:00:56
      124500 -- (-1011.308) [-1007.431] (-1009.102) (-1013.049) * [-1012.685] (-1009.544) (-1007.395) (-1007.327) -- 0:00:56
      125000 -- (-1012.605) (-1009.171) (-1010.295) [-1007.366] * (-1009.924) (-1012.014) (-1010.263) [-1008.571] -- 0:00:56

      Average standard deviation of split frequencies: 0.023768

      125500 -- (-1009.114) [-1008.114] (-1007.761) (-1009.964) * (-1008.825) (-1016.345) (-1009.553) [-1008.150] -- 0:00:55
      126000 -- [-1008.817] (-1007.728) (-1012.274) (-1010.247) * (-1011.249) [-1008.561] (-1008.745) (-1006.862) -- 0:00:55
      126500 -- (-1011.093) (-1006.916) [-1011.096] (-1009.608) * (-1008.616) (-1006.994) [-1008.968] (-1012.489) -- 0:00:55
      127000 -- [-1008.915] (-1008.405) (-1009.744) (-1008.441) * (-1011.148) [-1008.398] (-1007.247) (-1013.799) -- 0:00:54
      127500 -- (-1008.915) [-1008.374] (-1009.341) (-1010.967) * [-1008.582] (-1008.865) (-1007.276) (-1008.945) -- 0:00:54
      128000 -- (-1007.484) [-1009.129] (-1007.385) (-1010.113) * (-1010.280) (-1007.695) [-1011.031] (-1007.396) -- 0:00:54
      128500 -- [-1010.335] (-1007.534) (-1008.228) (-1009.900) * [-1007.306] (-1007.532) (-1017.832) (-1007.832) -- 0:00:54
      129000 -- [-1008.834] (-1007.921) (-1008.660) (-1010.040) * (-1007.357) (-1008.484) (-1009.260) [-1009.440] -- 0:00:54
      129500 -- (-1006.947) [-1007.471] (-1009.484) (-1013.317) * (-1016.228) (-1007.751) [-1007.217] (-1010.453) -- 0:00:53
      130000 -- (-1007.120) (-1012.910) (-1008.425) [-1009.944] * (-1009.918) (-1008.472) [-1007.897] (-1010.315) -- 0:00:53

      Average standard deviation of split frequencies: 0.026739

      130500 -- (-1007.163) (-1009.919) (-1008.090) [-1011.010] * [-1008.463] (-1008.532) (-1008.606) (-1006.848) -- 0:00:53
      131000 -- (-1007.306) (-1012.934) (-1008.079) [-1008.445] * [-1008.402] (-1008.723) (-1009.275) (-1006.889) -- 0:00:53
      131500 -- (-1011.652) (-1010.048) (-1013.277) [-1007.715] * (-1008.342) [-1011.013] (-1007.056) (-1006.697) -- 0:00:52
      132000 -- (-1008.686) (-1009.064) (-1009.380) [-1008.394] * (-1008.471) (-1010.426) (-1009.059) [-1011.063] -- 0:00:52
      132500 -- (-1013.745) (-1013.455) (-1009.372) [-1008.514] * (-1008.174) (-1009.359) (-1007.509) [-1009.991] -- 0:00:52
      133000 -- (-1011.538) [-1014.810] (-1009.175) (-1007.682) * [-1008.317] (-1008.110) (-1006.943) (-1008.323) -- 0:00:52
      133500 -- (-1008.739) (-1011.990) (-1009.467) [-1006.714] * [-1007.989] (-1009.923) (-1007.465) (-1008.196) -- 0:00:51
      134000 -- [-1007.216] (-1008.935) (-1013.677) (-1007.260) * (-1007.586) [-1007.781] (-1008.635) (-1008.865) -- 0:00:51
      134500 -- (-1009.826) [-1007.816] (-1009.164) (-1007.747) * (-1007.899) [-1009.027] (-1009.358) (-1007.000) -- 0:00:51
      135000 -- [-1010.356] (-1008.554) (-1008.991) (-1008.062) * (-1011.437) (-1009.451) (-1009.956) [-1011.372] -- 0:00:51

      Average standard deviation of split frequencies: 0.025804

      135500 -- (-1009.925) (-1009.226) [-1010.163] (-1008.319) * (-1008.492) (-1007.261) [-1014.103] (-1010.828) -- 0:00:51
      136000 -- [-1008.998] (-1006.809) (-1011.450) (-1010.733) * (-1010.004) [-1010.217] (-1008.429) (-1009.350) -- 0:00:50
      136500 -- [-1009.812] (-1008.436) (-1012.922) (-1008.827) * [-1008.801] (-1007.986) (-1010.086) (-1008.589) -- 0:00:50
      137000 -- [-1008.313] (-1009.044) (-1009.781) (-1009.949) * (-1009.097) (-1007.489) (-1007.557) [-1009.498] -- 0:00:50
      137500 -- (-1009.533) (-1008.778) (-1009.473) [-1009.624] * [-1008.195] (-1006.994) (-1012.875) (-1008.110) -- 0:00:50
      138000 -- (-1011.113) (-1009.211) (-1009.708) [-1010.755] * [-1007.124] (-1009.397) (-1008.226) (-1007.830) -- 0:00:49
      138500 -- (-1013.520) (-1007.889) [-1007.791] (-1010.390) * [-1007.609] (-1009.472) (-1008.348) (-1009.558) -- 0:00:55
      139000 -- (-1008.016) [-1009.262] (-1010.246) (-1008.645) * (-1007.711) [-1008.086] (-1010.750) (-1008.610) -- 0:00:55
      139500 -- (-1008.388) (-1012.313) (-1008.381) [-1007.101] * (-1010.615) [-1010.760] (-1010.531) (-1007.459) -- 0:00:55
      140000 -- [-1007.911] (-1007.417) (-1009.817) (-1011.620) * (-1011.327) (-1007.975) (-1008.740) [-1007.530] -- 0:00:55

      Average standard deviation of split frequencies: 0.024948

      140500 -- (-1007.886) [-1010.495] (-1008.365) (-1006.900) * (-1009.962) [-1007.339] (-1008.365) (-1007.023) -- 0:00:55
      141000 -- (-1007.791) (-1008.381) (-1007.149) [-1010.479] * (-1008.825) (-1007.715) [-1009.376] (-1007.091) -- 0:00:54
      141500 -- (-1010.541) [-1008.635] (-1007.852) (-1008.381) * (-1013.551) [-1009.151] (-1008.039) (-1007.788) -- 0:00:54
      142000 -- (-1007.903) (-1007.633) (-1007.893) [-1007.288] * (-1013.250) (-1009.395) (-1009.571) [-1007.286] -- 0:00:54
      142500 -- (-1010.208) (-1008.777) [-1006.866] (-1011.276) * (-1010.369) (-1009.627) [-1011.366] (-1009.222) -- 0:00:54
      143000 -- (-1012.933) (-1007.252) [-1007.323] (-1009.927) * (-1014.645) (-1010.026) [-1009.233] (-1009.774) -- 0:00:53
      143500 -- [-1007.038] (-1013.093) (-1007.797) (-1008.495) * [-1011.520] (-1013.279) (-1009.984) (-1010.417) -- 0:00:53
      144000 -- (-1008.057) (-1007.242) [-1007.795] (-1009.879) * (-1008.619) [-1008.603] (-1008.707) (-1011.401) -- 0:00:53
      144500 -- [-1007.568] (-1010.721) (-1008.399) (-1008.671) * (-1012.050) (-1006.969) [-1010.465] (-1010.633) -- 0:00:53
      145000 -- (-1008.998) [-1009.347] (-1010.775) (-1009.161) * (-1012.809) (-1007.750) (-1009.356) [-1010.604] -- 0:00:53

      Average standard deviation of split frequencies: 0.022763

      145500 -- [-1009.544] (-1007.718) (-1012.414) (-1008.670) * (-1017.514) [-1008.302] (-1010.846) (-1009.708) -- 0:00:52
      146000 -- (-1010.847) [-1011.134] (-1012.812) (-1010.416) * [-1007.547] (-1007.350) (-1013.554) (-1010.282) -- 0:00:52
      146500 -- (-1009.369) (-1009.234) (-1010.898) [-1009.396] * (-1006.898) [-1007.784] (-1011.718) (-1008.251) -- 0:00:52
      147000 -- (-1007.076) (-1007.724) (-1009.399) [-1008.724] * [-1007.633] (-1013.441) (-1008.496) (-1008.951) -- 0:00:52
      147500 -- (-1007.368) [-1008.052] (-1007.451) (-1006.670) * [-1007.851] (-1015.917) (-1008.254) (-1008.499) -- 0:00:52
      148000 -- [-1007.748] (-1012.942) (-1012.560) (-1008.002) * [-1008.403] (-1008.552) (-1008.495) (-1008.134) -- 0:00:51
      148500 -- (-1008.873) (-1009.800) [-1007.773] (-1010.245) * (-1008.768) (-1011.996) [-1009.042] (-1007.716) -- 0:00:51
      149000 -- (-1008.669) [-1008.752] (-1008.240) (-1010.358) * [-1007.423] (-1006.825) (-1008.241) (-1009.383) -- 0:00:51
      149500 -- [-1006.734] (-1009.498) (-1010.314) (-1013.786) * (-1010.193) (-1007.314) [-1009.958] (-1011.908) -- 0:00:51
      150000 -- (-1007.933) (-1010.991) [-1009.715] (-1007.564) * [-1008.510] (-1007.811) (-1012.618) (-1008.354) -- 0:00:51

      Average standard deviation of split frequencies: 0.022058

      150500 -- (-1009.760) (-1015.466) [-1009.450] (-1006.945) * (-1007.653) (-1007.888) [-1010.152] (-1008.299) -- 0:00:50
      151000 -- (-1008.361) (-1009.565) [-1009.567] (-1007.319) * (-1008.896) (-1008.102) [-1010.885] (-1008.417) -- 0:00:50
      151500 -- (-1007.988) [-1008.396] (-1009.169) (-1007.316) * (-1010.477) [-1007.206] (-1008.423) (-1007.935) -- 0:00:50
      152000 -- (-1008.134) (-1008.115) (-1010.572) [-1008.749] * (-1010.477) (-1009.160) [-1007.389] (-1009.173) -- 0:00:50
      152500 -- (-1008.777) (-1008.583) [-1010.073] (-1009.603) * (-1010.515) (-1012.911) [-1007.421] (-1007.527) -- 0:00:50
      153000 -- (-1009.599) (-1009.661) (-1009.041) [-1009.682] * (-1011.628) (-1012.906) (-1007.039) [-1007.759] -- 0:00:49
      153500 -- (-1006.820) (-1008.168) [-1006.930] (-1008.434) * (-1008.478) (-1009.671) (-1007.638) [-1007.643] -- 0:00:49
      154000 -- [-1007.081] (-1008.089) (-1007.897) (-1013.334) * [-1008.368] (-1010.692) (-1007.715) (-1007.257) -- 0:00:49
      154500 -- [-1009.782] (-1007.604) (-1009.188) (-1012.229) * (-1007.875) (-1008.793) [-1008.095] (-1007.257) -- 0:00:49
      155000 -- [-1008.889] (-1010.575) (-1008.051) (-1011.585) * (-1016.128) (-1008.442) (-1010.121) [-1009.686] -- 0:00:54

      Average standard deviation of split frequencies: 0.022210

      155500 -- [-1008.847] (-1006.682) (-1009.150) (-1010.936) * (-1008.389) [-1013.036] (-1008.242) (-1011.083) -- 0:00:54
      156000 -- (-1011.399) [-1009.367] (-1009.143) (-1009.414) * (-1008.586) (-1008.458) [-1007.949] (-1008.027) -- 0:00:54
      156500 -- [-1008.276] (-1008.590) (-1007.822) (-1010.243) * (-1010.409) (-1012.134) (-1011.081) [-1008.716] -- 0:00:53
      157000 -- (-1008.870) (-1009.325) [-1007.798] (-1008.738) * [-1006.682] (-1009.056) (-1010.455) (-1008.436) -- 0:00:53
      157500 -- (-1007.644) (-1007.425) (-1007.626) [-1008.790] * (-1006.577) (-1009.145) [-1007.636] (-1008.769) -- 0:00:53
      158000 -- (-1009.696) (-1008.333) (-1008.745) [-1008.152] * (-1007.017) [-1008.159] (-1014.887) (-1011.890) -- 0:00:53
      158500 -- (-1009.538) (-1009.031) (-1007.187) [-1007.806] * [-1008.407] (-1013.550) (-1009.124) (-1008.467) -- 0:00:53
      159000 -- [-1008.326] (-1008.414) (-1008.896) (-1010.128) * (-1007.828) (-1009.446) (-1011.623) [-1008.780] -- 0:00:52
      159500 -- (-1008.690) (-1008.373) (-1008.392) [-1008.787] * (-1010.212) (-1009.098) [-1012.941] (-1007.903) -- 0:00:52
      160000 -- (-1011.748) (-1007.872) [-1007.067] (-1009.047) * (-1009.570) (-1010.352) [-1013.694] (-1007.946) -- 0:00:52

      Average standard deviation of split frequencies: 0.019612

      160500 -- (-1009.015) [-1008.360] (-1007.612) (-1008.703) * (-1010.537) [-1009.284] (-1007.426) (-1009.380) -- 0:00:52
      161000 -- [-1010.068] (-1008.966) (-1007.435) (-1010.212) * (-1007.500) (-1009.001) [-1010.933] (-1011.869) -- 0:00:52
      161500 -- [-1007.546] (-1008.509) (-1007.461) (-1010.414) * [-1008.683] (-1008.224) (-1007.552) (-1012.176) -- 0:00:51
      162000 -- (-1010.209) (-1007.449) (-1008.941) [-1007.086] * (-1012.564) (-1010.152) [-1007.539] (-1008.914) -- 0:00:51
      162500 -- (-1014.642) [-1008.148] (-1009.215) (-1007.700) * [-1011.156] (-1008.246) (-1008.537) (-1008.369) -- 0:00:51
      163000 -- (-1017.493) (-1006.735) [-1007.753] (-1007.594) * (-1011.942) (-1007.838) [-1008.702] (-1008.931) -- 0:00:51
      163500 -- [-1010.865] (-1009.465) (-1006.920) (-1007.562) * (-1007.890) (-1007.215) [-1009.695] (-1007.988) -- 0:00:51
      164000 -- [-1008.382] (-1011.060) (-1013.896) (-1007.196) * (-1007.641) [-1010.384] (-1008.075) (-1010.605) -- 0:00:50
      164500 -- [-1013.401] (-1006.958) (-1010.078) (-1008.118) * (-1009.678) (-1010.422) [-1007.567] (-1009.833) -- 0:00:50
      165000 -- (-1013.251) (-1008.102) (-1006.827) [-1008.357] * (-1006.966) (-1007.267) (-1007.547) [-1010.012] -- 0:00:50

      Average standard deviation of split frequencies: 0.018885

      165500 -- [-1009.016] (-1008.674) (-1009.276) (-1008.284) * (-1006.731) (-1007.704) [-1007.347] (-1010.626) -- 0:00:50
      166000 -- (-1010.288) (-1008.442) [-1006.808] (-1009.574) * (-1008.800) (-1007.512) (-1007.656) [-1011.982] -- 0:00:50
      166500 -- (-1009.974) (-1008.565) [-1006.732] (-1008.514) * (-1011.547) (-1007.703) (-1006.741) [-1009.579] -- 0:00:50
      167000 -- (-1009.217) [-1008.507] (-1006.648) (-1008.455) * (-1009.618) (-1014.467) [-1008.813] (-1009.239) -- 0:00:49
      167500 -- (-1016.153) (-1009.284) (-1010.791) [-1007.993] * [-1007.027] (-1007.770) (-1008.278) (-1009.839) -- 0:00:49
      168000 -- (-1011.393) (-1011.590) [-1006.580] (-1008.051) * (-1008.458) [-1007.491] (-1009.659) (-1006.920) -- 0:00:49
      168500 -- (-1009.972) [-1010.320] (-1007.326) (-1007.718) * [-1008.051] (-1016.383) (-1008.951) (-1007.330) -- 0:00:49
      169000 -- (-1010.626) (-1014.831) [-1010.039] (-1007.445) * [-1008.246] (-1014.452) (-1009.712) (-1007.689) -- 0:00:49
      169500 -- [-1009.354] (-1012.867) (-1007.525) (-1007.504) * (-1008.383) (-1010.020) [-1010.559] (-1007.896) -- 0:00:48
      170000 -- (-1013.030) [-1009.858] (-1009.904) (-1007.183) * [-1008.434] (-1007.276) (-1015.356) (-1013.600) -- 0:00:48

      Average standard deviation of split frequencies: 0.016987

      170500 -- (-1007.404) (-1010.765) [-1008.448] (-1008.644) * (-1009.462) [-1008.094] (-1011.131) (-1012.767) -- 0:00:48
      171000 -- (-1008.441) [-1009.166] (-1009.347) (-1008.066) * (-1010.650) (-1009.467) (-1011.756) [-1009.687] -- 0:00:53
      171500 -- (-1008.422) (-1010.544) [-1008.066] (-1007.763) * [-1008.488] (-1009.464) (-1008.197) (-1011.935) -- 0:00:53
      172000 -- [-1008.388] (-1007.389) (-1006.880) (-1006.861) * [-1010.109] (-1008.497) (-1010.191) (-1014.332) -- 0:00:52
      172500 -- (-1007.696) (-1011.160) [-1009.001] (-1008.766) * (-1008.418) (-1014.660) [-1007.952] (-1008.810) -- 0:00:52
      173000 -- [-1007.945] (-1009.391) (-1008.269) (-1007.556) * (-1008.118) [-1007.810] (-1008.112) (-1008.970) -- 0:00:52
      173500 -- (-1008.566) (-1008.799) (-1007.150) [-1009.543] * (-1012.289) (-1009.093) [-1008.812] (-1008.921) -- 0:00:52
      174000 -- [-1007.577] (-1007.995) (-1009.457) (-1011.629) * (-1011.342) [-1006.802] (-1008.806) (-1009.798) -- 0:00:52
      174500 -- (-1007.689) [-1009.219] (-1008.209) (-1007.610) * (-1009.549) [-1006.772] (-1011.888) (-1007.777) -- 0:00:52
      175000 -- (-1007.453) (-1012.137) (-1007.566) [-1012.212] * [-1012.549] (-1008.142) (-1013.508) (-1007.777) -- 0:00:51

      Average standard deviation of split frequencies: 0.016634

      175500 -- (-1006.970) (-1009.891) (-1007.753) [-1007.980] * (-1008.600) (-1010.424) [-1008.000] (-1007.484) -- 0:00:51
      176000 -- (-1007.677) (-1009.316) [-1007.771] (-1009.621) * (-1008.514) (-1007.952) [-1009.595] (-1011.186) -- 0:00:51
      176500 -- [-1007.487] (-1009.058) (-1007.771) (-1007.015) * [-1008.414] (-1008.734) (-1007.528) (-1010.819) -- 0:00:51
      177000 -- (-1012.620) [-1009.645] (-1008.410) (-1010.801) * [-1009.212] (-1007.596) (-1008.554) (-1014.948) -- 0:00:51
      177500 -- [-1012.735] (-1008.031) (-1008.101) (-1006.784) * (-1010.182) [-1007.585] (-1009.051) (-1010.518) -- 0:00:50
      178000 -- (-1008.962) (-1007.596) (-1008.121) [-1007.952] * (-1010.104) (-1009.264) [-1009.221] (-1011.726) -- 0:00:50
      178500 -- (-1011.548) (-1011.063) (-1008.994) [-1011.375] * (-1007.553) (-1009.764) [-1008.446] (-1008.946) -- 0:00:50
      179000 -- (-1008.489) (-1009.035) [-1010.132] (-1009.987) * [-1010.491] (-1009.257) (-1008.017) (-1009.218) -- 0:00:50
      179500 -- (-1009.665) (-1007.311) [-1011.996] (-1008.627) * (-1007.964) [-1007.674] (-1007.427) (-1008.863) -- 0:00:50
      180000 -- (-1007.410) [-1008.853] (-1010.791) (-1008.890) * [-1008.106] (-1007.003) (-1012.643) (-1007.760) -- 0:00:50

      Average standard deviation of split frequencies: 0.016235

      180500 -- [-1009.462] (-1012.215) (-1008.051) (-1007.613) * (-1010.745) (-1006.985) [-1008.277] (-1008.686) -- 0:00:49
      181000 -- [-1008.224] (-1007.217) (-1009.817) (-1007.808) * (-1010.659) [-1011.463] (-1009.353) (-1010.754) -- 0:00:49
      181500 -- [-1008.882] (-1011.275) (-1010.060) (-1012.462) * (-1009.255) [-1008.046] (-1011.761) (-1011.356) -- 0:00:49
      182000 -- (-1007.551) (-1006.844) [-1008.437] (-1010.767) * (-1008.165) (-1009.680) (-1008.688) [-1009.501] -- 0:00:49
      182500 -- (-1008.451) (-1008.946) [-1008.987] (-1008.010) * [-1009.782] (-1007.436) (-1009.380) (-1008.549) -- 0:00:49
      183000 -- [-1010.675] (-1010.373) (-1013.200) (-1007.373) * (-1007.026) [-1008.619] (-1013.032) (-1012.932) -- 0:00:49
      183500 -- [-1007.689] (-1009.439) (-1009.172) (-1009.185) * (-1007.028) (-1007.071) [-1012.161] (-1009.020) -- 0:00:48
      184000 -- [-1007.684] (-1007.787) (-1007.206) (-1008.231) * (-1008.015) (-1007.404) [-1010.047] (-1011.326) -- 0:00:48
      184500 -- (-1010.458) [-1008.304] (-1010.660) (-1008.364) * (-1008.232) [-1007.575] (-1007.689) (-1015.905) -- 0:00:48
      185000 -- (-1008.086) (-1007.269) [-1008.837] (-1008.257) * (-1012.336) (-1008.831) [-1008.175] (-1012.761) -- 0:00:48

      Average standard deviation of split frequencies: 0.015740

      185500 -- (-1008.035) (-1008.711) (-1008.247) [-1007.529] * (-1009.571) (-1010.794) [-1009.071] (-1007.438) -- 0:00:48
      186000 -- [-1007.019] (-1011.136) (-1008.329) (-1009.874) * (-1008.490) (-1009.312) [-1009.999] (-1010.818) -- 0:00:48
      186500 -- (-1011.158) (-1011.506) [-1007.062] (-1007.367) * (-1009.294) (-1010.809) (-1010.811) [-1007.334] -- 0:00:47
      187000 -- (-1013.182) [-1008.798] (-1007.245) (-1007.894) * (-1008.986) (-1009.982) [-1008.789] (-1007.459) -- 0:00:47
      187500 -- (-1012.290) [-1008.589] (-1007.278) (-1011.664) * (-1011.413) (-1010.821) [-1008.980] (-1007.666) -- 0:00:52
      188000 -- (-1012.136) [-1010.180] (-1008.226) (-1008.210) * (-1009.497) (-1011.364) [-1007.991] (-1007.920) -- 0:00:51
      188500 -- [-1008.922] (-1010.565) (-1009.508) (-1009.923) * (-1009.130) [-1010.794] (-1007.373) (-1007.921) -- 0:00:51
      189000 -- [-1008.596] (-1009.139) (-1007.042) (-1007.239) * (-1010.287) (-1007.855) [-1007.126] (-1007.978) -- 0:00:51
      189500 -- (-1007.892) (-1009.574) [-1008.384] (-1007.239) * (-1010.434) (-1006.922) [-1008.022] (-1007.977) -- 0:00:51
      190000 -- [-1012.023] (-1007.760) (-1009.083) (-1007.022) * (-1011.421) (-1007.284) [-1009.563] (-1008.666) -- 0:00:51

      Average standard deviation of split frequencies: 0.014010

      190500 -- (-1008.122) (-1008.657) [-1008.107] (-1007.706) * (-1008.453) (-1007.114) [-1013.726] (-1011.819) -- 0:00:50
      191000 -- (-1007.353) (-1008.819) (-1008.375) [-1009.554] * (-1007.450) (-1007.789) [-1017.854] (-1009.602) -- 0:00:50
      191500 -- (-1007.800) (-1008.039) [-1009.818] (-1009.729) * [-1008.290] (-1012.025) (-1015.929) (-1009.371) -- 0:00:50
      192000 -- (-1007.892) (-1007.115) [-1008.224] (-1010.630) * (-1008.840) (-1009.649) [-1007.341] (-1014.903) -- 0:00:50
      192500 -- (-1007.185) [-1008.250] (-1009.615) (-1014.449) * (-1006.903) (-1007.244) (-1010.402) [-1009.310] -- 0:00:50
      193000 -- [-1008.173] (-1011.203) (-1008.325) (-1015.098) * [-1006.497] (-1008.222) (-1007.832) (-1010.541) -- 0:00:50
      193500 -- (-1011.225) (-1011.881) [-1008.183] (-1009.108) * (-1006.774) (-1007.833) (-1007.464) [-1010.286] -- 0:00:50
      194000 -- (-1008.173) (-1010.459) [-1007.947] (-1008.880) * (-1007.953) (-1010.539) (-1007.477) [-1007.219] -- 0:00:49
      194500 -- [-1009.914] (-1008.726) (-1014.640) (-1007.721) * [-1009.212] (-1010.523) (-1008.779) (-1008.643) -- 0:00:49
      195000 -- (-1007.241) (-1009.356) (-1012.684) [-1009.216] * [-1007.949] (-1008.745) (-1013.035) (-1011.643) -- 0:00:49

      Average standard deviation of split frequencies: 0.011892

      195500 -- (-1009.976) [-1010.334] (-1009.044) (-1009.024) * (-1007.819) [-1011.010] (-1009.022) (-1009.987) -- 0:00:49
      196000 -- (-1008.456) (-1009.804) [-1009.363] (-1009.058) * (-1006.623) (-1009.653) [-1008.935] (-1009.124) -- 0:00:49
      196500 -- (-1007.933) (-1007.703) (-1010.027) [-1007.944] * (-1006.527) (-1008.092) (-1007.181) [-1009.429] -- 0:00:49
      197000 -- (-1007.521) [-1008.549] (-1008.513) (-1009.656) * [-1007.765] (-1014.205) (-1008.949) (-1007.640) -- 0:00:48
      197500 -- (-1007.958) (-1007.987) (-1008.555) [-1010.119] * (-1008.958) (-1012.141) (-1008.362) [-1008.973] -- 0:00:48
      198000 -- (-1007.140) (-1008.433) (-1008.868) [-1009.137] * (-1007.967) (-1010.829) (-1008.585) [-1012.429] -- 0:00:48
      198500 -- (-1006.998) [-1009.455] (-1012.665) (-1008.126) * [-1009.736] (-1007.774) (-1007.818) (-1008.449) -- 0:00:48
      199000 -- (-1008.750) (-1007.740) [-1008.656] (-1007.548) * [-1007.786] (-1008.597) (-1012.047) (-1008.154) -- 0:00:48
      199500 -- [-1007.136] (-1006.848) (-1008.271) (-1009.726) * [-1009.407] (-1011.871) (-1009.622) (-1009.441) -- 0:00:48
      200000 -- [-1006.869] (-1009.630) (-1007.706) (-1011.483) * (-1009.054) (-1008.467) [-1008.275] (-1008.788) -- 0:00:48

      Average standard deviation of split frequencies: 0.014837

      200500 -- [-1006.807] (-1011.265) (-1008.098) (-1009.663) * [-1008.061] (-1007.995) (-1011.738) (-1008.114) -- 0:00:47
      201000 -- (-1009.208) (-1007.496) [-1008.042] (-1009.424) * (-1010.649) (-1011.943) (-1014.067) [-1009.340] -- 0:00:47
      201500 -- (-1013.522) (-1007.232) (-1007.358) [-1010.131] * (-1010.019) (-1009.410) [-1009.682] (-1010.447) -- 0:00:47
      202000 -- (-1009.756) (-1007.007) (-1007.200) [-1008.907] * (-1012.855) (-1008.298) (-1009.626) [-1007.131] -- 0:00:47
      202500 -- (-1007.058) (-1007.145) (-1013.540) [-1008.563] * (-1008.998) (-1011.099) [-1011.905] (-1007.617) -- 0:00:47
      203000 -- (-1010.307) (-1007.261) (-1008.020) [-1008.272] * [-1006.713] (-1014.321) (-1010.179) (-1008.609) -- 0:00:47
      203500 -- (-1008.697) [-1008.538] (-1007.506) (-1009.184) * (-1007.538) (-1009.039) [-1009.323] (-1007.532) -- 0:00:50
      204000 -- [-1006.872] (-1009.576) (-1006.996) (-1008.960) * (-1010.438) (-1014.132) [-1007.320] (-1007.068) -- 0:00:50
      204500 -- (-1008.032) (-1008.181) (-1007.697) [-1007.739] * (-1007.900) (-1011.878) (-1010.629) [-1008.263] -- 0:00:50
      205000 -- (-1007.395) (-1007.519) [-1007.648] (-1009.344) * (-1010.849) (-1008.437) (-1008.910) [-1007.704] -- 0:00:50

      Average standard deviation of split frequencies: 0.014935

      205500 -- [-1006.706] (-1008.431) (-1008.230) (-1010.763) * (-1010.751) (-1008.863) [-1011.154] (-1008.962) -- 0:00:50
      206000 -- (-1006.706) [-1009.118] (-1012.580) (-1014.591) * (-1008.417) (-1007.624) [-1008.810] (-1013.295) -- 0:00:50
      206500 -- [-1009.304] (-1008.825) (-1007.128) (-1011.754) * (-1011.082) [-1008.070] (-1008.413) (-1007.897) -- 0:00:49
      207000 -- [-1007.164] (-1009.628) (-1008.412) (-1014.995) * (-1012.812) (-1007.324) (-1008.719) [-1006.677] -- 0:00:49
      207500 -- (-1010.570) (-1010.892) (-1010.803) [-1009.515] * [-1007.999] (-1008.337) (-1009.183) (-1008.103) -- 0:00:49
      208000 -- [-1010.643] (-1012.641) (-1007.234) (-1008.242) * (-1007.776) (-1007.489) (-1006.977) [-1006.769] -- 0:00:49
      208500 -- [-1007.640] (-1011.724) (-1008.338) (-1008.229) * (-1006.963) (-1013.279) (-1007.881) [-1009.039] -- 0:00:49
      209000 -- (-1008.975) (-1009.803) (-1009.629) [-1008.734] * [-1006.963] (-1008.824) (-1009.291) (-1008.161) -- 0:00:49
      209500 -- (-1010.875) [-1009.144] (-1008.413) (-1008.743) * (-1008.725) (-1008.367) (-1010.380) [-1013.821] -- 0:00:49
      210000 -- [-1009.142] (-1007.994) (-1011.598) (-1008.721) * (-1010.459) (-1008.568) (-1011.597) [-1009.711] -- 0:00:48

      Average standard deviation of split frequencies: 0.015193

      210500 -- (-1010.534) (-1007.624) (-1010.211) [-1009.193] * (-1007.188) (-1008.234) [-1009.151] (-1008.139) -- 0:00:48
      211000 -- (-1014.222) (-1009.274) [-1008.140] (-1007.498) * [-1007.785] (-1010.744) (-1009.022) (-1009.971) -- 0:00:48
      211500 -- (-1010.434) [-1011.365] (-1007.883) (-1009.697) * (-1012.841) [-1010.292] (-1012.238) (-1007.505) -- 0:00:48
      212000 -- (-1010.508) (-1010.229) [-1007.304] (-1010.530) * (-1016.969) [-1010.309] (-1012.099) (-1011.840) -- 0:00:48
      212500 -- (-1010.792) [-1012.044] (-1007.763) (-1009.068) * (-1010.224) [-1006.671] (-1012.043) (-1007.711) -- 0:00:48
      213000 -- (-1012.470) (-1010.967) [-1007.920] (-1008.671) * [-1011.350] (-1007.937) (-1007.099) (-1010.921) -- 0:00:48
      213500 -- (-1012.021) [-1008.222] (-1009.326) (-1007.281) * (-1009.381) (-1008.493) (-1008.563) [-1011.236] -- 0:00:47
      214000 -- (-1016.101) (-1007.082) (-1009.138) [-1008.782] * (-1011.113) (-1009.323) [-1007.626] (-1008.240) -- 0:00:47
      214500 -- (-1009.773) [-1007.126] (-1013.339) (-1007.696) * (-1012.249) [-1010.018] (-1009.598) (-1008.151) -- 0:00:47
      215000 -- (-1011.379) [-1006.870] (-1008.334) (-1009.026) * [-1007.921] (-1009.845) (-1009.365) (-1008.821) -- 0:00:47

      Average standard deviation of split frequencies: 0.014703

      215500 -- (-1008.321) (-1010.788) (-1009.443) [-1010.177] * (-1008.429) [-1010.631] (-1012.069) (-1009.735) -- 0:00:47
      216000 -- [-1008.858] (-1009.361) (-1009.911) (-1011.271) * (-1006.817) (-1009.966) (-1013.272) [-1007.939] -- 0:00:47
      216500 -- (-1007.280) (-1009.835) [-1011.464] (-1008.316) * (-1008.564) (-1008.471) (-1010.041) [-1009.013] -- 0:00:47
      217000 -- [-1007.429] (-1008.945) (-1009.255) (-1009.651) * [-1010.117] (-1010.405) (-1009.836) (-1009.695) -- 0:00:46
      217500 -- (-1007.387) (-1008.945) (-1009.884) [-1008.905] * (-1007.761) [-1010.409] (-1009.979) (-1010.754) -- 0:00:46
      218000 -- (-1011.227) (-1009.278) (-1007.430) [-1008.122] * (-1012.491) [-1009.122] (-1008.703) (-1009.763) -- 0:00:46
      218500 -- (-1012.895) [-1007.253] (-1008.775) (-1006.869) * (-1009.595) (-1008.385) (-1007.852) [-1009.657] -- 0:00:46
      219000 -- (-1008.296) (-1008.558) [-1009.662] (-1007.375) * [-1007.551] (-1009.636) (-1007.022) (-1008.844) -- 0:00:46
      219500 -- [-1008.335] (-1008.713) (-1010.090) (-1007.641) * [-1007.696] (-1010.886) (-1010.881) (-1008.699) -- 0:00:46
      220000 -- [-1008.251] (-1011.035) (-1010.691) (-1011.792) * [-1012.428] (-1009.434) (-1013.277) (-1007.758) -- 0:00:49

      Average standard deviation of split frequencies: 0.014847

      220500 -- (-1009.003) [-1008.689] (-1009.520) (-1009.945) * (-1010.212) [-1007.947] (-1013.264) (-1009.510) -- 0:00:49
      221000 -- [-1010.554] (-1009.349) (-1010.700) (-1010.964) * (-1007.811) (-1007.748) [-1007.801] (-1013.623) -- 0:00:49
      221500 -- (-1012.638) [-1007.802] (-1007.819) (-1009.426) * (-1006.566) (-1007.221) [-1008.294] (-1011.563) -- 0:00:49
      222000 -- (-1007.646) [-1007.815] (-1010.297) (-1010.096) * (-1006.794) (-1014.014) [-1010.565] (-1007.565) -- 0:00:49
      222500 -- (-1008.542) [-1009.044] (-1010.493) (-1009.936) * (-1010.042) [-1009.475] (-1008.619) (-1009.525) -- 0:00:48
      223000 -- (-1009.527) (-1010.210) (-1013.809) [-1008.296] * (-1007.949) [-1008.808] (-1008.737) (-1008.466) -- 0:00:48
      223500 -- (-1009.953) (-1012.757) [-1008.791] (-1008.655) * (-1007.233) (-1007.413) [-1010.666] (-1010.528) -- 0:00:48
      224000 -- (-1011.500) (-1011.900) [-1007.589] (-1009.671) * (-1008.121) (-1009.207) (-1013.053) [-1007.614] -- 0:00:48
      224500 -- (-1008.820) (-1011.096) [-1007.196] (-1009.067) * (-1012.405) (-1009.697) (-1009.877) [-1008.216] -- 0:00:48
      225000 -- [-1010.538] (-1010.963) (-1012.172) (-1009.272) * (-1008.561) (-1017.956) (-1010.149) [-1010.121] -- 0:00:48

      Average standard deviation of split frequencies: 0.014810

      225500 -- [-1007.463] (-1008.043) (-1009.973) (-1010.039) * [-1007.830] (-1011.265) (-1012.775) (-1009.084) -- 0:00:48
      226000 -- (-1010.958) (-1009.277) [-1012.745] (-1007.098) * (-1008.800) (-1009.043) (-1009.539) [-1008.489] -- 0:00:47
      226500 -- (-1010.955) [-1009.150] (-1009.574) (-1007.097) * (-1007.804) (-1008.409) (-1007.816) [-1007.473] -- 0:00:47
      227000 -- (-1014.792) (-1008.271) [-1009.355] (-1009.680) * (-1010.852) [-1009.072] (-1008.219) (-1006.793) -- 0:00:47
      227500 -- (-1015.026) (-1009.018) [-1007.499] (-1010.490) * (-1010.856) (-1011.096) (-1008.734) [-1007.423] -- 0:00:47
      228000 -- [-1010.986] (-1007.227) (-1008.120) (-1010.629) * (-1008.896) (-1013.371) [-1009.084] (-1009.337) -- 0:00:47
      228500 -- [-1009.280] (-1007.224) (-1009.112) (-1009.725) * (-1008.972) (-1013.970) [-1010.448] (-1012.348) -- 0:00:47
      229000 -- (-1006.479) (-1006.813) (-1011.339) [-1009.387] * (-1008.200) [-1007.650] (-1012.401) (-1008.640) -- 0:00:47
      229500 -- [-1006.476] (-1006.888) (-1012.601) (-1008.827) * (-1009.489) (-1009.073) [-1007.928] (-1012.199) -- 0:00:47
      230000 -- [-1006.876] (-1012.461) (-1007.629) (-1008.709) * (-1008.458) [-1010.977] (-1014.227) (-1011.272) -- 0:00:46

      Average standard deviation of split frequencies: 0.012603

      230500 -- (-1008.596) (-1007.419) (-1007.619) [-1007.374] * (-1011.156) (-1007.806) [-1009.112] (-1007.348) -- 0:00:46
      231000 -- (-1007.269) (-1007.866) [-1007.952] (-1015.405) * (-1009.364) [-1007.028] (-1009.545) (-1009.743) -- 0:00:46
      231500 -- [-1006.760] (-1009.866) (-1007.577) (-1009.924) * (-1008.502) [-1007.308] (-1007.970) (-1008.169) -- 0:00:46
      232000 -- (-1008.027) [-1009.896] (-1007.581) (-1007.355) * (-1007.178) (-1011.863) (-1011.132) [-1008.329] -- 0:00:46
      232500 -- [-1007.518] (-1011.383) (-1010.942) (-1009.311) * (-1007.571) (-1007.670) (-1007.815) [-1008.481] -- 0:00:46
      233000 -- (-1012.890) (-1009.050) [-1008.903] (-1008.542) * (-1007.201) (-1010.456) (-1010.419) [-1008.151] -- 0:00:46
      233500 -- (-1009.441) (-1009.430) [-1007.746] (-1008.647) * [-1007.910] (-1008.660) (-1012.397) (-1007.979) -- 0:00:45
      234000 -- (-1009.608) (-1010.284) [-1007.054] (-1008.589) * (-1008.608) (-1009.328) (-1011.168) [-1011.314] -- 0:00:45
      234500 -- [-1009.094] (-1008.784) (-1008.507) (-1007.605) * (-1009.388) [-1007.147] (-1008.229) (-1012.951) -- 0:00:45
      235000 -- (-1008.169) [-1011.982] (-1012.343) (-1007.778) * (-1010.040) (-1006.855) [-1007.292] (-1012.896) -- 0:00:45

      Average standard deviation of split frequencies: 0.012651

      235500 -- [-1007.784] (-1008.963) (-1009.455) (-1011.004) * (-1012.230) (-1007.722) [-1007.348] (-1012.241) -- 0:00:45
      236000 -- (-1008.864) (-1009.670) [-1009.844] (-1009.971) * (-1009.465) (-1007.647) [-1007.873] (-1012.299) -- 0:00:48
      236500 -- [-1006.653] (-1008.444) (-1010.726) (-1009.294) * [-1008.145] (-1012.706) (-1007.212) (-1009.880) -- 0:00:48
      237000 -- (-1008.625) [-1008.264] (-1011.300) (-1007.882) * (-1007.480) (-1016.900) [-1007.786] (-1010.430) -- 0:00:48
      237500 -- (-1011.126) (-1007.322) [-1008.482] (-1009.065) * (-1007.921) [-1010.796] (-1007.167) (-1009.601) -- 0:00:48
      238000 -- [-1006.985] (-1010.446) (-1009.333) (-1006.891) * (-1009.456) [-1010.042] (-1008.069) (-1008.610) -- 0:00:48
      238500 -- (-1012.594) [-1007.828] (-1012.754) (-1006.826) * [-1007.520] (-1009.562) (-1008.882) (-1009.082) -- 0:00:47
      239000 -- (-1007.551) (-1009.427) [-1010.926] (-1007.764) * (-1010.536) (-1009.671) (-1008.842) [-1008.594] -- 0:00:47
      239500 -- (-1008.634) [-1007.540] (-1008.573) (-1007.761) * (-1009.436) [-1008.079] (-1009.706) (-1014.176) -- 0:00:47
      240000 -- (-1008.298) (-1006.964) (-1010.938) [-1008.518] * (-1011.802) (-1009.574) [-1007.541] (-1010.471) -- 0:00:47

      Average standard deviation of split frequencies: 0.013820

      240500 -- (-1006.814) (-1010.717) (-1008.258) [-1008.292] * (-1008.969) (-1011.049) [-1008.189] (-1007.712) -- 0:00:47
      241000 -- [-1007.525] (-1011.112) (-1008.688) (-1008.799) * (-1009.319) (-1009.650) [-1007.378] (-1009.973) -- 0:00:47
      241500 -- [-1008.029] (-1010.696) (-1009.146) (-1009.595) * (-1007.406) (-1009.940) [-1008.267] (-1007.922) -- 0:00:47
      242000 -- (-1009.921) (-1007.326) [-1008.803] (-1010.191) * (-1007.838) (-1007.829) (-1006.837) [-1011.655] -- 0:00:46
      242500 -- (-1007.207) (-1007.394) (-1010.356) [-1007.809] * [-1007.373] (-1007.898) (-1009.089) (-1014.420) -- 0:00:46
      243000 -- [-1007.111] (-1007.270) (-1010.676) (-1007.984) * (-1009.200) (-1009.199) (-1007.646) [-1009.511] -- 0:00:46
      243500 -- [-1007.743] (-1007.237) (-1007.161) (-1010.201) * [-1009.459] (-1008.947) (-1009.791) (-1007.829) -- 0:00:46
      244000 -- [-1007.576] (-1009.299) (-1008.260) (-1008.171) * (-1006.690) (-1007.527) [-1011.280] (-1009.553) -- 0:00:46
      244500 -- (-1007.916) [-1007.293] (-1008.566) (-1007.986) * (-1007.161) (-1007.716) [-1008.679] (-1009.014) -- 0:00:46
      245000 -- [-1010.042] (-1008.014) (-1006.436) (-1010.252) * (-1011.665) (-1011.193) [-1008.301] (-1006.687) -- 0:00:46

      Average standard deviation of split frequencies: 0.013011

      245500 -- (-1007.761) (-1006.947) [-1007.472] (-1011.660) * [-1007.019] (-1008.072) (-1007.000) (-1006.630) -- 0:00:46
      246000 -- [-1008.956] (-1007.483) (-1007.507) (-1010.189) * [-1011.293] (-1009.255) (-1006.778) (-1006.925) -- 0:00:45
      246500 -- (-1011.179) (-1007.588) [-1006.889] (-1016.085) * (-1011.690) [-1008.285] (-1008.324) (-1007.622) -- 0:00:45
      247000 -- (-1012.733) [-1010.066] (-1009.398) (-1007.133) * (-1009.944) (-1010.481) [-1011.839] (-1010.498) -- 0:00:45
      247500 -- (-1011.319) (-1008.828) (-1008.816) [-1008.694] * (-1010.951) [-1008.852] (-1006.719) (-1008.558) -- 0:00:45
      248000 -- (-1006.752) [-1007.878] (-1009.152) (-1007.053) * (-1008.492) (-1007.296) [-1008.101] (-1009.177) -- 0:00:45
      248500 -- (-1007.763) (-1007.411) [-1008.338] (-1009.894) * [-1007.486] (-1011.897) (-1008.413) (-1014.667) -- 0:00:45
      249000 -- [-1007.268] (-1009.132) (-1008.142) (-1010.622) * [-1009.998] (-1007.834) (-1009.168) (-1013.877) -- 0:00:45
      249500 -- (-1007.481) [-1008.037] (-1009.057) (-1007.241) * [-1008.000] (-1008.148) (-1008.645) (-1008.349) -- 0:00:45
      250000 -- (-1010.445) (-1009.441) [-1009.539] (-1008.855) * (-1008.045) (-1008.541) (-1008.449) [-1008.244] -- 0:00:45

      Average standard deviation of split frequencies: 0.012669

      250500 -- (-1007.987) (-1018.033) (-1008.520) [-1009.242] * [-1009.239] (-1008.509) (-1010.266) (-1011.026) -- 0:00:44
      251000 -- [-1007.377] (-1008.396) (-1011.420) (-1008.084) * (-1008.501) (-1010.153) [-1011.827] (-1010.819) -- 0:00:44
      251500 -- (-1007.619) (-1009.892) [-1009.607] (-1008.091) * (-1007.406) (-1007.421) (-1011.571) [-1010.339] -- 0:00:44
      252000 -- (-1007.424) (-1014.742) [-1007.859] (-1008.170) * (-1007.378) (-1007.162) (-1008.244) [-1007.350] -- 0:00:44
      252500 -- [-1008.394] (-1012.325) (-1008.686) (-1008.000) * (-1007.223) (-1006.778) (-1010.550) [-1007.408] -- 0:00:47
      253000 -- (-1008.074) (-1010.926) [-1011.284] (-1007.131) * (-1009.526) (-1018.934) (-1007.771) [-1008.822] -- 0:00:47
      253500 -- [-1010.448] (-1008.915) (-1008.202) (-1007.466) * (-1009.762) (-1012.248) (-1008.880) [-1007.917] -- 0:00:47
      254000 -- (-1008.279) (-1008.247) (-1009.229) [-1008.669] * (-1008.412) [-1011.237] (-1012.298) (-1008.806) -- 0:00:46
      254500 -- (-1008.460) [-1008.362] (-1007.970) (-1013.247) * (-1010.877) (-1010.839) [-1007.862] (-1006.646) -- 0:00:46
      255000 -- (-1011.904) [-1008.736] (-1007.936) (-1009.229) * (-1011.163) [-1008.779] (-1012.294) (-1009.387) -- 0:00:46

      Average standard deviation of split frequencies: 0.013627

      255500 -- (-1008.780) [-1009.905] (-1010.306) (-1009.193) * (-1010.630) (-1008.927) [-1007.057] (-1010.420) -- 0:00:46
      256000 -- [-1010.190] (-1013.087) (-1007.981) (-1009.737) * (-1009.354) (-1011.126) (-1007.961) [-1008.193] -- 0:00:46
      256500 -- [-1007.766] (-1009.528) (-1009.061) (-1011.813) * (-1008.527) [-1008.714] (-1008.041) (-1008.167) -- 0:00:46
      257000 -- (-1009.193) (-1009.127) [-1013.101] (-1009.756) * (-1009.263) [-1006.945] (-1007.349) (-1008.204) -- 0:00:46
      257500 -- (-1011.194) (-1012.780) [-1008.094] (-1007.758) * (-1009.276) (-1007.355) (-1009.197) [-1010.010] -- 0:00:46
      258000 -- (-1007.787) (-1011.670) [-1008.772] (-1006.755) * (-1008.465) (-1007.891) (-1012.781) [-1009.866] -- 0:00:46
      258500 -- [-1009.046] (-1008.740) (-1008.228) (-1007.870) * (-1009.521) [-1009.004] (-1011.674) (-1012.466) -- 0:00:45
      259000 -- (-1009.293) (-1013.040) [-1007.880] (-1010.217) * (-1012.101) [-1010.381] (-1016.894) (-1013.505) -- 0:00:45
      259500 -- (-1009.714) (-1011.604) (-1007.932) [-1009.240] * [-1009.557] (-1009.400) (-1014.420) (-1008.277) -- 0:00:45
      260000 -- (-1008.446) (-1011.207) [-1010.382] (-1008.473) * (-1008.967) [-1008.220] (-1009.482) (-1007.086) -- 0:00:45

      Average standard deviation of split frequencies: 0.013706

      260500 -- (-1007.265) (-1009.394) [-1010.514] (-1008.926) * (-1009.990) [-1008.964] (-1010.800) (-1008.379) -- 0:00:45
      261000 -- (-1007.481) [-1009.381] (-1008.451) (-1008.634) * (-1010.245) (-1012.957) [-1010.637] (-1009.154) -- 0:00:45
      261500 -- (-1009.696) (-1008.516) [-1009.441] (-1009.640) * (-1008.863) (-1011.783) [-1008.583] (-1012.050) -- 0:00:45
      262000 -- (-1009.304) [-1009.888] (-1007.575) (-1009.206) * (-1009.404) (-1011.923) (-1007.601) [-1008.100] -- 0:00:45
      262500 -- (-1009.701) (-1013.615) [-1009.449] (-1007.975) * (-1009.162) (-1014.658) [-1008.180] (-1008.061) -- 0:00:44
      263000 -- (-1008.484) (-1011.916) (-1008.365) [-1011.120] * (-1009.780) (-1011.863) [-1009.024] (-1011.926) -- 0:00:44
      263500 -- (-1009.758) (-1008.872) (-1009.469) [-1007.792] * [-1009.116] (-1009.568) (-1008.403) (-1009.569) -- 0:00:44
      264000 -- (-1011.026) (-1008.710) (-1009.149) [-1008.601] * (-1012.190) [-1010.912] (-1010.069) (-1007.821) -- 0:00:44
      264500 -- (-1008.421) (-1007.478) [-1008.311] (-1009.479) * [-1009.761] (-1010.369) (-1008.054) (-1008.295) -- 0:00:44
      265000 -- [-1009.854] (-1007.994) (-1009.067) (-1011.668) * (-1010.034) [-1011.904] (-1012.463) (-1014.455) -- 0:00:44

      Average standard deviation of split frequencies: 0.012494

      265500 -- [-1008.798] (-1010.750) (-1006.960) (-1008.098) * (-1006.867) [-1012.624] (-1008.263) (-1013.790) -- 0:00:44
      266000 -- [-1009.286] (-1009.416) (-1007.374) (-1010.078) * (-1007.997) (-1008.620) (-1010.381) [-1010.631] -- 0:00:44
      266500 -- (-1011.232) (-1008.642) [-1009.439] (-1010.359) * (-1009.910) (-1008.713) (-1008.788) [-1009.303] -- 0:00:44
      267000 -- (-1009.308) (-1008.459) (-1009.509) [-1008.421] * (-1008.372) (-1008.109) (-1008.250) [-1009.099] -- 0:00:43
      267500 -- [-1008.702] (-1007.401) (-1008.401) (-1015.600) * [-1009.540] (-1007.969) (-1008.028) (-1009.669) -- 0:00:43
      268000 -- (-1010.726) (-1007.394) (-1008.980) [-1009.133] * [-1008.234] (-1009.873) (-1007.408) (-1007.175) -- 0:00:43
      268500 -- (-1008.094) (-1007.434) (-1009.328) [-1010.438] * (-1010.025) (-1011.170) (-1009.975) [-1007.831] -- 0:00:46
      269000 -- (-1008.967) (-1010.739) (-1007.966) [-1008.425] * (-1009.456) (-1010.767) (-1014.491) [-1012.759] -- 0:00:46
      269500 -- [-1010.506] (-1009.480) (-1009.411) (-1007.550) * [-1010.830] (-1011.903) (-1007.160) (-1021.016) -- 0:00:46
      270000 -- (-1012.202) (-1010.310) (-1007.082) [-1006.858] * (-1012.299) (-1009.209) [-1007.886] (-1011.459) -- 0:00:45

      Average standard deviation of split frequencies: 0.012975

      270500 -- [-1011.081] (-1010.123) (-1007.364) (-1007.150) * (-1009.044) (-1008.971) [-1007.902] (-1009.047) -- 0:00:45
      271000 -- (-1012.948) (-1009.669) (-1009.045) [-1010.158] * (-1009.598) (-1014.915) (-1009.945) [-1008.673] -- 0:00:45
      271500 -- [-1011.952] (-1009.742) (-1008.787) (-1016.658) * [-1009.113] (-1009.931) (-1008.260) (-1009.050) -- 0:00:45
      272000 -- (-1017.174) [-1013.874] (-1006.684) (-1015.428) * (-1006.826) [-1009.665] (-1011.321) (-1008.491) -- 0:00:45
      272500 -- (-1012.064) (-1008.663) (-1007.775) [-1011.136] * (-1007.318) [-1007.473] (-1007.840) (-1009.945) -- 0:00:45
      273000 -- (-1008.251) (-1008.667) (-1006.743) [-1009.192] * (-1013.368) (-1007.187) (-1008.027) [-1007.733] -- 0:00:45
      273500 -- (-1009.746) (-1009.871) (-1007.614) [-1010.905] * (-1008.996) (-1009.345) [-1007.331] (-1009.166) -- 0:00:45
      274000 -- [-1008.077] (-1008.815) (-1008.610) (-1009.456) * (-1011.865) (-1010.088) [-1007.820] (-1008.753) -- 0:00:45
      274500 -- (-1017.303) (-1009.297) [-1009.472] (-1010.472) * (-1009.662) [-1009.783] (-1010.602) (-1010.042) -- 0:00:44
      275000 -- (-1008.886) (-1010.523) (-1015.801) [-1006.984] * [-1010.337] (-1008.131) (-1011.846) (-1009.398) -- 0:00:44

      Average standard deviation of split frequencies: 0.012495

      275500 -- (-1008.220) [-1009.965] (-1008.208) (-1007.905) * (-1008.041) (-1007.740) [-1007.471] (-1008.025) -- 0:00:44
      276000 -- (-1007.955) (-1013.946) [-1008.342] (-1008.154) * (-1008.377) (-1009.727) [-1007.052] (-1009.273) -- 0:00:44
      276500 -- (-1007.970) [-1007.173] (-1008.574) (-1008.936) * (-1007.838) [-1009.438] (-1010.444) (-1007.961) -- 0:00:44
      277000 -- (-1009.614) (-1009.588) (-1011.664) [-1006.921] * (-1008.038) [-1009.554] (-1007.382) (-1009.579) -- 0:00:44
      277500 -- (-1010.479) (-1008.908) (-1009.191) [-1006.952] * (-1007.882) (-1011.140) [-1013.556] (-1008.418) -- 0:00:44
      278000 -- (-1010.014) [-1007.457] (-1008.370) (-1006.722) * (-1010.199) (-1007.045) (-1009.157) [-1007.989] -- 0:00:44
      278500 -- (-1007.567) (-1007.792) (-1010.280) [-1008.141] * (-1009.234) (-1007.811) [-1008.221] (-1009.031) -- 0:00:44
      279000 -- (-1008.207) (-1008.422) (-1009.353) [-1009.389] * (-1008.804) (-1008.870) (-1008.534) [-1008.254] -- 0:00:43
      279500 -- (-1008.413) (-1006.847) [-1010.225] (-1014.139) * (-1012.376) [-1007.304] (-1009.705) (-1009.857) -- 0:00:43
      280000 -- [-1008.989] (-1006.958) (-1010.744) (-1015.056) * (-1012.931) (-1009.079) (-1008.338) [-1009.187] -- 0:00:43

      Average standard deviation of split frequencies: 0.013343

      280500 -- [-1006.755] (-1007.331) (-1008.988) (-1012.402) * (-1010.091) (-1007.947) (-1008.302) [-1012.191] -- 0:00:43
      281000 -- (-1007.456) (-1007.853) (-1010.106) [-1010.307] * (-1009.532) (-1008.279) (-1013.486) [-1008.481] -- 0:00:43
      281500 -- (-1012.488) [-1007.472] (-1007.936) (-1007.374) * [-1008.568] (-1009.189) (-1009.341) (-1009.876) -- 0:00:45
      282000 -- [-1009.816] (-1008.567) (-1006.764) (-1009.425) * (-1008.973) [-1009.478] (-1010.353) (-1009.823) -- 0:00:45
      282500 -- (-1008.649) (-1008.892) [-1008.158] (-1015.097) * (-1009.754) (-1010.201) [-1008.214] (-1007.180) -- 0:00:45
      283000 -- (-1012.368) (-1010.885) [-1008.153] (-1013.210) * (-1008.189) (-1011.760) [-1008.166] (-1007.983) -- 0:00:45
      283500 -- (-1013.172) (-1011.310) [-1009.872] (-1008.915) * [-1008.064] (-1013.269) (-1009.425) (-1007.114) -- 0:00:45
      284000 -- (-1012.951) (-1008.766) [-1009.390] (-1007.467) * (-1007.214) (-1008.810) (-1006.663) [-1009.599] -- 0:00:45
      284500 -- (-1010.637) [-1009.662] (-1010.577) (-1009.153) * (-1008.063) (-1015.747) (-1013.586) [-1008.239] -- 0:00:45
      285000 -- (-1010.814) (-1009.098) (-1009.556) [-1007.276] * (-1006.879) (-1011.922) (-1011.576) [-1010.299] -- 0:00:45

      Average standard deviation of split frequencies: 0.013269

      285500 -- [-1011.149] (-1008.539) (-1012.476) (-1010.096) * [-1009.842] (-1015.703) (-1011.598) (-1010.317) -- 0:00:45
      286000 -- (-1008.060) [-1007.977] (-1011.871) (-1011.144) * (-1007.849) (-1008.598) [-1009.065] (-1008.776) -- 0:00:44
      286500 -- (-1008.369) (-1007.969) [-1009.432] (-1009.301) * (-1007.268) [-1006.973] (-1009.472) (-1009.015) -- 0:00:44
      287000 -- (-1014.717) (-1006.839) (-1010.205) [-1008.533] * (-1014.645) (-1007.908) (-1009.307) [-1008.564] -- 0:00:44
      287500 -- (-1012.310) [-1007.052] (-1008.634) (-1009.859) * (-1014.118) (-1009.489) [-1008.807] (-1009.194) -- 0:00:44
      288000 -- (-1007.974) [-1007.246] (-1008.292) (-1012.351) * (-1007.891) [-1008.573] (-1007.407) (-1009.782) -- 0:00:44
      288500 -- [-1012.113] (-1008.763) (-1008.911) (-1007.469) * (-1007.439) [-1008.571] (-1006.760) (-1007.087) -- 0:00:44
      289000 -- (-1010.998) (-1009.234) (-1008.595) [-1008.708] * (-1010.173) [-1008.485] (-1007.744) (-1006.836) -- 0:00:44
      289500 -- (-1010.059) (-1009.941) (-1014.897) [-1008.386] * (-1008.719) (-1009.515) [-1008.433] (-1010.957) -- 0:00:44
      290000 -- (-1007.517) [-1007.400] (-1013.774) (-1010.753) * (-1008.878) [-1009.156] (-1007.363) (-1009.853) -- 0:00:44

      Average standard deviation of split frequencies: 0.012614

      290500 -- (-1008.660) [-1006.917] (-1008.197) (-1008.532) * (-1008.491) (-1011.313) [-1011.026] (-1013.043) -- 0:00:43
      291000 -- [-1009.911] (-1009.328) (-1007.465) (-1008.412) * (-1008.203) (-1009.738) (-1007.589) [-1009.770] -- 0:00:43
      291500 -- [-1008.496] (-1006.930) (-1009.293) (-1010.442) * (-1010.056) (-1008.330) (-1007.791) [-1006.575] -- 0:00:43
      292000 -- (-1009.858) [-1007.964] (-1010.316) (-1008.227) * [-1016.650] (-1007.689) (-1010.998) (-1009.419) -- 0:00:43
      292500 -- (-1012.353) [-1008.180] (-1011.535) (-1008.707) * (-1012.011) (-1009.406) (-1007.246) [-1006.502] -- 0:00:43
      293000 -- (-1007.880) (-1008.072) (-1009.738) [-1008.536] * (-1009.198) (-1011.160) (-1010.565) [-1007.579] -- 0:00:43
      293500 -- [-1006.593] (-1006.866) (-1008.419) (-1012.173) * (-1008.835) [-1010.518] (-1014.076) (-1007.578) -- 0:00:43
      294000 -- (-1012.905) [-1007.504] (-1008.713) (-1012.069) * (-1009.199) [-1012.428] (-1013.404) (-1009.191) -- 0:00:43
      294500 -- [-1008.735] (-1009.997) (-1011.691) (-1006.991) * (-1008.639) (-1011.432) (-1011.135) [-1009.169] -- 0:00:43
      295000 -- (-1011.427) (-1010.314) [-1010.737] (-1007.802) * [-1009.857] (-1008.929) (-1007.245) (-1011.377) -- 0:00:43

      Average standard deviation of split frequencies: 0.011944

      295500 -- (-1011.708) (-1011.025) (-1008.993) [-1007.805] * (-1007.919) (-1008.262) (-1012.459) [-1010.170] -- 0:00:42
      296000 -- (-1009.887) (-1008.079) (-1010.669) [-1007.422] * (-1008.192) [-1010.898] (-1009.438) (-1009.372) -- 0:00:42
      296500 -- (-1009.103) [-1008.308] (-1014.712) (-1008.462) * [-1014.252] (-1008.411) (-1009.559) (-1012.221) -- 0:00:45
      297000 -- [-1008.198] (-1008.581) (-1007.979) (-1008.832) * (-1009.241) (-1008.944) [-1007.509] (-1009.905) -- 0:00:44
      297500 -- (-1010.862) [-1007.897] (-1009.698) (-1010.769) * (-1013.645) (-1007.537) [-1008.038] (-1007.673) -- 0:00:44
      298000 -- [-1012.064] (-1009.251) (-1012.058) (-1007.173) * (-1007.903) (-1010.938) (-1007.954) [-1007.980] -- 0:00:44
      298500 -- (-1008.121) [-1008.827] (-1009.937) (-1015.388) * (-1007.842) [-1008.383] (-1008.091) (-1008.015) -- 0:00:44
      299000 -- (-1009.526) [-1009.302] (-1013.645) (-1010.187) * (-1007.686) (-1007.736) (-1013.213) [-1009.349] -- 0:00:44
      299500 -- [-1009.751] (-1014.050) (-1006.892) (-1013.466) * (-1007.898) [-1008.630] (-1009.919) (-1013.655) -- 0:00:44
      300000 -- (-1009.691) [-1017.025] (-1010.798) (-1013.172) * [-1007.023] (-1009.221) (-1012.965) (-1009.378) -- 0:00:44

      Average standard deviation of split frequencies: 0.012194

      300500 -- (-1014.070) [-1012.629] (-1010.564) (-1010.281) * (-1007.737) (-1013.664) (-1010.928) [-1007.257] -- 0:00:44
      301000 -- (-1012.208) (-1011.851) [-1010.502] (-1008.178) * (-1010.020) (-1010.816) (-1008.563) [-1007.376] -- 0:00:44
      301500 -- (-1008.462) (-1010.939) [-1009.197] (-1009.128) * (-1011.086) [-1006.952] (-1011.373) (-1006.854) -- 0:00:44
      302000 -- (-1011.636) (-1010.051) [-1008.264] (-1009.604) * (-1011.847) (-1009.016) (-1016.373) [-1007.195] -- 0:00:43
      302500 -- (-1011.832) [-1009.463] (-1009.062) (-1008.778) * (-1010.251) [-1009.555] (-1011.801) (-1010.138) -- 0:00:43
      303000 -- (-1012.009) (-1009.745) (-1010.106) [-1006.792] * (-1009.909) [-1012.097] (-1014.533) (-1011.648) -- 0:00:43
      303500 -- [-1009.160] (-1009.226) (-1011.518) (-1007.168) * (-1007.744) [-1008.598] (-1011.627) (-1009.274) -- 0:00:43
      304000 -- (-1008.763) (-1009.114) (-1008.473) [-1009.935] * (-1009.093) [-1009.621] (-1010.267) (-1011.667) -- 0:00:43
      304500 -- (-1012.680) [-1008.579] (-1008.583) (-1008.219) * (-1009.253) (-1013.179) [-1014.311] (-1010.290) -- 0:00:43
      305000 -- (-1010.919) (-1008.554) [-1008.663] (-1013.671) * [-1008.292] (-1010.793) (-1009.160) (-1007.340) -- 0:00:43

      Average standard deviation of split frequencies: 0.011896

      305500 -- (-1011.600) (-1008.549) [-1009.674] (-1008.248) * [-1006.645] (-1011.273) (-1008.807) (-1012.226) -- 0:00:43
      306000 -- (-1009.114) (-1009.186) [-1008.774] (-1008.794) * (-1006.561) [-1007.477] (-1009.215) (-1013.461) -- 0:00:43
      306500 -- (-1007.671) (-1010.054) (-1013.633) [-1007.909] * (-1008.864) (-1009.784) [-1008.232] (-1010.579) -- 0:00:42
      307000 -- (-1011.057) (-1012.887) (-1010.946) [-1007.119] * (-1011.944) (-1011.516) (-1010.575) [-1007.920] -- 0:00:42
      307500 -- (-1012.430) [-1007.828] (-1012.365) (-1009.775) * (-1007.911) [-1007.622] (-1008.199) (-1009.878) -- 0:00:42
      308000 -- [-1008.597] (-1015.074) (-1010.832) (-1007.691) * (-1007.500) (-1011.313) [-1008.178] (-1009.765) -- 0:00:42
      308500 -- (-1011.214) (-1012.328) [-1008.724] (-1009.342) * (-1008.607) (-1010.415) (-1008.818) [-1009.883] -- 0:00:42
      309000 -- (-1007.720) (-1008.142) [-1007.728] (-1010.842) * (-1007.458) (-1008.670) (-1013.784) [-1008.037] -- 0:00:42
      309500 -- (-1009.329) (-1011.239) (-1007.879) [-1008.344] * [-1007.166] (-1007.406) (-1011.131) (-1007.429) -- 0:00:44
      310000 -- [-1007.958] (-1006.565) (-1009.060) (-1009.907) * (-1006.861) (-1007.694) (-1011.491) [-1009.466] -- 0:00:44

      Average standard deviation of split frequencies: 0.011549

      310500 -- [-1007.451] (-1007.239) (-1007.505) (-1008.938) * (-1010.241) (-1011.551) (-1010.482) [-1008.308] -- 0:00:44
      311000 -- (-1009.222) [-1007.827] (-1008.219) (-1010.030) * (-1012.901) (-1009.925) [-1009.314] (-1009.030) -- 0:00:44
      311500 -- [-1007.739] (-1007.644) (-1010.606) (-1007.922) * [-1008.628] (-1009.091) (-1011.366) (-1008.240) -- 0:00:44
      312000 -- (-1006.607) (-1008.811) (-1008.490) [-1008.909] * [-1008.786] (-1012.109) (-1009.276) (-1007.793) -- 0:00:44
      312500 -- [-1006.861] (-1008.622) (-1007.456) (-1010.604) * (-1008.369) [-1007.721] (-1006.905) (-1008.006) -- 0:00:44
      313000 -- [-1008.519] (-1007.178) (-1008.310) (-1007.491) * (-1009.042) (-1010.323) (-1006.891) [-1007.471] -- 0:00:43
      313500 -- (-1007.073) (-1008.076) (-1010.250) [-1008.468] * (-1013.612) (-1008.150) [-1006.576] (-1011.728) -- 0:00:43
      314000 -- (-1008.379) (-1008.128) (-1008.887) [-1007.959] * (-1013.607) [-1010.044] (-1007.095) (-1009.664) -- 0:00:43
      314500 -- (-1008.022) (-1008.258) [-1010.305] (-1010.220) * (-1008.448) (-1009.476) [-1007.838] (-1008.595) -- 0:00:43
      315000 -- (-1007.687) [-1008.743] (-1013.017) (-1009.623) * (-1007.609) (-1007.348) [-1008.549] (-1010.607) -- 0:00:43

      Average standard deviation of split frequencies: 0.012183

      315500 -- (-1011.337) (-1011.120) [-1009.503] (-1008.219) * (-1007.844) [-1007.335] (-1014.374) (-1014.397) -- 0:00:43
      316000 -- (-1009.322) (-1010.646) [-1010.012] (-1008.220) * (-1007.539) [-1007.180] (-1013.122) (-1009.012) -- 0:00:43
      316500 -- [-1008.625] (-1012.698) (-1008.546) (-1007.769) * (-1009.019) (-1011.551) [-1007.909] (-1008.047) -- 0:00:43
      317000 -- (-1012.611) (-1009.719) [-1007.687] (-1006.971) * (-1011.693) (-1011.840) (-1011.052) [-1010.136] -- 0:00:43
      317500 -- (-1007.890) (-1010.406) (-1010.482) [-1007.823] * [-1010.414] (-1008.140) (-1015.960) (-1011.199) -- 0:00:42
      318000 -- (-1009.414) [-1008.622] (-1010.888) (-1010.796) * [-1012.298] (-1010.093) (-1014.348) (-1010.101) -- 0:00:42
      318500 -- (-1008.908) (-1009.116) [-1010.182] (-1008.434) * (-1009.482) (-1008.243) [-1009.374] (-1009.820) -- 0:00:42
      319000 -- (-1008.771) (-1008.395) [-1010.287] (-1008.466) * (-1007.145) [-1009.306] (-1007.958) (-1008.883) -- 0:00:42
      319500 -- (-1011.116) (-1011.901) [-1011.071] (-1009.150) * (-1011.281) [-1007.756] (-1009.737) (-1010.898) -- 0:00:42
      320000 -- (-1009.800) (-1011.677) (-1010.080) [-1010.782] * [-1009.583] (-1007.917) (-1007.640) (-1007.046) -- 0:00:42

      Average standard deviation of split frequencies: 0.012986

      320500 -- (-1007.738) (-1012.266) (-1011.775) [-1008.880] * (-1007.643) (-1007.584) [-1007.073] (-1007.017) -- 0:00:42
      321000 -- [-1007.850] (-1017.426) (-1013.740) (-1009.626) * [-1006.719] (-1010.679) (-1008.039) (-1007.179) -- 0:00:42
      321500 -- (-1006.718) (-1013.084) [-1015.223] (-1007.863) * (-1008.129) (-1007.607) [-1007.451] (-1017.013) -- 0:00:42
      322000 -- (-1006.829) (-1012.459) (-1008.911) [-1009.544] * (-1007.328) [-1008.575] (-1012.619) (-1014.964) -- 0:00:42
      322500 -- [-1008.945] (-1013.334) (-1010.322) (-1007.941) * (-1008.649) [-1011.568] (-1012.039) (-1013.144) -- 0:00:42
      323000 -- [-1009.448] (-1012.415) (-1010.381) (-1015.061) * (-1007.928) [-1009.607] (-1010.900) (-1009.221) -- 0:00:41
      323500 -- (-1009.733) (-1008.089) (-1007.545) [-1009.121] * (-1008.358) (-1007.397) [-1014.714] (-1007.948) -- 0:00:41
      324000 -- (-1008.551) [-1007.699] (-1006.911) (-1010.366) * (-1007.980) (-1009.730) [-1008.498] (-1009.869) -- 0:00:41
      324500 -- (-1010.264) (-1007.490) (-1007.340) [-1010.006] * (-1008.468) [-1007.957] (-1009.699) (-1013.217) -- 0:00:43
      325000 -- (-1007.401) [-1008.426] (-1006.882) (-1009.916) * [-1006.620] (-1009.546) (-1007.773) (-1008.940) -- 0:00:43

      Average standard deviation of split frequencies: 0.012613

      325500 -- [-1008.844] (-1008.291) (-1010.424) (-1010.200) * (-1007.880) [-1008.354] (-1007.311) (-1009.157) -- 0:00:43
      326000 -- (-1013.092) (-1009.590) (-1007.184) [-1006.977] * (-1008.446) (-1008.117) (-1006.925) [-1008.757] -- 0:00:43
      326500 -- (-1007.292) (-1006.877) [-1006.904] (-1008.742) * (-1009.438) [-1008.354] (-1008.822) (-1009.593) -- 0:00:43
      327000 -- (-1009.166) (-1010.777) (-1006.746) [-1010.691] * (-1008.079) (-1008.279) (-1008.373) [-1008.613] -- 0:00:43
      327500 -- (-1011.677) (-1008.461) [-1006.813] (-1010.753) * [-1009.408] (-1011.337) (-1010.500) (-1007.766) -- 0:00:43
      328000 -- [-1007.219] (-1008.189) (-1006.890) (-1010.807) * (-1007.106) (-1009.355) [-1009.625] (-1007.104) -- 0:00:43
      328500 -- (-1008.851) [-1007.661] (-1012.916) (-1009.777) * (-1006.993) [-1008.442] (-1008.821) (-1008.448) -- 0:00:42
      329000 -- [-1008.671] (-1008.337) (-1008.868) (-1009.113) * [-1008.529] (-1012.659) (-1007.897) (-1009.649) -- 0:00:42
      329500 -- (-1007.995) [-1008.592] (-1009.083) (-1007.505) * (-1007.445) (-1010.536) (-1007.843) [-1009.727] -- 0:00:42
      330000 -- (-1013.696) (-1007.358) [-1008.546] (-1007.625) * (-1010.072) [-1009.936] (-1008.904) (-1009.677) -- 0:00:42

      Average standard deviation of split frequencies: 0.012514

      330500 -- (-1012.866) (-1009.669) [-1007.421] (-1010.144) * (-1009.547) [-1008.700] (-1008.395) (-1010.926) -- 0:00:42
      331000 -- (-1009.616) (-1007.809) (-1007.932) [-1010.296] * (-1009.061) [-1008.647] (-1011.587) (-1007.916) -- 0:00:42
      331500 -- (-1009.401) [-1009.094] (-1009.473) (-1009.861) * (-1010.167) [-1010.870] (-1010.446) (-1008.920) -- 0:00:42
      332000 -- (-1006.785) [-1008.596] (-1010.767) (-1009.096) * (-1008.565) (-1013.466) [-1010.148] (-1009.403) -- 0:00:42
      332500 -- (-1006.785) (-1010.650) [-1008.874] (-1012.158) * (-1009.374) (-1013.649) [-1008.001] (-1009.367) -- 0:00:42
      333000 -- (-1007.187) (-1009.641) [-1007.934] (-1009.517) * (-1009.172) (-1010.108) [-1008.614] (-1006.766) -- 0:00:42
      333500 -- [-1010.291] (-1008.239) (-1007.879) (-1008.320) * (-1014.359) (-1009.319) (-1008.227) [-1007.308] -- 0:00:41
      334000 -- (-1012.731) (-1011.530) (-1008.079) [-1012.935] * (-1007.916) (-1013.220) [-1007.707] (-1006.994) -- 0:00:41
      334500 -- (-1007.565) (-1008.517) [-1009.503] (-1008.281) * [-1008.224] (-1011.120) (-1009.220) (-1009.886) -- 0:00:41
      335000 -- (-1007.127) (-1011.857) [-1007.041] (-1009.529) * [-1007.483] (-1007.667) (-1010.147) (-1006.617) -- 0:00:41

      Average standard deviation of split frequencies: 0.012861

      335500 -- (-1008.794) (-1012.104) [-1008.443] (-1009.001) * [-1009.260] (-1007.855) (-1010.058) (-1007.506) -- 0:00:41
      336000 -- (-1014.747) (-1014.132) [-1007.028] (-1008.438) * [-1010.420] (-1009.014) (-1008.998) (-1008.150) -- 0:00:41
      336500 -- (-1010.598) [-1008.104] (-1008.022) (-1010.004) * (-1007.867) [-1008.481] (-1010.444) (-1010.377) -- 0:00:41
      337000 -- (-1009.051) (-1010.429) [-1010.136] (-1008.515) * [-1007.813] (-1008.481) (-1012.850) (-1010.434) -- 0:00:41
      337500 -- [-1008.354] (-1007.982) (-1008.008) (-1009.953) * (-1008.245) (-1010.132) (-1009.269) [-1008.863] -- 0:00:41
      338000 -- (-1007.049) (-1008.971) (-1006.846) [-1008.746] * [-1009.631] (-1010.424) (-1009.992) (-1010.855) -- 0:00:41
      338500 -- (-1008.415) [-1009.313] (-1006.856) (-1008.815) * (-1009.085) (-1009.354) (-1008.006) [-1009.334] -- 0:00:41
      339000 -- (-1008.293) [-1009.406] (-1013.963) (-1009.447) * (-1009.378) [-1010.720] (-1009.858) (-1009.334) -- 0:00:40
      339500 -- (-1007.726) [-1010.645] (-1009.885) (-1011.647) * (-1007.622) [-1008.069] (-1010.370) (-1008.093) -- 0:00:42
      340000 -- (-1008.779) (-1010.050) [-1010.223] (-1010.798) * (-1007.241) (-1008.497) (-1007.505) [-1008.190] -- 0:00:42

      Average standard deviation of split frequencies: 0.013530

      340500 -- (-1007.435) (-1010.579) [-1009.609] (-1009.101) * [-1009.817] (-1008.639) (-1007.810) (-1011.716) -- 0:00:42
      341000 -- [-1007.912] (-1008.778) (-1008.040) (-1008.513) * [-1010.464] (-1009.593) (-1010.274) (-1012.857) -- 0:00:42
      341500 -- (-1006.983) (-1009.830) [-1007.536] (-1008.993) * [-1010.993] (-1008.906) (-1009.378) (-1012.787) -- 0:00:42
      342000 -- (-1009.299) (-1012.006) (-1008.155) [-1008.252] * [-1014.258] (-1009.359) (-1008.843) (-1007.823) -- 0:00:42
      342500 -- (-1007.398) (-1010.193) [-1008.023] (-1011.968) * (-1009.303) [-1008.522] (-1008.860) (-1007.500) -- 0:00:42
      343000 -- (-1011.387) (-1008.877) (-1008.403) [-1009.643] * (-1007.364) [-1010.846] (-1013.299) (-1007.567) -- 0:00:42
      343500 -- (-1009.884) (-1007.830) (-1008.274) [-1008.377] * [-1009.452] (-1012.744) (-1013.170) (-1007.219) -- 0:00:42
      344000 -- (-1007.906) (-1011.868) [-1008.918] (-1008.537) * [-1009.167] (-1012.792) (-1009.083) (-1009.265) -- 0:00:41
      344500 -- (-1009.697) (-1011.145) [-1007.283] (-1009.267) * [-1010.974] (-1008.439) (-1009.118) (-1007.838) -- 0:00:41
      345000 -- (-1010.186) [-1010.392] (-1008.092) (-1010.454) * (-1010.682) [-1009.676] (-1011.912) (-1008.440) -- 0:00:41

      Average standard deviation of split frequencies: 0.013776

      345500 -- (-1012.425) (-1010.006) (-1010.692) [-1008.156] * [-1007.492] (-1009.511) (-1012.046) (-1008.519) -- 0:00:41
      346000 -- [-1010.416] (-1009.640) (-1010.144) (-1010.698) * (-1008.529) [-1012.945] (-1011.715) (-1007.686) -- 0:00:41
      346500 -- [-1014.612] (-1013.940) (-1009.938) (-1007.003) * [-1010.628] (-1009.480) (-1009.777) (-1009.119) -- 0:00:41
      347000 -- (-1009.308) (-1015.119) (-1011.119) [-1006.576] * [-1007.338] (-1009.044) (-1010.311) (-1007.948) -- 0:00:41
      347500 -- (-1010.095) (-1008.765) [-1008.067] (-1011.958) * (-1008.690) (-1008.741) [-1008.997] (-1008.969) -- 0:00:41
      348000 -- (-1008.387) [-1009.454] (-1009.310) (-1007.021) * (-1007.108) (-1011.161) [-1009.024] (-1008.745) -- 0:00:41
      348500 -- [-1008.181] (-1011.856) (-1009.496) (-1009.474) * (-1007.115) (-1013.543) [-1009.456] (-1012.798) -- 0:00:41
      349000 -- (-1008.254) (-1011.221) (-1008.529) [-1007.583] * (-1007.584) [-1011.284] (-1008.844) (-1007.964) -- 0:00:41
      349500 -- (-1007.813) [-1009.180] (-1011.546) (-1009.757) * [-1010.255] (-1007.603) (-1011.730) (-1008.806) -- 0:00:40
      350000 -- (-1007.346) (-1008.632) (-1010.128) [-1010.186] * (-1011.874) (-1007.667) [-1007.393] (-1012.408) -- 0:00:40

      Average standard deviation of split frequencies: 0.014563

      350500 -- [-1008.004] (-1008.777) (-1013.972) (-1009.050) * (-1012.617) (-1008.285) (-1008.772) [-1013.789] -- 0:00:40
      351000 -- (-1008.935) [-1011.300] (-1013.352) (-1008.258) * (-1008.318) [-1008.616] (-1009.370) (-1008.631) -- 0:00:40
      351500 -- (-1007.878) (-1014.125) (-1007.844) [-1009.895] * [-1007.166] (-1006.960) (-1007.853) (-1010.490) -- 0:00:40
      352000 -- (-1009.315) (-1012.640) (-1008.729) [-1010.807] * [-1009.342] (-1007.216) (-1009.087) (-1014.261) -- 0:00:40
      352500 -- (-1007.335) (-1009.202) (-1007.437) [-1009.512] * (-1011.322) (-1010.619) [-1009.172] (-1012.424) -- 0:00:40
      353000 -- (-1008.862) [-1008.960] (-1009.703) (-1008.080) * (-1010.521) (-1010.612) [-1010.729] (-1011.167) -- 0:00:40
      353500 -- [-1008.101] (-1013.756) (-1007.163) (-1008.906) * [-1009.543] (-1012.920) (-1012.175) (-1008.676) -- 0:00:40
      354000 -- (-1008.594) [-1008.924] (-1008.856) (-1009.741) * (-1008.179) (-1010.052) (-1009.613) [-1008.099] -- 0:00:40
      354500 -- (-1008.551) (-1011.196) (-1006.922) [-1008.759] * (-1013.727) (-1007.589) (-1010.679) [-1010.056] -- 0:00:40
      355000 -- (-1010.444) [-1012.759] (-1014.727) (-1008.941) * (-1008.563) (-1010.325) [-1008.670] (-1008.418) -- 0:00:41

      Average standard deviation of split frequencies: 0.014488

      355500 -- (-1010.148) [-1008.949] (-1009.666) (-1007.319) * (-1009.019) (-1007.961) (-1008.555) [-1008.925] -- 0:00:41
      356000 -- (-1008.412) (-1010.447) (-1018.747) [-1007.244] * (-1007.900) (-1008.814) (-1007.934) [-1012.189] -- 0:00:41
      356500 -- (-1008.947) [-1007.178] (-1014.970) (-1008.566) * (-1012.093) (-1012.083) (-1011.868) [-1007.001] -- 0:00:41
      357000 -- (-1008.944) (-1007.219) (-1008.021) [-1008.195] * (-1007.849) [-1010.234] (-1008.176) (-1007.690) -- 0:00:41
      357500 -- (-1009.261) [-1008.377] (-1007.085) (-1011.227) * (-1010.237) (-1009.769) (-1008.689) [-1008.166] -- 0:00:41
      358000 -- (-1009.922) [-1007.631] (-1009.532) (-1010.169) * (-1007.634) [-1008.487] (-1008.055) (-1007.835) -- 0:00:41
      358500 -- (-1013.648) (-1007.355) [-1008.043] (-1007.646) * [-1013.336] (-1007.354) (-1011.561) (-1008.785) -- 0:00:41
      359000 -- (-1008.908) (-1008.015) [-1008.112] (-1009.277) * (-1011.348) (-1008.030) [-1009.971] (-1008.461) -- 0:00:41
      359500 -- (-1009.451) (-1007.100) [-1007.252] (-1010.943) * (-1011.031) [-1007.936] (-1008.573) (-1008.154) -- 0:00:40
      360000 -- (-1009.627) (-1008.090) [-1008.862] (-1010.931) * [-1010.635] (-1006.669) (-1013.198) (-1008.570) -- 0:00:40

      Average standard deviation of split frequencies: 0.014685

      360500 -- (-1009.395) (-1009.166) [-1008.483] (-1007.480) * (-1011.248) (-1006.554) (-1012.040) [-1008.461] -- 0:00:40
      361000 -- [-1009.544] (-1011.441) (-1010.452) (-1013.435) * (-1011.020) [-1007.812] (-1011.716) (-1009.706) -- 0:00:40
      361500 -- (-1013.385) (-1006.867) [-1008.514] (-1009.552) * (-1010.293) (-1007.148) [-1008.486] (-1007.774) -- 0:00:40
      362000 -- (-1007.655) (-1009.495) [-1007.248] (-1010.134) * (-1009.487) (-1007.981) (-1009.143) [-1008.421] -- 0:00:40
      362500 -- (-1008.899) (-1007.277) [-1007.199] (-1009.049) * (-1011.821) (-1008.236) (-1008.252) [-1007.704] -- 0:00:40
      363000 -- (-1008.689) [-1006.847] (-1010.022) (-1008.956) * (-1008.385) (-1007.910) [-1012.873] (-1011.871) -- 0:00:40
      363500 -- [-1008.051] (-1009.220) (-1010.394) (-1007.853) * (-1009.508) (-1008.046) [-1010.417] (-1014.739) -- 0:00:40
      364000 -- (-1008.623) (-1007.799) (-1011.646) [-1008.842] * (-1011.093) (-1010.591) [-1008.740] (-1008.569) -- 0:00:40
      364500 -- (-1012.488) (-1008.181) [-1010.913] (-1008.361) * (-1010.114) (-1015.642) [-1006.697] (-1008.569) -- 0:00:40
      365000 -- (-1010.965) (-1009.249) (-1011.409) [-1009.026] * (-1008.237) (-1008.236) [-1006.945] (-1008.471) -- 0:00:40

      Average standard deviation of split frequencies: 0.015027

      365500 -- (-1013.433) [-1009.643] (-1010.419) (-1012.299) * (-1012.441) [-1007.552] (-1008.433) (-1007.775) -- 0:00:39
      366000 -- (-1013.579) [-1008.494] (-1007.483) (-1008.532) * (-1009.390) (-1010.946) (-1008.041) [-1008.930] -- 0:00:39
      366500 -- (-1011.571) [-1010.161] (-1007.372) (-1008.393) * (-1010.261) (-1008.796) (-1010.473) [-1010.473] -- 0:00:39
      367000 -- [-1009.106] (-1008.344) (-1007.982) (-1010.718) * (-1008.090) (-1009.490) [-1010.810] (-1010.380) -- 0:00:39
      367500 -- (-1009.440) (-1010.006) [-1006.506] (-1007.666) * (-1011.258) (-1009.725) (-1007.548) [-1009.123] -- 0:00:39
      368000 -- (-1014.044) (-1007.048) [-1008.449] (-1010.220) * (-1008.795) (-1009.918) (-1009.847) [-1012.127] -- 0:00:39
      368500 -- (-1011.160) (-1007.048) [-1007.777] (-1012.694) * (-1011.707) (-1009.921) [-1011.415] (-1009.611) -- 0:00:39
      369000 -- (-1009.082) (-1008.108) [-1008.801] (-1009.561) * (-1008.782) (-1009.015) [-1007.758] (-1007.234) -- 0:00:39
      369500 -- (-1007.700) (-1007.808) (-1007.522) [-1008.588] * (-1009.806) (-1007.664) [-1007.818] (-1007.239) -- 0:00:39
      370000 -- (-1007.884) (-1011.702) [-1009.200] (-1009.485) * (-1007.693) (-1008.144) (-1008.448) [-1007.509] -- 0:00:39

      Average standard deviation of split frequencies: 0.014908

      370500 -- [-1009.342] (-1006.747) (-1009.295) (-1008.687) * (-1007.117) (-1010.732) [-1010.027] (-1012.378) -- 0:00:39
      371000 -- [-1010.235] (-1006.834) (-1009.766) (-1009.630) * (-1012.233) [-1009.698] (-1007.868) (-1009.676) -- 0:00:40
      371500 -- (-1009.680) [-1007.288] (-1007.394) (-1008.740) * (-1011.098) (-1008.425) (-1008.713) [-1009.578] -- 0:00:40
      372000 -- (-1011.421) (-1008.803) [-1008.073] (-1012.094) * (-1009.157) [-1007.149] (-1007.529) (-1009.832) -- 0:00:40
      372500 -- (-1009.661) (-1008.766) [-1008.340] (-1007.916) * (-1010.146) (-1009.909) (-1010.181) [-1011.209] -- 0:00:40
      373000 -- (-1009.322) (-1008.146) (-1008.036) [-1008.015] * (-1010.335) [-1009.016] (-1010.303) (-1008.634) -- 0:00:40
      373500 -- (-1010.193) [-1008.862] (-1009.365) (-1012.344) * (-1009.862) [-1010.340] (-1007.838) (-1008.552) -- 0:00:40
      374000 -- (-1012.853) (-1009.993) [-1007.971] (-1015.742) * (-1009.473) [-1009.972] (-1008.032) (-1007.731) -- 0:00:40
      374500 -- [-1008.182] (-1012.046) (-1008.166) (-1009.403) * (-1010.913) (-1009.708) [-1009.967] (-1010.302) -- 0:00:40
      375000 -- (-1009.661) [-1007.804] (-1007.497) (-1009.488) * (-1009.851) (-1010.142) (-1010.527) [-1007.727] -- 0:00:40

      Average standard deviation of split frequencies: 0.015184

      375500 -- [-1008.482] (-1009.748) (-1009.042) (-1012.925) * [-1008.808] (-1009.826) (-1007.795) (-1007.933) -- 0:00:39
      376000 -- (-1008.845) (-1010.542) (-1007.957) [-1007.965] * (-1008.683) [-1008.756] (-1008.398) (-1008.354) -- 0:00:39
      376500 -- (-1011.061) (-1008.823) (-1008.691) [-1010.328] * (-1008.799) (-1009.606) (-1007.598) [-1009.351] -- 0:00:39
      377000 -- [-1009.773] (-1009.893) (-1009.640) (-1009.738) * (-1008.769) [-1006.975] (-1010.708) (-1009.682) -- 0:00:39
      377500 -- [-1010.430] (-1010.726) (-1008.232) (-1011.143) * (-1008.958) (-1007.266) [-1013.712] (-1009.812) -- 0:00:39
      378000 -- (-1009.196) (-1007.502) (-1008.490) [-1008.320] * [-1009.283] (-1007.265) (-1007.463) (-1009.681) -- 0:00:39
      378500 -- (-1011.582) (-1008.506) (-1015.493) [-1008.136] * (-1009.715) (-1006.704) (-1008.583) [-1007.515] -- 0:00:39
      379000 -- [-1007.377] (-1011.491) (-1009.416) (-1008.787) * (-1012.735) (-1008.614) [-1009.785] (-1010.352) -- 0:00:39
      379500 -- (-1007.736) [-1011.004] (-1012.061) (-1009.584) * (-1010.039) (-1008.715) [-1008.280] (-1010.987) -- 0:00:39
      380000 -- (-1009.556) [-1010.700] (-1007.854) (-1011.443) * (-1008.925) (-1007.747) [-1012.513] (-1008.631) -- 0:00:39

      Average standard deviation of split frequencies: 0.015225

      380500 -- (-1009.157) [-1009.162] (-1015.083) (-1009.036) * (-1008.359) [-1008.831] (-1007.392) (-1009.408) -- 0:00:39
      381000 -- (-1008.996) [-1014.774] (-1007.541) (-1014.945) * [-1007.310] (-1007.413) (-1011.486) (-1007.608) -- 0:00:38
      381500 -- (-1011.203) (-1009.400) (-1008.204) [-1007.732] * (-1007.090) (-1011.847) [-1008.592] (-1010.311) -- 0:00:38
      382000 -- [-1007.470] (-1009.481) (-1013.145) (-1008.932) * (-1008.395) [-1007.048] (-1008.346) (-1008.536) -- 0:00:38
      382500 -- [-1007.925] (-1013.864) (-1008.751) (-1009.238) * [-1010.080] (-1006.965) (-1009.379) (-1008.230) -- 0:00:38
      383000 -- (-1008.194) [-1008.677] (-1007.739) (-1007.887) * (-1008.240) (-1007.186) (-1007.581) [-1006.790] -- 0:00:38
      383500 -- (-1009.049) (-1007.249) (-1009.369) [-1007.731] * (-1010.999) (-1009.335) (-1008.326) [-1009.999] -- 0:00:38
      384000 -- (-1007.121) [-1008.536] (-1010.834) (-1006.633) * [-1010.803] (-1008.826) (-1010.046) (-1011.006) -- 0:00:38
      384500 -- [-1007.735] (-1009.685) (-1011.636) (-1006.499) * (-1008.301) [-1007.605] (-1007.464) (-1011.162) -- 0:00:38
      385000 -- (-1007.315) [-1011.611] (-1016.251) (-1008.848) * (-1008.495) [-1009.669] (-1007.422) (-1011.159) -- 0:00:38

      Average standard deviation of split frequencies: 0.014859

      385500 -- [-1007.728] (-1010.968) (-1013.597) (-1012.234) * (-1007.453) (-1011.129) (-1007.525) [-1007.485] -- 0:00:38
      386000 -- (-1007.128) (-1009.831) [-1010.012] (-1008.760) * (-1008.984) (-1009.483) [-1007.426] (-1007.487) -- 0:00:38
      386500 -- (-1006.899) (-1009.590) [-1009.672] (-1008.508) * (-1008.236) [-1010.481] (-1009.392) (-1010.905) -- 0:00:38
      387000 -- (-1008.029) (-1008.206) (-1008.890) [-1007.060] * (-1007.356) (-1014.616) (-1011.481) [-1009.844] -- 0:00:38
      387500 -- (-1009.672) (-1007.762) [-1007.506] (-1012.903) * [-1008.874] (-1010.648) (-1008.374) (-1010.450) -- 0:00:39
      388000 -- (-1009.072) [-1010.176] (-1008.239) (-1008.840) * [-1007.406] (-1008.979) (-1008.031) (-1007.564) -- 0:00:39
      388500 -- (-1011.202) (-1010.318) (-1008.138) [-1010.660] * (-1006.693) [-1007.968] (-1008.317) (-1008.434) -- 0:00:39
      389000 -- (-1010.744) [-1006.718] (-1008.727) (-1008.780) * (-1007.366) (-1011.877) (-1009.964) [-1008.421] -- 0:00:39
      389500 -- [-1008.296] (-1010.610) (-1008.341) (-1010.750) * (-1008.712) (-1012.560) [-1009.315] (-1011.335) -- 0:00:39
      390000 -- [-1010.705] (-1010.146) (-1007.887) (-1014.897) * (-1007.636) (-1008.082) [-1007.787] (-1012.143) -- 0:00:39

      Average standard deviation of split frequencies: 0.014681

      390500 -- (-1008.819) (-1007.286) (-1008.511) [-1008.527] * (-1012.470) [-1008.436] (-1006.986) (-1007.489) -- 0:00:39
      391000 -- [-1007.545] (-1007.289) (-1008.117) (-1009.076) * (-1009.247) (-1008.048) (-1007.614) [-1007.824] -- 0:00:38
      391500 -- [-1008.188] (-1007.554) (-1008.121) (-1011.015) * (-1007.592) (-1009.407) (-1010.223) [-1007.126] -- 0:00:38
      392000 -- (-1011.439) [-1007.746] (-1007.371) (-1010.783) * (-1009.359) (-1009.513) [-1011.049] (-1007.754) -- 0:00:38
      392500 -- (-1012.843) (-1006.843) [-1010.524] (-1009.284) * (-1010.616) (-1011.223) (-1012.374) [-1008.928] -- 0:00:38
      393000 -- (-1012.773) (-1008.345) (-1009.467) [-1011.002] * (-1009.760) (-1011.220) (-1007.848) [-1007.678] -- 0:00:38
      393500 -- (-1012.493) [-1010.453] (-1008.481) (-1015.094) * (-1008.233) [-1008.736] (-1012.914) (-1014.625) -- 0:00:38
      394000 -- (-1011.758) (-1011.068) [-1008.806] (-1007.125) * (-1007.713) (-1008.634) [-1009.472] (-1008.827) -- 0:00:38
      394500 -- (-1011.496) (-1008.296) [-1006.746] (-1008.221) * (-1010.605) (-1009.218) [-1008.630] (-1011.565) -- 0:00:38
      395000 -- (-1008.822) (-1008.660) (-1008.727) [-1007.130] * (-1008.021) (-1009.385) [-1007.598] (-1013.820) -- 0:00:38

      Average standard deviation of split frequencies: 0.014915

      395500 -- (-1011.830) [-1007.598] (-1008.882) (-1010.103) * (-1011.752) (-1008.936) (-1009.147) [-1009.532] -- 0:00:38
      396000 -- (-1008.312) [-1008.824] (-1007.550) (-1007.188) * (-1009.212) [-1007.760] (-1008.268) (-1007.165) -- 0:00:38
      396500 -- (-1007.757) [-1008.316] (-1008.963) (-1007.685) * (-1009.119) (-1008.523) [-1009.192] (-1007.053) -- 0:00:38
      397000 -- (-1007.272) (-1008.721) (-1007.313) [-1007.368] * (-1009.207) [-1011.418] (-1006.856) (-1009.234) -- 0:00:37
      397500 -- (-1007.390) [-1010.056] (-1013.159) (-1011.042) * (-1010.135) (-1010.904) (-1007.656) [-1008.393] -- 0:00:37
      398000 -- (-1007.100) [-1008.377] (-1007.707) (-1013.704) * [-1007.743] (-1006.780) (-1010.376) (-1009.156) -- 0:00:37
      398500 -- (-1007.339) [-1007.987] (-1008.210) (-1008.140) * (-1009.975) [-1008.529] (-1008.392) (-1009.601) -- 0:00:37
      399000 -- (-1006.723) [-1007.175] (-1008.869) (-1010.065) * (-1007.759) (-1009.149) [-1007.717] (-1008.379) -- 0:00:37
      399500 -- (-1011.187) [-1008.079] (-1008.449) (-1009.797) * (-1007.387) [-1014.059] (-1007.746) (-1008.625) -- 0:00:37
      400000 -- (-1010.969) [-1009.709] (-1008.793) (-1010.995) * [-1008.259] (-1013.258) (-1011.146) (-1010.752) -- 0:00:37

      Average standard deviation of split frequencies: 0.014395

      400500 -- (-1010.961) [-1007.624] (-1017.349) (-1009.565) * (-1008.665) (-1014.041) (-1009.552) [-1012.238] -- 0:00:37
      401000 -- [-1010.264] (-1006.930) (-1016.652) (-1010.833) * (-1007.698) (-1011.746) (-1010.390) [-1007.084] -- 0:00:37
      401500 -- (-1011.482) (-1007.953) (-1008.723) [-1008.425] * [-1007.202] (-1008.556) (-1009.285) (-1008.442) -- 0:00:37
      402000 -- (-1009.314) [-1006.868] (-1006.728) (-1009.708) * (-1016.079) (-1010.118) (-1008.042) [-1008.204] -- 0:00:37
      402500 -- [-1011.680] (-1008.560) (-1010.161) (-1011.376) * (-1007.180) (-1012.961) [-1009.158] (-1008.473) -- 0:00:37
      403000 -- [-1010.034] (-1010.062) (-1009.555) (-1007.028) * (-1010.034) (-1010.300) (-1008.976) [-1007.224] -- 0:00:37
      403500 -- [-1010.443] (-1009.644) (-1010.833) (-1012.383) * (-1013.120) [-1009.452] (-1008.941) (-1008.397) -- 0:00:38
      404000 -- (-1008.696) (-1009.677) (-1007.235) [-1010.805] * (-1011.898) [-1011.921] (-1011.295) (-1011.558) -- 0:00:38
      404500 -- [-1007.117] (-1013.285) (-1008.626) (-1011.131) * (-1012.397) (-1008.175) (-1007.859) [-1007.423] -- 0:00:38
      405000 -- [-1006.969] (-1016.497) (-1010.616) (-1011.181) * (-1008.199) (-1008.050) [-1011.272] (-1008.710) -- 0:00:38

      Average standard deviation of split frequencies: 0.013592

      405500 -- (-1006.873) [-1009.590] (-1009.575) (-1008.972) * (-1011.967) (-1012.792) [-1008.133] (-1012.662) -- 0:00:38
      406000 -- [-1008.681] (-1009.995) (-1009.944) (-1011.925) * [-1008.819] (-1014.892) (-1007.355) (-1009.074) -- 0:00:38
      406500 -- (-1009.735) (-1008.469) (-1010.962) [-1008.329] * (-1007.417) (-1008.527) (-1007.574) [-1011.915] -- 0:00:37
      407000 -- (-1009.015) (-1009.725) [-1009.679] (-1006.785) * (-1007.835) (-1007.373) (-1008.749) [-1010.474] -- 0:00:37
      407500 -- (-1011.745) [-1009.168] (-1008.794) (-1006.847) * [-1008.669] (-1009.054) (-1011.901) (-1008.699) -- 0:00:37
      408000 -- (-1009.415) (-1011.104) (-1007.208) [-1010.034] * (-1007.408) [-1007.415] (-1008.407) (-1010.099) -- 0:00:37
      408500 -- [-1009.865] (-1007.826) (-1010.098) (-1009.800) * (-1008.623) (-1008.112) (-1009.294) [-1009.667] -- 0:00:37
      409000 -- (-1012.283) (-1009.526) (-1011.043) [-1009.400] * (-1012.760) (-1009.113) (-1010.794) [-1009.954] -- 0:00:37
      409500 -- (-1009.159) (-1012.295) (-1010.018) [-1009.197] * (-1008.276) (-1009.881) (-1009.308) [-1009.147] -- 0:00:37
      410000 -- (-1010.078) (-1009.184) [-1013.311] (-1007.452) * [-1007.705] (-1006.449) (-1009.132) (-1012.528) -- 0:00:37

      Average standard deviation of split frequencies: 0.013100

      410500 -- (-1008.784) (-1007.515) [-1009.535] (-1008.030) * (-1010.405) [-1006.745] (-1008.822) (-1009.072) -- 0:00:37
      411000 -- [-1007.353] (-1007.137) (-1008.521) (-1011.415) * [-1008.372] (-1008.600) (-1008.098) (-1010.509) -- 0:00:37
      411500 -- (-1007.307) [-1008.447] (-1007.900) (-1009.124) * (-1008.444) (-1007.727) [-1006.735] (-1010.648) -- 0:00:37
      412000 -- (-1007.641) [-1008.664] (-1008.161) (-1010.038) * (-1007.991) [-1007.101] (-1009.250) (-1007.802) -- 0:00:37
      412500 -- (-1011.231) [-1006.766] (-1009.381) (-1006.905) * (-1008.480) (-1007.514) [-1011.290] (-1007.122) -- 0:00:37
      413000 -- (-1011.155) (-1009.146) [-1007.323] (-1011.491) * (-1009.150) [-1010.322] (-1008.075) (-1007.089) -- 0:00:36
      413500 -- (-1008.147) (-1007.215) (-1008.863) [-1013.190] * (-1009.256) (-1010.348) [-1009.877] (-1008.297) -- 0:00:36
      414000 -- (-1009.296) [-1010.277] (-1007.205) (-1012.162) * (-1010.946) [-1007.857] (-1009.605) (-1008.432) -- 0:00:36
      414500 -- (-1006.923) (-1012.795) [-1009.473] (-1010.099) * (-1009.604) [-1008.275] (-1010.524) (-1007.073) -- 0:00:36
      415000 -- (-1008.308) [-1009.486] (-1010.684) (-1008.890) * (-1009.414) (-1011.591) [-1010.857] (-1009.135) -- 0:00:36

      Average standard deviation of split frequencies: 0.012890

      415500 -- [-1009.264] (-1008.101) (-1009.024) (-1017.417) * [-1011.729] (-1011.332) (-1013.870) (-1008.650) -- 0:00:36
      416000 -- (-1011.486) [-1008.601] (-1010.039) (-1015.655) * [-1007.516] (-1007.576) (-1012.950) (-1008.689) -- 0:00:36
      416500 -- (-1011.470) [-1010.989] (-1011.899) (-1013.384) * (-1010.454) [-1009.987] (-1009.045) (-1010.543) -- 0:00:36
      417000 -- [-1009.680] (-1010.029) (-1008.560) (-1009.648) * (-1009.122) (-1009.010) [-1011.486] (-1011.333) -- 0:00:36
      417500 -- [-1008.667] (-1009.273) (-1009.058) (-1007.528) * [-1008.895] (-1009.370) (-1008.592) (-1009.779) -- 0:00:36
      418000 -- [-1007.660] (-1007.800) (-1008.235) (-1007.825) * [-1009.199] (-1013.115) (-1007.900) (-1008.212) -- 0:00:36
      418500 -- [-1007.393] (-1008.005) (-1009.955) (-1006.666) * (-1010.631) (-1011.472) [-1008.714] (-1008.221) -- 0:00:36
      419000 -- (-1011.401) (-1009.662) (-1010.212) [-1008.141] * (-1009.991) [-1009.911] (-1007.368) (-1007.466) -- 0:00:36
      419500 -- (-1007.048) [-1012.233] (-1007.585) (-1008.200) * (-1008.854) (-1007.750) [-1007.010] (-1011.210) -- 0:00:35
      420000 -- (-1010.268) (-1007.530) (-1009.896) [-1008.290] * (-1011.801) (-1010.211) (-1008.666) [-1008.664] -- 0:00:37

      Average standard deviation of split frequencies: 0.012187

      420500 -- (-1008.653) (-1009.977) [-1014.033] (-1008.904) * (-1008.911) [-1009.222] (-1008.953) (-1014.008) -- 0:00:37
      421000 -- [-1009.289] (-1010.284) (-1008.376) (-1008.531) * (-1008.105) [-1008.255] (-1009.913) (-1012.707) -- 0:00:37
      421500 -- (-1010.228) (-1010.140) [-1012.219] (-1008.318) * [-1008.159] (-1007.290) (-1007.982) (-1009.345) -- 0:00:37
      422000 -- (-1007.781) (-1009.543) (-1008.946) [-1008.910] * (-1008.017) [-1009.736] (-1008.465) (-1010.610) -- 0:00:36
      422500 -- (-1010.443) [-1009.319] (-1011.443) (-1009.460) * [-1006.863] (-1009.529) (-1011.832) (-1008.816) -- 0:00:36
      423000 -- (-1008.798) (-1007.868) (-1009.012) [-1009.461] * (-1008.258) [-1010.830] (-1010.103) (-1008.391) -- 0:00:36
      423500 -- (-1010.290) (-1007.342) [-1009.128] (-1011.235) * [-1009.275] (-1009.863) (-1009.252) (-1015.236) -- 0:00:36
      424000 -- (-1008.503) [-1007.397] (-1013.003) (-1007.694) * [-1012.800] (-1010.778) (-1007.928) (-1015.524) -- 0:00:36
      424500 -- (-1019.274) (-1008.014) (-1011.309) [-1007.451] * (-1009.922) [-1007.729] (-1010.351) (-1010.041) -- 0:00:36
      425000 -- (-1013.350) (-1010.184) (-1011.467) [-1006.861] * [-1008.276] (-1008.957) (-1009.822) (-1009.533) -- 0:00:36

      Average standard deviation of split frequencies: 0.013214

      425500 -- (-1020.069) [-1012.077] (-1010.787) (-1009.933) * (-1009.594) (-1011.775) (-1011.002) [-1007.538] -- 0:00:36
      426000 -- (-1008.216) (-1008.453) [-1009.132] (-1009.844) * (-1007.546) [-1010.256] (-1006.999) (-1007.845) -- 0:00:36
      426500 -- (-1011.927) [-1006.930] (-1010.640) (-1008.218) * (-1015.481) (-1009.799) [-1007.778] (-1012.970) -- 0:00:36
      427000 -- (-1009.631) [-1007.004] (-1007.737) (-1009.860) * (-1008.195) (-1007.473) [-1008.002] (-1009.593) -- 0:00:36
      427500 -- (-1007.172) (-1007.011) (-1009.777) [-1008.029] * [-1008.179] (-1009.633) (-1013.784) (-1008.543) -- 0:00:36
      428000 -- (-1008.747) (-1007.935) [-1007.367] (-1010.490) * [-1009.160] (-1009.124) (-1009.398) (-1008.372) -- 0:00:36
      428500 -- (-1007.591) (-1006.963) [-1008.693] (-1011.577) * [-1007.786] (-1009.644) (-1008.224) (-1007.830) -- 0:00:36
      429000 -- (-1008.737) (-1007.029) [-1008.901] (-1011.282) * [-1009.416] (-1010.040) (-1010.350) (-1008.443) -- 0:00:35
      429500 -- (-1007.695) (-1007.215) [-1009.791] (-1010.619) * [-1007.715] (-1009.400) (-1008.619) (-1008.920) -- 0:00:35
      430000 -- (-1008.163) (-1007.687) [-1010.759] (-1008.923) * (-1009.318) (-1009.611) (-1011.604) [-1008.699] -- 0:00:35

      Average standard deviation of split frequencies: 0.013272

      430500 -- (-1008.247) (-1011.962) [-1014.330] (-1007.346) * (-1011.154) (-1008.435) (-1008.834) [-1006.970] -- 0:00:35
      431000 -- (-1009.558) (-1010.298) (-1015.634) [-1007.659] * [-1010.457] (-1007.960) (-1008.442) (-1006.974) -- 0:00:35
      431500 -- (-1012.930) [-1010.469] (-1011.045) (-1009.233) * (-1008.626) (-1007.969) (-1008.031) [-1006.965] -- 0:00:35
      432000 -- [-1006.987] (-1008.084) (-1007.676) (-1008.904) * (-1008.778) [-1010.626] (-1011.223) (-1006.900) -- 0:00:35
      432500 -- (-1007.449) [-1010.775] (-1006.979) (-1008.348) * (-1007.835) (-1012.387) [-1008.470] (-1015.714) -- 0:00:35
      433000 -- (-1007.663) [-1008.652] (-1014.044) (-1011.570) * (-1006.693) (-1010.725) [-1011.405] (-1013.646) -- 0:00:35
      433500 -- (-1011.815) [-1010.197] (-1015.107) (-1008.667) * [-1006.708] (-1008.432) (-1013.573) (-1012.475) -- 0:00:35
      434000 -- [-1011.413] (-1010.089) (-1011.914) (-1009.315) * (-1007.922) (-1008.072) (-1014.567) [-1008.104] -- 0:00:35
      434500 -- (-1012.879) (-1007.193) (-1008.728) [-1009.534] * (-1009.525) [-1010.321] (-1010.541) (-1011.589) -- 0:00:35
      435000 -- (-1012.607) (-1008.313) (-1009.232) [-1007.872] * (-1009.123) [-1009.216] (-1008.215) (-1011.972) -- 0:00:35

      Average standard deviation of split frequencies: 0.013583

      435500 -- (-1010.162) (-1008.747) (-1007.874) [-1008.934] * (-1007.340) (-1007.700) (-1010.513) [-1008.082] -- 0:00:34
      436000 -- (-1008.767) [-1007.840] (-1013.437) (-1008.262) * (-1007.495) [-1008.832] (-1007.659) (-1009.027) -- 0:00:36
      436500 -- [-1009.847] (-1007.353) (-1008.136) (-1007.934) * [-1010.931] (-1007.891) (-1008.855) (-1007.546) -- 0:00:36
      437000 -- (-1008.703) [-1007.492] (-1008.451) (-1007.901) * (-1008.847) (-1008.558) (-1010.025) [-1011.094] -- 0:00:36
      437500 -- (-1013.795) (-1008.632) [-1008.517] (-1009.288) * (-1006.547) [-1008.375] (-1008.431) (-1009.786) -- 0:00:36
      438000 -- [-1010.012] (-1013.240) (-1010.700) (-1011.600) * (-1008.017) (-1009.632) (-1009.221) [-1009.952] -- 0:00:35
      438500 -- (-1008.843) (-1009.116) [-1008.751] (-1009.801) * (-1007.878) [-1009.286] (-1008.122) (-1007.747) -- 0:00:35
      439000 -- (-1008.916) (-1007.612) [-1007.791] (-1010.823) * (-1010.820) (-1011.353) [-1007.440] (-1009.000) -- 0:00:35
      439500 -- [-1010.022] (-1008.134) (-1008.920) (-1011.183) * (-1009.559) (-1010.682) [-1008.965] (-1007.802) -- 0:00:35
      440000 -- [-1009.839] (-1011.778) (-1011.216) (-1007.856) * (-1007.627) [-1015.128] (-1012.969) (-1008.335) -- 0:00:35

      Average standard deviation of split frequencies: 0.012703

      440500 -- [-1009.018] (-1009.546) (-1008.038) (-1007.542) * (-1007.645) (-1011.597) [-1006.972] (-1010.582) -- 0:00:35
      441000 -- (-1008.621) [-1007.779] (-1008.315) (-1007.039) * (-1009.206) (-1008.596) [-1007.133] (-1009.335) -- 0:00:35
      441500 -- (-1007.309) [-1010.937] (-1010.116) (-1007.935) * (-1008.356) (-1007.365) [-1009.618] (-1007.924) -- 0:00:35
      442000 -- (-1008.083) (-1011.369) (-1010.954) [-1007.308] * (-1007.598) (-1008.378) [-1008.552] (-1009.193) -- 0:00:35
      442500 -- (-1011.429) (-1009.232) [-1007.096] (-1008.999) * (-1011.662) (-1007.767) [-1008.117] (-1008.960) -- 0:00:35
      443000 -- (-1007.411) (-1008.348) [-1007.833] (-1010.406) * (-1011.030) (-1008.825) [-1007.886] (-1007.145) -- 0:00:35
      443500 -- [-1008.074] (-1009.181) (-1008.061) (-1008.836) * (-1010.231) (-1009.319) [-1006.966] (-1007.895) -- 0:00:35
      444000 -- (-1007.771) [-1010.268] (-1008.343) (-1007.889) * [-1008.022] (-1008.787) (-1007.171) (-1007.266) -- 0:00:35
      444500 -- (-1010.894) (-1010.395) (-1010.065) [-1008.423] * (-1008.606) (-1007.447) [-1009.640] (-1008.076) -- 0:00:34
      445000 -- (-1013.027) [-1012.344] (-1008.185) (-1007.752) * (-1008.786) [-1008.612] (-1010.160) (-1007.246) -- 0:00:34

      Average standard deviation of split frequencies: 0.012621

      445500 -- (-1010.184) (-1011.849) [-1007.702] (-1008.768) * (-1008.722) [-1009.617] (-1009.638) (-1007.310) -- 0:00:34
      446000 -- (-1010.189) (-1012.179) (-1010.420) [-1008.330] * (-1008.224) (-1007.842) (-1014.470) [-1010.477] -- 0:00:34
      446500 -- (-1010.385) (-1006.641) [-1012.598] (-1008.482) * (-1011.931) (-1008.698) (-1012.404) [-1009.463] -- 0:00:34
      447000 -- [-1007.457] (-1008.584) (-1013.279) (-1013.945) * (-1007.846) [-1009.687] (-1011.271) (-1007.666) -- 0:00:34
      447500 -- (-1007.549) (-1007.476) (-1011.502) [-1010.452] * (-1007.146) (-1007.842) [-1010.532] (-1009.040) -- 0:00:34
      448000 -- (-1009.469) (-1007.677) [-1008.804] (-1006.992) * (-1010.366) (-1008.049) (-1010.047) [-1009.685] -- 0:00:34
      448500 -- (-1009.629) (-1007.405) (-1009.761) [-1010.035] * (-1008.791) (-1009.621) (-1014.030) [-1008.078] -- 0:00:34
      449000 -- (-1008.910) [-1011.000] (-1010.336) (-1013.104) * (-1012.286) (-1013.181) [-1008.134] (-1010.559) -- 0:00:34
      449500 -- (-1010.711) [-1007.818] (-1010.733) (-1012.863) * (-1010.927) (-1009.491) (-1009.309) [-1008.377] -- 0:00:34
      450000 -- [-1010.211] (-1013.894) (-1009.418) (-1008.676) * (-1008.516) [-1006.794] (-1014.304) (-1008.391) -- 0:00:34

      Average standard deviation of split frequencies: 0.013106

      450500 -- (-1008.937) (-1009.188) [-1008.869] (-1009.483) * (-1010.836) (-1008.150) (-1011.351) [-1008.844] -- 0:00:34
      451000 -- [-1008.148] (-1008.285) (-1009.756) (-1009.789) * (-1007.859) (-1008.307) [-1009.376] (-1008.310) -- 0:00:34
      451500 -- [-1014.973] (-1008.991) (-1008.840) (-1010.442) * (-1009.294) [-1008.996] (-1007.941) (-1007.962) -- 0:00:34
      452000 -- (-1013.511) (-1009.498) [-1007.481] (-1007.501) * [-1009.365] (-1008.709) (-1008.678) (-1012.553) -- 0:00:33
      452500 -- (-1012.145) (-1007.816) (-1010.250) [-1010.636] * (-1009.467) [-1008.646] (-1010.065) (-1009.106) -- 0:00:35
      453000 -- (-1011.797) (-1007.967) [-1007.876] (-1013.358) * (-1007.914) (-1010.990) (-1008.367) [-1006.854] -- 0:00:35
      453500 -- [-1009.083] (-1007.967) (-1008.052) (-1009.814) * (-1009.363) [-1007.077] (-1014.038) (-1009.525) -- 0:00:34
      454000 -- [-1010.284] (-1008.970) (-1009.441) (-1007.378) * (-1009.080) (-1006.953) (-1010.453) [-1007.179] -- 0:00:34
      454500 -- [-1008.927] (-1009.885) (-1008.035) (-1007.053) * (-1008.388) (-1008.032) (-1009.649) [-1010.454] -- 0:00:34
      455000 -- (-1008.298) [-1009.132] (-1010.168) (-1009.545) * [-1009.893] (-1006.656) (-1009.266) (-1008.529) -- 0:00:34

      Average standard deviation of split frequencies: 0.013310

      455500 -- (-1008.104) [-1008.383] (-1010.896) (-1012.188) * (-1010.297) [-1006.657] (-1007.368) (-1008.401) -- 0:00:34
      456000 -- (-1013.154) (-1009.220) [-1009.799] (-1009.909) * (-1011.732) (-1011.670) (-1007.361) [-1008.031] -- 0:00:34
      456500 -- (-1008.494) (-1007.748) (-1007.791) [-1010.164] * [-1007.735] (-1014.546) (-1007.122) (-1007.718) -- 0:00:34
      457000 -- (-1007.204) [-1009.097] (-1008.402) (-1011.969) * [-1009.588] (-1009.246) (-1008.805) (-1009.120) -- 0:00:34
      457500 -- [-1009.428] (-1008.535) (-1012.080) (-1010.541) * (-1008.344) (-1008.772) (-1008.030) [-1009.093] -- 0:00:34
      458000 -- (-1007.432) [-1007.729] (-1011.517) (-1010.397) * [-1008.150] (-1011.856) (-1008.695) (-1012.661) -- 0:00:34
      458500 -- (-1006.997) (-1007.229) [-1009.135] (-1014.564) * (-1008.921) (-1007.857) [-1011.032] (-1010.481) -- 0:00:34
      459000 -- [-1006.775] (-1010.669) (-1009.050) (-1009.020) * (-1007.531) [-1007.877] (-1008.079) (-1014.242) -- 0:00:34
      459500 -- [-1011.733] (-1011.056) (-1011.860) (-1007.277) * (-1013.796) (-1009.000) [-1007.234] (-1013.439) -- 0:00:34
      460000 -- (-1008.052) (-1010.079) [-1007.832] (-1008.306) * [-1007.305] (-1008.452) (-1006.795) (-1010.180) -- 0:00:34

      Average standard deviation of split frequencies: 0.013495

      460500 -- [-1011.941] (-1010.981) (-1007.011) (-1008.291) * (-1007.678) [-1008.082] (-1008.443) (-1009.240) -- 0:00:33
      461000 -- (-1009.366) [-1009.728] (-1012.672) (-1008.530) * [-1010.690] (-1007.863) (-1008.771) (-1011.299) -- 0:00:33
      461500 -- (-1009.763) [-1007.460] (-1008.135) (-1007.187) * (-1012.784) (-1012.401) [-1007.800] (-1012.177) -- 0:00:33
      462000 -- (-1007.003) (-1006.661) (-1009.749) [-1007.024] * (-1012.204) [-1008.126] (-1008.905) (-1010.020) -- 0:00:33
      462500 -- (-1012.098) (-1011.410) [-1011.043] (-1010.063) * (-1010.593) (-1007.470) (-1014.710) [-1012.612] -- 0:00:33
      463000 -- (-1014.937) (-1011.696) [-1008.627] (-1009.020) * (-1011.266) (-1006.743) [-1007.507] (-1014.286) -- 0:00:33
      463500 -- (-1013.248) [-1007.546] (-1010.075) (-1008.136) * [-1009.551] (-1009.251) (-1007.165) (-1009.213) -- 0:00:33
      464000 -- (-1009.825) [-1007.937] (-1007.195) (-1008.730) * [-1008.610] (-1009.440) (-1008.129) (-1010.365) -- 0:00:33
      464500 -- (-1009.194) (-1008.047) [-1007.311] (-1008.408) * (-1009.818) (-1006.857) [-1008.358] (-1007.729) -- 0:00:33
      465000 -- [-1008.327] (-1007.806) (-1008.607) (-1008.158) * (-1010.351) (-1007.646) [-1008.292] (-1012.601) -- 0:00:33

      Average standard deviation of split frequencies: 0.012645

      465500 -- [-1007.303] (-1009.054) (-1008.416) (-1012.782) * [-1008.230] (-1010.276) (-1008.414) (-1008.829) -- 0:00:33
      466000 -- (-1008.405) [-1007.046] (-1008.772) (-1008.951) * [-1007.337] (-1008.976) (-1011.812) (-1014.593) -- 0:00:33
      466500 -- (-1010.673) (-1008.749) [-1009.650] (-1008.929) * [-1010.993] (-1010.505) (-1009.181) (-1008.438) -- 0:00:33
      467000 -- (-1011.257) (-1012.233) [-1009.346] (-1010.069) * (-1010.932) [-1007.948] (-1011.956) (-1008.602) -- 0:00:33
      467500 -- (-1010.615) [-1011.355] (-1012.398) (-1010.824) * (-1008.578) (-1009.381) [-1010.060] (-1011.742) -- 0:00:33
      468000 -- (-1007.334) (-1010.646) [-1009.620] (-1008.684) * (-1008.103) [-1009.533] (-1009.627) (-1010.415) -- 0:00:32
      468500 -- [-1007.647] (-1011.472) (-1010.445) (-1009.716) * (-1009.964) (-1008.437) [-1006.909] (-1007.818) -- 0:00:32
      469000 -- (-1008.929) [-1009.329] (-1008.633) (-1014.753) * (-1008.996) [-1007.888] (-1008.898) (-1007.471) -- 0:00:33
      469500 -- (-1011.573) [-1008.786] (-1008.743) (-1007.555) * (-1008.908) (-1011.008) (-1013.456) [-1010.906] -- 0:00:33
      470000 -- [-1008.657] (-1011.462) (-1011.968) (-1006.869) * (-1010.662) (-1010.234) (-1014.475) [-1008.797] -- 0:00:33

      Average standard deviation of split frequencies: 0.012457

      470500 -- [-1009.151] (-1008.222) (-1010.113) (-1008.245) * [-1010.077] (-1008.031) (-1014.673) (-1011.832) -- 0:00:33
      471000 -- (-1009.219) (-1007.277) (-1012.481) [-1007.609] * (-1008.152) [-1007.513] (-1009.512) (-1011.993) -- 0:00:33
      471500 -- (-1012.413) (-1009.053) (-1011.041) [-1008.610] * (-1012.404) (-1011.102) [-1009.685] (-1013.530) -- 0:00:33
      472000 -- (-1009.732) (-1008.586) (-1007.587) [-1009.171] * (-1010.685) [-1008.333] (-1008.033) (-1011.172) -- 0:00:33
      472500 -- (-1008.725) (-1009.693) [-1007.531] (-1011.398) * (-1010.250) [-1009.733] (-1013.286) (-1009.415) -- 0:00:33
      473000 -- (-1007.885) (-1009.366) [-1009.115] (-1010.437) * [-1006.879] (-1008.355) (-1012.685) (-1009.272) -- 0:00:33
      473500 -- (-1010.096) (-1011.976) (-1007.681) [-1006.651] * (-1009.047) (-1007.452) (-1008.767) [-1007.805] -- 0:00:33
      474000 -- (-1011.046) [-1008.502] (-1009.082) (-1008.015) * (-1009.919) (-1008.262) [-1009.586] (-1008.249) -- 0:00:33
      474500 -- [-1008.992] (-1009.831) (-1007.762) (-1007.334) * (-1006.716) [-1007.352] (-1010.901) (-1007.342) -- 0:00:33
      475000 -- (-1012.465) (-1007.549) [-1008.348] (-1009.532) * (-1007.828) [-1007.057] (-1014.552) (-1007.420) -- 0:00:33

      Average standard deviation of split frequencies: 0.011698

      475500 -- (-1010.611) (-1011.074) [-1010.903] (-1010.270) * (-1011.326) (-1007.451) [-1014.301] (-1011.530) -- 0:00:33
      476000 -- (-1007.956) [-1009.786] (-1008.157) (-1009.629) * [-1008.123] (-1011.112) (-1009.505) (-1009.689) -- 0:00:33
      476500 -- (-1011.100) [-1009.885] (-1011.159) (-1007.557) * (-1010.150) (-1009.204) [-1008.892] (-1007.030) -- 0:00:32
      477000 -- (-1009.041) (-1014.187) [-1006.763] (-1007.376) * (-1013.653) (-1011.547) [-1011.750] (-1010.259) -- 0:00:32
      477500 -- (-1014.435) [-1009.991] (-1008.954) (-1009.459) * (-1009.609) (-1010.025) (-1011.313) [-1009.462] -- 0:00:32
      478000 -- (-1010.232) (-1009.474) [-1010.947] (-1009.402) * (-1008.428) (-1008.135) (-1015.286) [-1008.390] -- 0:00:32
      478500 -- [-1009.385] (-1010.478) (-1009.825) (-1010.436) * (-1007.325) (-1009.363) (-1011.568) [-1007.929] -- 0:00:32
      479000 -- (-1009.968) (-1008.605) (-1008.349) [-1014.019] * [-1007.615] (-1006.847) (-1009.826) (-1008.687) -- 0:00:32
      479500 -- [-1008.067] (-1009.632) (-1006.879) (-1010.637) * (-1008.254) [-1009.065] (-1008.532) (-1009.135) -- 0:00:32
      480000 -- (-1007.276) (-1008.617) [-1006.887] (-1010.176) * [-1008.811] (-1009.386) (-1008.427) (-1009.485) -- 0:00:32

      Average standard deviation of split frequencies: 0.012014

      480500 -- (-1011.190) (-1009.540) [-1007.287] (-1008.797) * (-1009.722) (-1009.125) [-1007.641] (-1007.094) -- 0:00:32
      481000 -- (-1007.374) (-1008.304) [-1008.967] (-1010.558) * [-1008.171] (-1007.535) (-1009.219) (-1010.117) -- 0:00:32
      481500 -- (-1012.628) (-1008.242) (-1011.072) [-1008.052] * (-1010.061) [-1011.702] (-1007.358) (-1008.720) -- 0:00:32
      482000 -- (-1007.873) [-1006.701] (-1007.034) (-1009.428) * (-1011.317) (-1012.262) [-1009.420] (-1008.296) -- 0:00:32
      482500 -- (-1010.401) (-1007.571) (-1007.472) [-1009.849] * (-1010.922) (-1009.363) [-1008.115] (-1010.670) -- 0:00:32
      483000 -- (-1008.159) [-1008.370] (-1007.472) (-1011.757) * [-1009.984] (-1008.205) (-1007.833) (-1009.015) -- 0:00:32
      483500 -- (-1016.143) (-1006.929) [-1008.603] (-1011.747) * (-1009.875) (-1008.809) [-1010.002] (-1010.172) -- 0:00:32
      484000 -- (-1011.834) (-1008.127) [-1008.195] (-1009.774) * (-1009.251) [-1009.281] (-1007.983) (-1010.032) -- 0:00:31
      484500 -- (-1010.602) (-1007.021) (-1008.878) [-1010.318] * (-1007.406) [-1007.565] (-1006.578) (-1011.348) -- 0:00:31
      485000 -- (-1008.646) [-1010.171] (-1009.081) (-1011.774) * (-1009.047) (-1008.059) [-1007.162] (-1009.815) -- 0:00:32

      Average standard deviation of split frequencies: 0.012367

      485500 -- (-1008.685) (-1008.254) (-1008.226) [-1008.706] * [-1009.473] (-1009.678) (-1007.902) (-1006.890) -- 0:00:32
      486000 -- (-1007.973) (-1008.213) [-1010.468] (-1007.905) * (-1009.524) (-1008.100) (-1007.131) [-1007.553] -- 0:00:32
      486500 -- (-1008.032) (-1010.256) (-1011.185) [-1008.244] * (-1008.752) (-1007.937) [-1011.010] (-1007.813) -- 0:00:32
      487000 -- (-1008.383) [-1007.592] (-1008.784) (-1007.648) * (-1009.184) (-1008.781) (-1008.711) [-1009.166] -- 0:00:32
      487500 -- (-1011.711) [-1007.770] (-1006.657) (-1007.726) * (-1009.291) (-1015.063) [-1007.911] (-1007.712) -- 0:00:32
      488000 -- [-1007.496] (-1008.227) (-1008.054) (-1009.611) * [-1007.791] (-1013.447) (-1008.316) (-1009.279) -- 0:00:32
      488500 -- (-1008.168) (-1009.967) [-1006.754] (-1008.493) * [-1008.272] (-1010.689) (-1006.990) (-1008.407) -- 0:00:32
      489000 -- [-1008.082] (-1007.635) (-1010.627) (-1006.880) * (-1010.224) (-1016.638) (-1006.990) [-1009.117] -- 0:00:32
      489500 -- [-1008.181] (-1007.350) (-1008.412) (-1007.532) * (-1008.640) [-1009.100] (-1007.371) (-1008.582) -- 0:00:32
      490000 -- [-1007.752] (-1010.475) (-1009.926) (-1009.846) * (-1008.730) (-1010.726) [-1007.627] (-1009.087) -- 0:00:32

      Average standard deviation of split frequencies: 0.012069

      490500 -- (-1009.992) (-1016.118) (-1009.903) [-1011.457] * (-1008.287) [-1010.395] (-1008.895) (-1012.596) -- 0:00:32
      491000 -- (-1007.790) (-1008.756) (-1009.766) [-1008.670] * (-1008.225) [-1007.172] (-1011.719) (-1010.626) -- 0:00:32
      491500 -- [-1006.934] (-1010.031) (-1007.210) (-1007.068) * [-1008.500] (-1007.649) (-1008.648) (-1010.588) -- 0:00:32
      492000 -- (-1007.543) [-1009.683] (-1011.252) (-1007.029) * [-1010.284] (-1008.418) (-1008.404) (-1010.849) -- 0:00:32
      492500 -- (-1007.556) (-1008.376) (-1009.130) [-1008.742] * (-1010.403) [-1009.576] (-1007.524) (-1011.641) -- 0:00:31
      493000 -- [-1009.476] (-1010.375) (-1007.779) (-1007.923) * [-1009.342] (-1010.775) (-1009.062) (-1007.883) -- 0:00:31
      493500 -- (-1008.771) (-1007.988) (-1015.756) [-1010.582] * (-1007.600) (-1008.861) (-1011.057) [-1008.522] -- 0:00:31
      494000 -- (-1011.272) [-1008.429] (-1009.227) (-1009.260) * [-1007.897] (-1012.895) (-1010.042) (-1009.371) -- 0:00:31
      494500 -- [-1008.953] (-1008.137) (-1009.102) (-1008.410) * (-1010.720) (-1010.226) [-1014.206] (-1009.242) -- 0:00:31
      495000 -- (-1007.818) [-1007.380] (-1009.090) (-1012.408) * [-1011.665] (-1007.397) (-1009.027) (-1013.494) -- 0:00:31

      Average standard deviation of split frequencies: 0.012712

      495500 -- [-1011.749] (-1007.721) (-1010.379) (-1011.484) * (-1009.035) [-1008.244] (-1011.087) (-1012.904) -- 0:00:31
      496000 -- (-1016.216) (-1009.793) (-1007.943) [-1008.149] * (-1008.363) (-1009.596) (-1007.907) [-1012.449] -- 0:00:31
      496500 -- (-1009.571) (-1007.922) (-1009.029) [-1009.266] * (-1010.484) (-1010.477) [-1011.248] (-1007.983) -- 0:00:31
      497000 -- (-1008.675) (-1008.879) [-1007.718] (-1009.764) * (-1006.819) (-1008.733) (-1009.068) [-1006.873] -- 0:00:31
      497500 -- [-1007.165] (-1006.905) (-1008.333) (-1006.955) * (-1010.145) [-1010.606] (-1009.319) (-1009.411) -- 0:00:31
      498000 -- (-1008.641) (-1007.233) [-1008.355] (-1010.624) * (-1007.266) [-1007.902] (-1013.444) (-1008.274) -- 0:00:31
      498500 -- (-1014.020) [-1007.047] (-1007.961) (-1011.984) * (-1008.170) (-1010.502) (-1009.787) [-1012.782] -- 0:00:31
      499000 -- (-1007.868) [-1007.595] (-1013.108) (-1010.378) * (-1009.501) [-1011.190] (-1007.859) (-1009.225) -- 0:00:31
      499500 -- (-1010.809) (-1008.260) [-1008.781] (-1009.917) * [-1006.747] (-1009.103) (-1012.772) (-1008.400) -- 0:00:31
      500000 -- [-1008.689] (-1009.843) (-1011.932) (-1007.613) * (-1011.728) (-1007.838) (-1012.227) [-1007.418] -- 0:00:31

      Average standard deviation of split frequencies: 0.012946

      500500 -- (-1007.209) (-1007.128) (-1007.836) [-1007.244] * (-1007.770) [-1007.554] (-1013.256) (-1007.663) -- 0:00:30
      501000 -- (-1014.949) (-1007.774) (-1010.030) [-1007.248] * [-1009.114] (-1013.066) (-1012.449) (-1010.810) -- 0:00:31
      501500 -- (-1014.225) (-1008.699) (-1010.364) [-1007.325] * (-1009.024) (-1009.232) [-1008.648] (-1007.265) -- 0:00:31
      502000 -- [-1011.418] (-1007.664) (-1009.963) (-1007.325) * [-1008.183] (-1009.139) (-1009.493) (-1006.600) -- 0:00:31
      502500 -- (-1012.146) [-1008.965] (-1009.115) (-1008.007) * [-1013.271] (-1007.126) (-1011.798) (-1006.602) -- 0:00:31
      503000 -- [-1007.337] (-1009.719) (-1008.973) (-1011.338) * (-1009.429) (-1008.045) [-1007.781] (-1008.800) -- 0:00:31
      503500 -- (-1008.115) (-1008.923) [-1009.837] (-1008.006) * [-1011.698] (-1008.156) (-1009.800) (-1008.171) -- 0:00:31
      504000 -- (-1009.707) (-1015.268) (-1011.583) [-1010.588] * (-1008.552) [-1009.516] (-1008.682) (-1008.063) -- 0:00:31
      504500 -- [-1007.313] (-1009.925) (-1011.829) (-1007.806) * [-1008.476] (-1010.453) (-1008.999) (-1008.726) -- 0:00:31
      505000 -- (-1008.369) (-1008.993) [-1007.811] (-1009.468) * (-1007.989) [-1008.144] (-1010.454) (-1007.667) -- 0:00:31

      Average standard deviation of split frequencies: 0.013207

      505500 -- [-1008.645] (-1006.806) (-1008.050) (-1008.992) * [-1009.625] (-1009.777) (-1008.294) (-1010.197) -- 0:00:31
      506000 -- (-1012.609) (-1008.050) (-1008.688) [-1009.611] * [-1010.197] (-1008.221) (-1008.011) (-1009.910) -- 0:00:31
      506500 -- (-1011.727) (-1008.713) (-1010.530) [-1007.859] * [-1007.963] (-1009.330) (-1009.269) (-1010.777) -- 0:00:31
      507000 -- [-1008.521] (-1008.142) (-1008.802) (-1006.823) * (-1015.332) (-1009.414) (-1007.498) [-1008.696] -- 0:00:31
      507500 -- (-1006.559) [-1009.382] (-1010.448) (-1008.397) * (-1011.340) (-1009.205) (-1010.230) [-1008.612] -- 0:00:31
      508000 -- (-1007.194) (-1009.251) [-1009.778] (-1006.832) * [-1009.851] (-1008.754) (-1010.232) (-1008.855) -- 0:00:30
      508500 -- (-1008.625) [-1008.718] (-1008.507) (-1009.664) * (-1009.694) [-1008.641] (-1009.461) (-1010.648) -- 0:00:30
      509000 -- (-1008.296) (-1006.544) [-1006.798] (-1010.923) * (-1008.738) (-1007.915) [-1007.846] (-1007.491) -- 0:00:30
      509500 -- (-1008.163) (-1010.096) (-1009.376) [-1007.974] * (-1011.747) (-1012.265) [-1013.046] (-1009.749) -- 0:00:30
      510000 -- [-1007.563] (-1007.810) (-1007.834) (-1011.858) * (-1009.103) (-1012.825) [-1007.609] (-1009.801) -- 0:00:30

      Average standard deviation of split frequencies: 0.013684

      510500 -- (-1006.621) (-1010.049) [-1008.038] (-1007.322) * (-1008.316) (-1016.647) [-1007.819] (-1014.414) -- 0:00:30
      511000 -- (-1008.503) (-1008.913) (-1009.489) [-1007.815] * (-1009.338) (-1012.549) [-1007.994] (-1008.605) -- 0:00:30
      511500 -- [-1008.095] (-1010.435) (-1008.508) (-1007.803) * [-1007.269] (-1008.444) (-1009.349) (-1007.450) -- 0:00:30
      512000 -- (-1008.388) [-1009.860] (-1010.942) (-1018.953) * (-1008.436) [-1007.373] (-1007.910) (-1006.584) -- 0:00:30
      512500 -- (-1007.762) (-1009.314) (-1007.955) [-1006.798] * (-1008.965) (-1008.072) (-1007.633) [-1012.969] -- 0:00:30
      513000 -- (-1010.606) (-1006.884) [-1009.459] (-1009.506) * [-1007.030] (-1010.022) (-1009.415) (-1007.345) -- 0:00:30
      513500 -- (-1016.348) [-1008.784] (-1007.952) (-1009.382) * (-1009.102) (-1007.702) (-1009.875) [-1009.306] -- 0:00:30
      514000 -- [-1012.476] (-1009.090) (-1009.559) (-1008.159) * (-1008.633) (-1008.031) (-1014.238) [-1007.599] -- 0:00:30
      514500 -- (-1008.377) (-1008.691) (-1009.654) [-1007.854] * (-1009.798) (-1009.328) (-1010.128) [-1007.604] -- 0:00:30
      515000 -- [-1007.779] (-1010.766) (-1009.155) (-1013.616) * (-1007.662) (-1008.026) (-1008.064) [-1008.756] -- 0:00:30

      Average standard deviation of split frequencies: 0.014566

      515500 -- [-1007.841] (-1009.857) (-1008.496) (-1007.868) * [-1007.891] (-1009.567) (-1008.181) (-1010.470) -- 0:00:30
      516000 -- (-1008.073) (-1009.174) (-1010.534) [-1007.338] * (-1008.043) (-1008.485) (-1007.048) [-1009.861] -- 0:00:30
      516500 -- (-1008.857) [-1009.611] (-1009.024) (-1008.526) * (-1010.093) (-1008.903) [-1009.563] (-1011.203) -- 0:00:29
      517000 -- (-1007.822) [-1007.813] (-1010.420) (-1009.591) * [-1007.574] (-1010.048) (-1010.078) (-1011.979) -- 0:00:29
      517500 -- (-1008.516) (-1009.213) (-1009.002) [-1007.885] * (-1010.353) (-1012.564) [-1008.317] (-1012.429) -- 0:00:30
      518000 -- (-1008.247) (-1008.976) [-1007.941] (-1007.417) * (-1012.607) (-1013.790) (-1008.917) [-1009.218] -- 0:00:30
      518500 -- [-1007.772] (-1008.765) (-1006.940) (-1009.623) * (-1008.386) [-1006.845] (-1011.344) (-1010.212) -- 0:00:30
      519000 -- [-1008.246] (-1007.858) (-1007.414) (-1009.180) * [-1012.234] (-1007.012) (-1013.828) (-1009.699) -- 0:00:30
      519500 -- (-1009.418) (-1008.074) [-1008.312] (-1008.986) * (-1014.899) [-1006.860] (-1010.199) (-1010.207) -- 0:00:30
      520000 -- (-1007.770) (-1011.672) (-1007.406) [-1008.219] * (-1008.643) (-1007.446) [-1011.683] (-1012.056) -- 0:00:30

      Average standard deviation of split frequencies: 0.014436

      520500 -- (-1007.905) (-1019.960) [-1009.667] (-1008.493) * (-1009.324) [-1008.339] (-1007.371) (-1007.613) -- 0:00:30
      521000 -- (-1010.633) [-1008.015] (-1011.013) (-1008.578) * (-1009.802) (-1010.253) (-1007.512) [-1007.831] -- 0:00:30
      521500 -- [-1008.267] (-1007.170) (-1010.627) (-1009.945) * (-1009.407) (-1009.200) (-1007.025) [-1007.990] -- 0:00:30
      522000 -- [-1009.102] (-1007.229) (-1007.822) (-1010.343) * (-1008.596) (-1008.338) [-1008.539] (-1008.714) -- 0:00:30
      522500 -- (-1007.744) [-1007.194] (-1008.720) (-1008.650) * (-1010.191) (-1008.025) (-1014.063) [-1007.525] -- 0:00:30
      523000 -- (-1008.838) [-1008.410] (-1007.020) (-1006.759) * (-1008.918) (-1009.599) (-1015.459) [-1007.184] -- 0:00:30
      523500 -- (-1012.279) (-1008.589) [-1008.222] (-1008.514) * (-1009.901) [-1009.574] (-1011.570) (-1010.489) -- 0:00:30
      524000 -- (-1011.217) (-1008.436) [-1009.855] (-1007.807) * [-1010.132] (-1008.218) (-1014.158) (-1010.799) -- 0:00:29
      524500 -- (-1009.914) (-1007.510) (-1012.659) [-1008.034] * (-1011.866) (-1007.670) (-1016.437) [-1009.794] -- 0:00:29
      525000 -- (-1009.798) [-1007.375] (-1009.668) (-1007.387) * (-1007.884) (-1008.619) [-1011.280] (-1011.037) -- 0:00:29

      Average standard deviation of split frequencies: 0.014240

      525500 -- (-1010.897) (-1009.461) [-1009.093] (-1010.218) * (-1007.661) [-1008.935] (-1012.683) (-1011.660) -- 0:00:29
      526000 -- [-1008.648] (-1008.055) (-1010.726) (-1009.972) * (-1011.659) (-1007.568) [-1008.752] (-1010.713) -- 0:00:29
      526500 -- (-1008.712) [-1010.471] (-1007.237) (-1009.877) * (-1007.768) [-1006.618] (-1010.213) (-1007.272) -- 0:00:29
      527000 -- (-1015.594) (-1010.248) [-1007.223] (-1007.899) * (-1008.433) (-1010.786) [-1008.486] (-1009.375) -- 0:00:29
      527500 -- (-1013.135) (-1014.140) [-1007.613] (-1008.745) * (-1008.473) (-1010.094) (-1009.374) [-1012.498] -- 0:00:29
      528000 -- (-1010.070) (-1013.626) [-1011.816] (-1009.918) * (-1010.158) (-1008.087) (-1014.498) [-1010.738] -- 0:00:29
      528500 -- (-1015.784) (-1012.218) (-1010.917) [-1007.187] * (-1006.931) [-1011.767] (-1009.062) (-1007.352) -- 0:00:29
      529000 -- [-1011.022] (-1016.824) (-1008.878) (-1008.844) * (-1007.505) [-1009.619] (-1011.739) (-1007.457) -- 0:00:29
      529500 -- (-1008.694) (-1008.055) (-1009.401) [-1007.235] * (-1007.624) (-1007.586) (-1009.222) [-1008.188] -- 0:00:29
      530000 -- (-1008.717) (-1007.958) [-1010.012] (-1007.405) * (-1008.767) (-1007.969) (-1008.041) [-1015.330] -- 0:00:29

      Average standard deviation of split frequencies: 0.013522

      530500 -- (-1009.348) (-1009.113) [-1008.212] (-1009.680) * (-1006.914) [-1008.038] (-1009.692) (-1012.117) -- 0:00:29
      531000 -- (-1012.259) (-1009.085) [-1007.837] (-1010.366) * (-1007.568) [-1011.015] (-1008.039) (-1009.716) -- 0:00:29
      531500 -- (-1015.400) (-1008.089) [-1007.121] (-1014.420) * (-1009.486) [-1008.336] (-1008.144) (-1008.493) -- 0:00:29
      532000 -- (-1011.017) [-1009.290] (-1008.553) (-1009.946) * (-1010.492) (-1006.722) [-1008.836] (-1013.458) -- 0:00:29
      532500 -- (-1008.021) [-1009.160] (-1011.407) (-1009.032) * (-1010.166) [-1008.045] (-1010.274) (-1009.917) -- 0:00:28
      533000 -- (-1009.581) (-1012.815) [-1011.649] (-1010.267) * [-1007.618] (-1010.296) (-1009.450) (-1012.684) -- 0:00:29
      533500 -- (-1008.256) [-1009.251] (-1010.263) (-1009.376) * (-1011.399) [-1010.874] (-1009.922) (-1011.087) -- 0:00:29
      534000 -- [-1007.734] (-1008.730) (-1007.349) (-1009.330) * [-1008.529] (-1011.183) (-1007.859) (-1007.695) -- 0:00:29
      534500 -- (-1010.868) (-1009.156) [-1007.494] (-1009.089) * [-1008.304] (-1006.993) (-1009.338) (-1008.762) -- 0:00:29
      535000 -- (-1008.605) [-1008.689] (-1012.156) (-1008.041) * (-1009.771) [-1010.223] (-1009.753) (-1008.530) -- 0:00:29

      Average standard deviation of split frequencies: 0.013388

      535500 -- (-1010.447) (-1008.117) (-1009.686) [-1008.299] * (-1009.608) [-1009.705] (-1008.848) (-1007.512) -- 0:00:29
      536000 -- [-1008.497] (-1008.003) (-1010.954) (-1011.942) * (-1008.029) (-1011.204) (-1008.550) [-1007.722] -- 0:00:29
      536500 -- (-1007.166) [-1008.179] (-1010.573) (-1009.294) * (-1009.241) (-1016.369) (-1011.006) [-1007.136] -- 0:00:29
      537000 -- (-1009.013) [-1007.588] (-1007.841) (-1010.740) * [-1010.474] (-1008.397) (-1014.694) (-1012.444) -- 0:00:29
      537500 -- [-1007.553] (-1007.316) (-1008.289) (-1006.638) * (-1008.451) (-1008.339) (-1010.759) [-1012.704] -- 0:00:29
      538000 -- [-1008.777] (-1010.146) (-1008.364) (-1007.115) * (-1009.432) (-1007.680) (-1009.565) [-1012.067] -- 0:00:29
      538500 -- [-1007.056] (-1012.957) (-1012.461) (-1008.720) * [-1009.341] (-1007.680) (-1008.330) (-1011.022) -- 0:00:29
      539000 -- (-1007.031) (-1013.425) [-1008.667] (-1007.965) * (-1012.205) (-1011.092) [-1009.247] (-1010.428) -- 0:00:29
      539500 -- [-1007.486] (-1007.597) (-1007.722) (-1010.184) * (-1011.011) [-1008.989] (-1010.576) (-1009.409) -- 0:00:29
      540000 -- (-1007.217) (-1008.457) (-1007.846) [-1009.171] * (-1014.130) (-1010.473) (-1007.852) [-1007.704] -- 0:00:28

      Average standard deviation of split frequencies: 0.013078

      540500 -- (-1008.126) (-1010.591) [-1008.584] (-1011.525) * (-1009.590) (-1020.550) (-1009.996) [-1008.608] -- 0:00:28
      541000 -- [-1006.853] (-1008.929) (-1010.556) (-1009.452) * (-1008.983) (-1011.400) [-1007.063] (-1008.765) -- 0:00:28
      541500 -- [-1006.741] (-1009.784) (-1010.487) (-1008.300) * (-1009.753) (-1008.185) (-1008.602) [-1010.072] -- 0:00:28
      542000 -- (-1007.957) (-1006.626) [-1008.284] (-1008.464) * (-1020.817) (-1010.005) [-1012.086] (-1007.167) -- 0:00:28
      542500 -- (-1007.956) (-1008.287) (-1009.179) [-1007.820] * (-1006.738) (-1010.074) [-1007.368] (-1014.209) -- 0:00:28
      543000 -- (-1008.163) [-1008.103] (-1009.964) (-1009.491) * (-1010.906) (-1007.520) [-1007.420] (-1007.786) -- 0:00:28
      543500 -- (-1007.184) (-1009.639) (-1009.452) [-1008.094] * (-1008.281) (-1008.814) [-1007.966] (-1012.894) -- 0:00:28
      544000 -- (-1012.473) (-1007.285) (-1007.758) [-1007.979] * (-1010.467) [-1008.183] (-1007.434) (-1012.008) -- 0:00:28
      544500 -- (-1008.507) [-1006.457] (-1008.222) (-1008.562) * (-1008.761) (-1011.137) (-1010.186) [-1008.553] -- 0:00:28
      545000 -- (-1008.523) (-1006.869) [-1008.268] (-1008.332) * (-1009.058) [-1011.275] (-1009.636) (-1007.748) -- 0:00:28

      Average standard deviation of split frequencies: 0.012567

      545500 -- (-1008.528) (-1007.462) [-1007.608] (-1008.904) * (-1011.095) [-1008.585] (-1008.645) (-1007.965) -- 0:00:28
      546000 -- (-1012.219) (-1007.812) (-1009.258) [-1007.568] * (-1009.555) (-1012.393) (-1007.458) [-1006.829] -- 0:00:28
      546500 -- [-1009.396] (-1010.095) (-1009.040) (-1011.295) * (-1009.647) (-1008.780) (-1007.024) [-1007.030] -- 0:00:28
      547000 -- [-1009.128] (-1008.231) (-1007.994) (-1011.225) * (-1009.745) (-1008.325) (-1012.614) [-1007.506] -- 0:00:28
      547500 -- (-1013.037) [-1008.217] (-1008.189) (-1008.001) * (-1008.056) (-1008.703) (-1011.088) [-1008.206] -- 0:00:28
      548000 -- (-1009.037) [-1009.885] (-1009.817) (-1014.442) * (-1008.017) (-1010.111) (-1012.864) [-1008.587] -- 0:00:28
      548500 -- (-1009.257) [-1013.265] (-1010.255) (-1013.170) * (-1009.165) [-1010.217] (-1009.742) (-1007.325) -- 0:00:28
      549000 -- (-1010.142) (-1013.072) [-1009.687] (-1009.483) * (-1008.925) [-1011.892] (-1010.339) (-1008.970) -- 0:00:28
      549500 -- (-1009.092) (-1008.712) [-1009.037] (-1010.463) * (-1010.230) (-1012.012) [-1008.588] (-1008.703) -- 0:00:28
      550000 -- (-1009.426) (-1007.808) [-1008.077] (-1008.668) * (-1010.193) (-1009.100) (-1007.794) [-1010.610] -- 0:00:28

      Average standard deviation of split frequencies: 0.012791

      550500 -- (-1009.587) (-1007.484) (-1007.819) [-1011.976] * (-1010.383) (-1008.176) (-1011.533) [-1008.536] -- 0:00:28
      551000 -- (-1010.886) (-1007.261) (-1012.889) [-1012.171] * (-1011.216) [-1008.481] (-1009.466) (-1008.439) -- 0:00:28
      551500 -- (-1009.720) [-1013.443] (-1009.195) (-1009.556) * [-1010.108] (-1009.817) (-1007.982) (-1008.439) -- 0:00:28
      552000 -- (-1010.428) (-1008.071) (-1008.587) [-1011.986] * (-1008.418) (-1007.128) [-1009.299] (-1010.838) -- 0:00:28
      552500 -- (-1013.628) [-1007.472] (-1008.788) (-1012.238) * (-1010.094) (-1012.202) (-1009.246) [-1008.967] -- 0:00:28
      553000 -- [-1008.481] (-1012.075) (-1011.848) (-1008.881) * (-1013.468) (-1007.493) [-1007.985] (-1008.260) -- 0:00:28
      553500 -- (-1007.392) [-1007.216] (-1015.828) (-1010.660) * (-1012.640) (-1007.303) (-1008.530) [-1007.162] -- 0:00:28
      554000 -- (-1009.450) (-1007.033) [-1009.545] (-1009.578) * (-1010.101) (-1010.843) (-1008.426) [-1007.566] -- 0:00:28
      554500 -- [-1007.242] (-1009.479) (-1010.294) (-1012.270) * [-1008.116] (-1010.108) (-1010.287) (-1008.017) -- 0:00:28
      555000 -- (-1007.978) (-1010.999) [-1009.405] (-1007.259) * (-1009.505) [-1007.799] (-1009.479) (-1010.594) -- 0:00:28

      Average standard deviation of split frequencies: 0.012718

      555500 -- (-1012.015) [-1009.834] (-1012.044) (-1008.983) * [-1007.334] (-1009.066) (-1009.677) (-1009.358) -- 0:00:28
      556000 -- (-1010.201) (-1007.133) (-1009.821) [-1007.164] * (-1010.368) (-1008.630) (-1008.486) [-1010.210] -- 0:00:27
      556500 -- [-1008.244] (-1009.513) (-1007.740) (-1007.820) * (-1009.514) (-1010.435) [-1010.736] (-1008.754) -- 0:00:27
      557000 -- (-1010.581) [-1009.771] (-1008.804) (-1008.337) * (-1010.943) (-1010.899) (-1007.729) [-1007.562] -- 0:00:27
      557500 -- (-1011.003) (-1009.644) [-1008.921] (-1008.810) * (-1010.656) (-1007.989) (-1007.400) [-1007.128] -- 0:00:27
      558000 -- (-1008.534) [-1007.919] (-1012.092) (-1008.810) * (-1011.933) (-1009.990) [-1009.083] (-1008.031) -- 0:00:27
      558500 -- (-1007.660) [-1008.555] (-1010.625) (-1008.939) * (-1010.122) (-1009.783) (-1009.763) [-1009.028] -- 0:00:27
      559000 -- [-1008.213] (-1008.263) (-1007.759) (-1007.773) * (-1007.450) (-1007.338) (-1008.848) [-1007.947] -- 0:00:27
      559500 -- (-1008.178) (-1008.601) (-1009.110) [-1008.231] * (-1007.884) [-1010.702] (-1011.994) (-1009.029) -- 0:00:27
      560000 -- (-1012.075) (-1009.619) [-1009.538] (-1010.814) * [-1007.782] (-1011.733) (-1008.759) (-1012.301) -- 0:00:27

      Average standard deviation of split frequencies: 0.013057

      560500 -- (-1009.576) [-1008.605] (-1009.924) (-1010.138) * [-1007.685] (-1013.168) (-1007.859) (-1013.887) -- 0:00:27
      561000 -- [-1007.025] (-1009.422) (-1007.857) (-1008.015) * (-1007.706) (-1009.315) [-1007.278] (-1009.534) -- 0:00:27
      561500 -- (-1010.028) (-1009.620) (-1007.950) [-1007.209] * (-1010.627) (-1009.814) [-1007.278] (-1007.215) -- 0:00:27
      562000 -- (-1010.579) (-1012.430) [-1009.246] (-1007.616) * (-1009.035) (-1009.919) (-1007.839) [-1009.714] -- 0:00:27
      562500 -- [-1008.638] (-1011.994) (-1008.493) (-1010.745) * (-1007.518) (-1009.214) (-1007.082) [-1007.882] -- 0:00:27
      563000 -- (-1008.358) (-1015.504) [-1006.951] (-1008.141) * (-1008.721) (-1008.015) [-1007.255] (-1011.210) -- 0:00:27
      563500 -- (-1010.323) (-1011.129) (-1009.977) [-1008.397] * (-1009.639) (-1010.954) [-1008.534] (-1011.073) -- 0:00:27
      564000 -- [-1010.005] (-1013.979) (-1010.720) (-1009.760) * [-1009.642] (-1010.252) (-1008.357) (-1011.005) -- 0:00:27
      564500 -- [-1007.461] (-1011.765) (-1009.469) (-1011.381) * (-1010.729) (-1011.604) (-1007.637) [-1008.573] -- 0:00:27
      565000 -- (-1008.727) (-1009.467) [-1007.119] (-1006.920) * (-1006.727) [-1008.727] (-1006.731) (-1008.650) -- 0:00:27

      Average standard deviation of split frequencies: 0.013032

      565500 -- (-1009.218) [-1007.317] (-1007.779) (-1008.278) * (-1009.283) (-1007.695) [-1009.962] (-1008.978) -- 0:00:27
      566000 -- [-1010.533] (-1007.255) (-1010.195) (-1009.279) * [-1008.967] (-1006.813) (-1007.372) (-1007.208) -- 0:00:27
      566500 -- (-1010.836) (-1011.977) (-1010.485) [-1009.318] * (-1009.274) (-1016.027) [-1007.098] (-1011.177) -- 0:00:27
      567000 -- [-1011.309] (-1018.306) (-1007.207) (-1009.139) * (-1007.702) [-1009.407] (-1008.299) (-1009.726) -- 0:00:27
      567500 -- (-1009.602) (-1008.854) [-1008.606] (-1010.865) * [-1007.226] (-1011.250) (-1012.448) (-1009.891) -- 0:00:27
      568000 -- (-1010.538) (-1006.960) [-1009.236] (-1008.647) * (-1007.399) [-1007.838] (-1011.280) (-1009.371) -- 0:00:27
      568500 -- (-1010.597) (-1006.819) [-1009.233] (-1009.388) * (-1008.502) [-1007.424] (-1008.484) (-1013.350) -- 0:00:27
      569000 -- (-1009.426) [-1006.792] (-1010.290) (-1009.412) * (-1007.319) (-1008.706) (-1010.288) [-1009.994] -- 0:00:27
      569500 -- (-1009.595) [-1006.647] (-1010.662) (-1008.944) * (-1008.392) (-1007.603) [-1006.703] (-1009.122) -- 0:00:27
      570000 -- [-1008.716] (-1006.939) (-1008.871) (-1010.865) * (-1010.195) (-1008.223) (-1009.172) [-1009.456] -- 0:00:27

      Average standard deviation of split frequencies: 0.013363

      570500 -- (-1009.772) (-1009.602) (-1009.599) [-1008.331] * (-1011.631) (-1009.849) (-1010.456) [-1008.687] -- 0:00:27
      571000 -- [-1014.925] (-1009.871) (-1008.684) (-1009.940) * (-1013.272) [-1010.277] (-1007.974) (-1010.217) -- 0:00:27
      571500 -- (-1012.458) (-1007.088) (-1008.566) [-1008.906] * (-1010.531) (-1007.583) (-1006.974) [-1007.868] -- 0:00:26
      572000 -- (-1008.530) [-1012.180] (-1009.329) (-1007.292) * [-1006.724] (-1008.592) (-1007.203) (-1007.616) -- 0:00:26
      572500 -- [-1012.102] (-1007.925) (-1007.702) (-1009.428) * (-1006.432) (-1009.278) (-1007.670) [-1007.906] -- 0:00:26
      573000 -- (-1012.853) [-1012.930] (-1007.184) (-1010.175) * (-1007.854) (-1006.726) (-1011.003) [-1008.543] -- 0:00:26
      573500 -- (-1009.284) (-1008.501) [-1012.772] (-1008.307) * (-1008.421) (-1008.513) (-1009.322) [-1010.133] -- 0:00:26
      574000 -- [-1007.834] (-1010.721) (-1009.930) (-1007.334) * (-1007.601) [-1010.757] (-1011.525) (-1008.719) -- 0:00:26
      574500 -- [-1009.233] (-1013.636) (-1007.973) (-1007.774) * [-1008.045] (-1009.105) (-1008.882) (-1007.596) -- 0:00:26
      575000 -- (-1008.932) (-1007.344) [-1007.874] (-1010.660) * (-1009.718) (-1014.332) [-1009.857] (-1006.964) -- 0:00:26

      Average standard deviation of split frequencies: 0.012902

      575500 -- (-1014.931) (-1007.480) [-1008.235] (-100