--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:15:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1661/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1008.14         -1011.08
2      -1008.15         -1011.64
--------------------------------------
TOTAL    -1008.15         -1011.40
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892381    0.087024    0.371087    1.471015    0.860947   1501.00   1501.00    1.000
r(A<->C){all}   0.163758    0.020486    0.000031    0.465426    0.126773     96.55    173.30    1.003
r(A<->G){all}   0.178784    0.021452    0.000076    0.464542    0.138304    112.74    156.09    1.000
r(A<->T){all}   0.162939    0.020033    0.000145    0.454404    0.121681    101.46    134.51    1.008
r(C<->G){all}   0.167028    0.021859    0.000027    0.475773    0.123339    165.38    230.79    1.000
r(C<->T){all}   0.162384    0.020731    0.000032    0.458304    0.120614    168.66    183.90    1.010
r(G<->T){all}   0.165106    0.019836    0.000354    0.448175    0.125252    205.47    288.83    1.002
pi(A){all}      0.215222    0.000228    0.188876    0.246685    0.214923   1330.99   1404.25    1.001
pi(C){all}      0.276730    0.000257    0.244619    0.308080    0.276846   1266.75   1271.80    1.001
pi(G){all}      0.331115    0.000284    0.298472    0.365147    0.330630   1314.64   1368.83    1.000
pi(T){all}      0.176934    0.000205    0.150090    0.205454    0.176736   1225.67   1293.22    1.000
alpha{1,2}      0.428076    0.237010    0.000141    1.428335    0.265852   1169.45   1307.66    1.000
alpha{3}        0.448949    0.222485    0.000130    1.402621    0.297875   1362.39   1374.85    1.000
pinvar{all}     0.997929    0.000006    0.993294    0.999999    0.998719   1246.19   1331.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-957.779453
Model 2: PositiveSelection	-957.779453
Model 0: one-ratio	-957.77997
Model 7: beta	-957.779453
Model 8: beta&w>1	-957.77986


Model 0 vs 1	0.001034000000117885

Model 2 vs 1	0.0

Model 8 vs 7	8.139999999912106E-4
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247 

C1              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
                **************************************************

C1              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
                **************************************************

C1              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
                **************************************************

C1              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
                **************************************************

C1              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  247 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  247 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7410]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7410]--->[7410]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C2              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C3              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C4              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C5              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
C6              MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
                **************************************************

C1              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C2              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C3              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C4              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C5              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
C6              LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
                **************************************************

C1              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C2              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C3              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C4              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C5              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
C6              AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
                **************************************************

C1              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C2              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C3              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C4              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C5              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
C6              RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
                **************************************************

C1              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C2              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C3              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C4              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C5              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
C6              RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C2              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C3              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C4              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C5              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
C6              ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
                **************************************************

C1              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C2              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C3              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C4              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C5              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
C6              CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
                **************************************************

C1              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C2              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C3              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C4              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C5              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
C6              GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
                **************************************************

C1              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C2              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C3              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C4              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C5              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
C6              TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
                **************************************************

C1              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C2              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C3              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C4              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C5              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
C6              CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
                **************************************************

C1              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C2              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C3              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C4              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C5              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
C6              AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
                **************************************************

C1              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C2              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C3              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C4              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C5              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
C6              GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
                **************************************************

C1              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C2              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C3              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C4              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C5              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
C6              GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
                **************************************************

C1              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C2              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C3              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C4              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C5              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
C6              CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
                **************************************************

C1              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C2              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C3              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C4              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C5              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
C6              CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
                **************************************************

C1              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C2              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C3              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C4              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C5              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
C6              CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
                **************************************************

C1              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C2              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C3              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C4              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C5              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
C6              CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
                **************************************************

C1              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C2              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C3              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C4              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C5              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
C6              CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
                **************************************************

C1              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C2              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C3              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C4              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C5              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
C6              CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
                **************************************************

C1              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C2              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C3              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C4              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C5              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
C6              AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
                *****************************************



>C1
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C2
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C3
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C4
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C5
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C6
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>C1
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C2
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C3
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C4
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C5
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>C6
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 741 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857260
      Setting output file names to "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 353694223
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5597914545
      Seed = 1215641637
      Swapseed = 1579857260
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1658.393524 -- -24.965149
         Chain 2 -- -1658.393271 -- -24.965149
         Chain 3 -- -1658.393524 -- -24.965149
         Chain 4 -- -1658.393524 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1658.393524 -- -24.965149
         Chain 2 -- -1658.393524 -- -24.965149
         Chain 3 -- -1658.393524 -- -24.965149
         Chain 4 -- -1658.393429 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1658.394] (-1658.393) (-1658.394) (-1658.394) * [-1658.394] (-1658.394) (-1658.394) (-1658.393) 
        500 -- (-1031.861) (-1017.553) (-1025.933) [-1013.843] * (-1022.038) (-1021.999) [-1017.748] (-1027.858) -- 0:00:00
       1000 -- (-1019.737) [-1016.194] (-1019.724) (-1012.420) * (-1029.613) (-1017.330) [-1013.435] (-1022.888) -- 0:00:00
       1500 -- (-1025.184) (-1022.315) (-1020.040) [-1021.493] * (-1022.802) (-1019.389) [-1016.565] (-1013.781) -- 0:00:00
       2000 -- (-1027.832) (-1018.352) (-1024.480) [-1014.107] * (-1015.329) (-1016.346) [-1014.961] (-1010.985) -- 0:00:00
       2500 -- (-1018.776) (-1019.959) (-1017.666) [-1017.948] * (-1014.853) (-1013.984) (-1017.008) [-1019.922] -- 0:00:00
       3000 -- (-1017.807) (-1025.490) [-1014.280] (-1013.657) * (-1022.261) (-1019.883) (-1016.423) [-1021.552] -- 0:00:00
       3500 -- (-1018.671) (-1013.350) (-1020.242) [-1012.357] * (-1028.295) (-1014.668) (-1021.011) [-1020.194] -- 0:00:00
       4000 -- (-1020.892) [-1012.713] (-1016.832) (-1015.869) * (-1015.899) [-1016.925] (-1020.170) (-1019.248) -- 0:00:00
       4500 -- (-1011.620) [-1018.927] (-1017.010) (-1019.621) * (-1019.297) (-1013.783) (-1016.549) [-1016.172] -- 0:00:00
       5000 -- [-1016.318] (-1022.782) (-1026.994) (-1022.346) * (-1023.831) [-1010.181] (-1027.321) (-1014.945) -- 0:00:00

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-1019.949) (-1021.553) [-1020.528] (-1019.217) * (-1014.935) (-1013.217) [-1020.748] (-1021.085) -- 0:00:00
       6000 -- (-1019.063) (-1017.075) [-1014.233] (-1022.006) * (-1019.914) (-1017.922) (-1018.926) [-1013.429] -- 0:00:00
       6500 -- (-1025.149) (-1012.710) (-1018.378) [-1017.860] * (-1022.149) [-1017.596] (-1020.942) (-1015.168) -- 0:00:00
       7000 -- [-1016.425] (-1022.237) (-1026.932) (-1026.760) * (-1016.963) (-1021.418) (-1019.391) [-1016.441] -- 0:00:00
       7500 -- (-1021.756) (-1020.507) (-1024.448) [-1010.243] * (-1013.651) (-1019.309) (-1024.956) [-1028.414] -- 0:00:00
       8000 -- (-1018.441) (-1017.572) [-1017.059] (-1017.054) * (-1021.656) (-1024.954) [-1014.236] (-1017.150) -- 0:00:00
       8500 -- (-1020.397) [-1020.814] (-1012.471) (-1016.754) * (-1023.180) (-1015.967) [-1016.897] (-1017.890) -- 0:00:00
       9000 -- (-1025.020) (-1016.627) [-1012.223] (-1020.792) * (-1026.815) (-1026.963) [-1013.462] (-1021.280) -- 0:00:00
       9500 -- (-1016.701) (-1024.922) (-1014.247) [-1013.569] * (-1019.400) (-1015.321) (-1016.743) [-1018.525] -- 0:01:44
      10000 -- (-1020.103) (-1020.865) (-1024.254) [-1019.817] * (-1015.924) (-1023.496) (-1013.020) [-1020.605] -- 0:01:39

      Average standard deviation of split frequencies: 0.062608

      10500 -- (-1015.403) (-1018.021) (-1014.188) [-1015.321] * (-1024.615) [-1016.872] (-1018.019) (-1018.565) -- 0:01:34
      11000 -- (-1019.308) (-1019.419) (-1017.915) [-1015.713] * [-1013.412] (-1015.330) (-1023.291) (-1020.454) -- 0:01:29
      11500 -- (-1015.677) (-1015.992) (-1015.457) [-1015.048] * (-1015.943) [-1016.058] (-1024.149) (-1018.433) -- 0:01:25
      12000 -- (-1025.918) (-1024.227) [-1010.495] (-1021.220) * (-1010.667) [-1019.708] (-1026.373) (-1014.577) -- 0:01:22
      12500 -- (-1019.380) (-1020.666) [-1019.156] (-1018.510) * (-1022.868) (-1017.359) [-1023.035] (-1021.873) -- 0:01:19
      13000 -- [-1020.284] (-1031.878) (-1019.499) (-1017.966) * (-1024.703) (-1014.961) (-1021.300) [-1013.739] -- 0:01:15
      13500 -- (-1013.822) (-1013.497) [-1017.896] (-1019.307) * (-1016.322) (-1020.403) (-1019.432) [-1022.382] -- 0:01:13
      14000 -- (-1027.269) (-1014.949) [-1018.670] (-1020.396) * (-1024.602) [-1018.802] (-1015.483) (-1017.588) -- 0:01:10
      14500 -- (-1018.774) [-1014.301] (-1023.402) (-1024.182) * [-1015.710] (-1024.996) (-1018.031) (-1020.127) -- 0:01:07
      15000 -- (-1014.604) [-1017.488] (-1020.045) (-1017.770) * (-1023.144) [-1015.507] (-1017.007) (-1028.564) -- 0:01:05

      Average standard deviation of split frequencies: 0.054274

      15500 -- [-1010.958] (-1024.317) (-1026.460) (-1014.537) * (-1017.261) (-1019.779) (-1015.869) [-1010.046] -- 0:01:03
      16000 -- (-1021.103) (-1015.456) (-1018.549) [-1017.040] * [-1016.505] (-1024.767) (-1012.719) (-1009.743) -- 0:01:01
      16500 -- (-1012.912) (-1014.180) [-1015.243] (-1024.702) * (-1025.080) (-1017.237) (-1017.276) [-1008.671] -- 0:00:59
      17000 -- [-1017.222] (-1013.087) (-1021.754) (-1018.880) * (-1020.544) (-1012.055) (-1021.385) [-1007.714] -- 0:00:57
      17500 -- (-1017.089) (-1021.846) (-1016.802) [-1016.323] * (-1019.105) [-1019.290] (-1030.213) (-1010.170) -- 0:00:56
      18000 -- (-1014.532) (-1018.071) (-1018.617) [-1010.704] * [-1020.211] (-1018.705) (-1019.793) (-1008.401) -- 0:00:54
      18500 -- (-1019.106) (-1017.435) (-1011.775) [-1018.658] * [-1013.868] (-1020.951) (-1027.657) (-1008.385) -- 0:00:53
      19000 -- (-1017.945) (-1019.031) [-1013.193] (-1021.436) * (-1014.480) (-1020.622) (-1023.178) [-1007.840] -- 0:00:51
      19500 -- [-1019.527] (-1017.754) (-1028.765) (-1016.455) * (-1019.604) (-1014.548) (-1012.619) [-1007.981] -- 0:00:50
      20000 -- (-1020.527) (-1015.087) (-1024.939) [-1019.945] * [-1013.947] (-1021.395) (-1008.903) (-1010.173) -- 0:00:49

      Average standard deviation of split frequencies: 0.051702

      20500 -- (-1021.857) [-1016.933] (-1021.689) (-1023.742) * (-1018.680) [-1020.149] (-1007.968) (-1009.291) -- 0:00:47
      21000 -- [-1018.744] (-1025.668) (-1020.450) (-1012.751) * (-1026.848) [-1018.905] (-1007.478) (-1008.307) -- 0:00:46
      21500 -- (-1025.876) [-1021.314] (-1018.060) (-1018.627) * (-1018.364) (-1015.794) [-1007.978] (-1008.741) -- 0:00:45
      22000 -- [-1017.946] (-1022.415) (-1027.012) (-1026.642) * (-1022.658) (-1020.022) (-1012.391) [-1009.357] -- 0:00:44
      22500 -- (-1026.391) (-1015.935) (-1017.011) [-1019.717] * (-1019.089) [-1015.796] (-1008.996) (-1010.553) -- 0:00:43
      23000 -- (-1024.010) [-1016.029] (-1036.604) (-1015.092) * [-1010.772] (-1012.482) (-1007.775) (-1009.276) -- 0:00:42
      23500 -- [-1013.441] (-1021.722) (-1009.163) (-1020.431) * (-1022.763) (-1028.709) [-1013.179] (-1007.053) -- 0:00:41
      24000 -- (-1011.740) [-1018.208] (-1013.471) (-1020.758) * (-1017.957) (-1014.711) (-1009.673) [-1009.398] -- 0:00:40
      24500 -- (-1010.689) [-1013.584] (-1010.198) (-1016.070) * [-1018.323] (-1010.096) (-1007.505) (-1006.965) -- 0:00:39
      25000 -- (-1007.720) [-1019.436] (-1012.522) (-1015.760) * (-1014.766) (-1008.879) (-1008.415) [-1007.321] -- 0:01:18

      Average standard deviation of split frequencies: 0.048624

      25500 -- (-1007.807) [-1018.732] (-1007.989) (-1026.984) * (-1023.115) (-1008.676) (-1009.225) [-1007.675] -- 0:01:16
      26000 -- (-1008.794) [-1017.736] (-1007.661) (-1019.309) * (-1013.203) [-1007.258] (-1008.394) (-1009.794) -- 0:01:14
      26500 -- [-1008.742] (-1024.023) (-1007.084) (-1017.714) * [-1016.403] (-1008.653) (-1013.414) (-1007.889) -- 0:01:13
      27000 -- [-1010.395] (-1014.579) (-1007.237) (-1015.577) * [-1014.643] (-1009.876) (-1009.148) (-1008.221) -- 0:01:12
      27500 -- (-1010.161) [-1014.885] (-1010.075) (-1018.387) * [-1018.831] (-1007.844) (-1008.125) (-1008.018) -- 0:01:10
      28000 -- (-1013.767) (-1014.352) (-1007.977) [-1016.860] * (-1022.134) (-1007.460) [-1008.018] (-1008.303) -- 0:01:09
      28500 -- (-1014.306) (-1017.202) [-1007.923] (-1019.918) * (-1014.168) [-1008.021] (-1008.858) (-1009.343) -- 0:01:08
      29000 -- [-1007.711] (-1017.352) (-1008.924) (-1018.298) * (-1025.199) (-1010.124) (-1011.215) [-1009.822] -- 0:01:06
      29500 -- (-1007.236) [-1020.813] (-1009.014) (-1012.674) * (-1011.414) [-1008.238] (-1008.709) (-1009.030) -- 0:01:05
      30000 -- (-1008.612) [-1018.921] (-1007.880) (-1013.853) * [-1020.252] (-1008.327) (-1008.092) (-1010.489) -- 0:01:04

      Average standard deviation of split frequencies: 0.042456

      30500 -- [-1007.820] (-1018.489) (-1006.895) (-1013.301) * (-1019.785) (-1008.825) [-1007.672] (-1011.919) -- 0:01:03
      31000 -- (-1007.775) (-1014.691) (-1008.654) [-1017.303] * (-1019.908) [-1008.311] (-1007.677) (-1007.668) -- 0:01:02
      31500 -- (-1007.030) (-1021.808) [-1010.122] (-1017.594) * (-1033.510) (-1007.396) (-1009.906) [-1008.116] -- 0:01:01
      32000 -- (-1006.999) (-1016.170) [-1009.283] (-1021.348) * (-1011.710) [-1007.428] (-1008.239) (-1008.242) -- 0:01:00
      32500 -- [-1007.464] (-1019.016) (-1009.671) (-1015.294) * (-1024.891) (-1011.209) (-1008.652) [-1008.291] -- 0:00:59
      33000 -- [-1007.936] (-1019.039) (-1008.592) (-1018.387) * [-1009.279] (-1008.746) (-1008.880) (-1007.366) -- 0:00:58
      33500 -- (-1007.326) (-1015.007) [-1007.789] (-1026.175) * (-1009.125) (-1010.352) [-1008.839] (-1008.013) -- 0:00:57
      34000 -- (-1010.456) (-1018.484) (-1007.983) [-1016.035] * (-1007.602) (-1010.254) (-1007.851) [-1007.538] -- 0:00:56
      34500 -- (-1009.524) (-1014.794) [-1008.978] (-1016.914) * [-1007.005] (-1012.338) (-1008.075) (-1010.755) -- 0:00:55
      35000 -- (-1011.129) (-1012.454) (-1008.471) [-1014.966] * (-1007.057) (-1010.178) [-1007.068] (-1014.092) -- 0:00:55

      Average standard deviation of split frequencies: 0.036166

      35500 -- (-1008.582) (-1014.762) (-1006.842) [-1013.330] * (-1011.612) (-1012.033) (-1010.429) [-1012.498] -- 0:00:54
      36000 -- (-1009.119) (-1020.794) (-1010.190) [-1014.151] * (-1010.479) (-1010.073) (-1008.260) [-1011.444] -- 0:00:53
      36500 -- [-1009.389] (-1016.776) (-1008.112) (-1020.449) * (-1009.109) [-1009.609] (-1009.158) (-1009.507) -- 0:00:52
      37000 -- [-1008.039] (-1016.966) (-1009.420) (-1021.153) * (-1008.092) (-1008.065) [-1013.153] (-1008.441) -- 0:00:52
      37500 -- [-1007.986] (-1017.007) (-1007.278) (-1008.241) * (-1009.320) (-1010.407) (-1008.650) [-1008.165] -- 0:00:51
      38000 -- (-1013.090) (-1031.439) (-1008.838) [-1008.607] * (-1008.512) (-1008.430) (-1009.199) [-1008.309] -- 0:00:50
      38500 -- (-1009.041) (-1020.147) (-1009.293) [-1007.971] * (-1007.759) (-1013.058) (-1008.592) [-1007.892] -- 0:00:49
      39000 -- [-1009.120] (-1013.157) (-1008.294) (-1010.516) * (-1016.217) (-1011.030) (-1009.028) [-1010.607] -- 0:00:49
      39500 -- (-1007.537) (-1020.001) [-1009.410] (-1008.469) * (-1012.653) (-1010.360) (-1016.394) [-1009.112] -- 0:00:48
      40000 -- (-1008.241) (-1015.849) [-1008.393] (-1007.361) * [-1007.682] (-1010.764) (-1013.721) (-1007.852) -- 0:00:48

      Average standard deviation of split frequencies: 0.032335

      40500 -- (-1007.793) (-1017.324) (-1010.521) [-1007.630] * [-1007.057] (-1013.695) (-1015.351) (-1006.821) -- 0:00:47
      41000 -- (-1008.990) (-1018.523) [-1007.520] (-1007.784) * (-1008.561) [-1014.687] (-1010.401) (-1007.487) -- 0:01:10
      41500 -- [-1009.661] (-1018.412) (-1008.192) (-1008.156) * (-1010.960) [-1014.729] (-1007.480) (-1008.281) -- 0:01:09
      42000 -- (-1008.799) (-1013.881) [-1007.278] (-1008.682) * (-1008.297) [-1011.797] (-1007.282) (-1009.304) -- 0:01:08
      42500 -- (-1009.935) (-1019.699) (-1008.059) [-1006.888] * (-1007.936) [-1007.876] (-1008.155) (-1010.213) -- 0:01:07
      43000 -- (-1014.065) (-1015.868) (-1008.334) [-1009.036] * [-1008.023] (-1007.655) (-1008.176) (-1009.568) -- 0:01:06
      43500 -- (-1012.864) (-1014.045) (-1008.727) [-1009.428] * (-1009.412) [-1010.490] (-1007.328) (-1008.204) -- 0:01:05
      44000 -- (-1011.761) (-1018.226) (-1007.558) [-1008.133] * (-1009.858) (-1013.945) [-1008.050] (-1007.627) -- 0:01:05
      44500 -- [-1011.764] (-1028.974) (-1009.912) (-1009.111) * (-1007.921) [-1010.428] (-1007.685) (-1007.070) -- 0:01:04
      45000 -- (-1011.028) (-1017.909) (-1007.306) [-1008.664] * (-1008.277) [-1008.777] (-1008.001) (-1007.629) -- 0:01:03

      Average standard deviation of split frequencies: 0.029768

      45500 -- (-1011.795) (-1013.680) [-1008.325] (-1008.083) * [-1009.430] (-1009.041) (-1009.963) (-1007.539) -- 0:01:02
      46000 -- (-1010.717) (-1020.771) [-1007.567] (-1007.935) * (-1008.118) (-1011.540) (-1010.960) [-1007.622] -- 0:01:02
      46500 -- (-1011.656) (-1017.346) (-1008.902) [-1007.354] * (-1007.903) (-1009.582) (-1009.263) [-1008.416] -- 0:01:01
      47000 -- (-1009.516) (-1017.957) [-1007.244] (-1009.850) * (-1008.426) (-1011.135) (-1007.953) [-1008.870] -- 0:01:00
      47500 -- (-1010.602) (-1020.084) [-1009.138] (-1010.782) * (-1007.913) (-1008.120) (-1009.402) [-1010.933] -- 0:01:00
      48000 -- (-1008.736) (-1012.583) [-1009.490] (-1010.458) * (-1007.915) (-1008.762) [-1010.090] (-1008.674) -- 0:00:59
      48500 -- (-1009.181) (-1017.381) (-1008.061) [-1009.707] * (-1007.981) (-1012.702) (-1008.544) [-1011.904] -- 0:00:58
      49000 -- (-1011.744) (-1024.465) [-1008.165] (-1009.622) * (-1007.340) (-1010.216) (-1010.348) [-1009.288] -- 0:00:58
      49500 -- (-1010.135) (-1023.564) (-1008.950) [-1009.538] * (-1010.723) (-1011.836) (-1008.480) [-1008.111] -- 0:00:57
      50000 -- [-1011.968] (-1014.907) (-1008.910) (-1012.070) * (-1011.500) (-1009.179) (-1009.057) [-1009.236] -- 0:00:57

      Average standard deviation of split frequencies: 0.029463

      50500 -- (-1009.355) (-1018.760) (-1008.276) [-1015.263] * (-1008.391) (-1008.172) (-1008.587) [-1008.450] -- 0:00:56
      51000 -- [-1010.615] (-1017.342) (-1009.057) (-1010.416) * (-1007.897) (-1008.780) (-1009.734) [-1009.003] -- 0:00:55
      51500 -- (-1012.779) [-1016.569] (-1009.495) (-1015.267) * [-1008.344] (-1007.052) (-1009.538) (-1007.583) -- 0:00:55
      52000 -- [-1012.241] (-1023.591) (-1010.371) (-1010.332) * (-1008.198) (-1007.392) (-1009.922) [-1009.973] -- 0:00:54
      52500 -- (-1009.046) (-1019.673) (-1013.605) [-1010.039] * (-1008.126) (-1010.352) (-1011.275) [-1009.343] -- 0:00:54
      53000 -- (-1011.340) [-1016.466] (-1015.856) (-1008.081) * (-1008.255) (-1011.626) [-1008.492] (-1008.043) -- 0:00:53
      53500 -- [-1008.144] (-1016.008) (-1010.436) (-1011.396) * (-1009.826) (-1011.891) (-1010.246) [-1010.068] -- 0:00:53
      54000 -- (-1009.098) [-1013.735] (-1008.085) (-1012.057) * [-1009.561] (-1011.196) (-1011.862) (-1010.075) -- 0:00:52
      54500 -- (-1007.637) (-1014.571) (-1009.180) [-1008.089] * (-1011.423) (-1008.643) (-1012.173) [-1014.235] -- 0:00:52
      55000 -- [-1007.753] (-1012.455) (-1009.501) (-1007.983) * (-1008.466) (-1007.097) (-1010.487) [-1009.654] -- 0:00:51

      Average standard deviation of split frequencies: 0.030398

      55500 -- (-1007.377) (-1020.988) (-1012.481) [-1008.853] * [-1010.613] (-1008.755) (-1011.446) (-1009.289) -- 0:00:51
      56000 -- (-1007.379) (-1029.476) (-1012.494) [-1010.693] * (-1008.013) [-1007.773] (-1008.482) (-1008.262) -- 0:00:50
      56500 -- (-1009.787) (-1013.576) (-1010.260) [-1008.231] * (-1009.346) [-1008.033] (-1008.043) (-1010.406) -- 0:00:50
      57000 -- (-1012.251) (-1020.332) [-1008.849] (-1007.389) * (-1008.638) [-1010.357] (-1009.657) (-1009.561) -- 0:01:06
      57500 -- (-1011.361) [-1023.089] (-1011.705) (-1008.944) * (-1011.835) (-1011.213) (-1012.970) [-1009.052] -- 0:01:05
      58000 -- (-1009.209) (-1022.272) [-1009.594] (-1008.514) * (-1012.752) (-1009.414) [-1012.525] (-1010.037) -- 0:01:04
      58500 -- (-1010.808) [-1021.209] (-1008.380) (-1008.501) * (-1010.184) (-1015.029) (-1014.101) [-1008.686] -- 0:01:04
      59000 -- (-1014.705) (-1012.486) [-1011.832] (-1012.586) * (-1008.227) [-1008.301] (-1007.092) (-1011.742) -- 0:01:03
      59500 -- (-1009.377) (-1014.303) [-1008.466] (-1012.336) * (-1007.817) (-1007.385) [-1009.039] (-1009.344) -- 0:01:03
      60000 -- (-1014.889) (-1018.685) (-1007.783) [-1011.554] * (-1009.028) (-1006.986) [-1010.411] (-1007.928) -- 0:01:02

      Average standard deviation of split frequencies: 0.030693

      60500 -- (-1008.406) [-1016.411] (-1007.562) (-1009.860) * (-1007.921) (-1008.163) [-1009.640] (-1008.100) -- 0:01:02
      61000 -- (-1009.555) (-1025.413) [-1006.982] (-1010.913) * (-1006.648) (-1008.306) (-1011.244) [-1010.163] -- 0:01:01
      61500 -- [-1008.694] (-1028.024) (-1007.110) (-1009.370) * (-1008.386) [-1008.073] (-1008.153) (-1011.027) -- 0:01:01
      62000 -- (-1008.043) (-1020.295) [-1008.377] (-1007.886) * [-1007.329] (-1007.223) (-1009.635) (-1011.482) -- 0:01:00
      62500 -- (-1009.014) (-1007.934) (-1007.437) [-1007.354] * [-1007.563] (-1007.840) (-1011.386) (-1011.765) -- 0:01:00
      63000 -- (-1008.445) (-1007.569) (-1008.045) [-1007.002] * [-1008.327] (-1008.461) (-1007.386) (-1007.775) -- 0:00:59
      63500 -- (-1009.068) [-1007.770] (-1008.174) (-1006.794) * (-1009.996) [-1007.415] (-1008.224) (-1007.096) -- 0:00:58
      64000 -- [-1012.269] (-1010.212) (-1007.812) (-1006.843) * (-1011.213) [-1009.110] (-1006.516) (-1012.797) -- 0:00:58
      64500 -- (-1009.227) (-1007.564) (-1007.585) [-1006.766] * (-1009.851) (-1011.846) (-1006.877) [-1009.354] -- 0:00:58
      65000 -- (-1010.153) (-1010.704) (-1007.857) [-1007.085] * (-1011.278) [-1011.569] (-1008.787) (-1010.119) -- 0:00:57

      Average standard deviation of split frequencies: 0.028570

      65500 -- (-1009.567) [-1006.531] (-1007.231) (-1009.485) * (-1012.020) (-1013.356) [-1011.132] (-1008.787) -- 0:00:57
      66000 -- (-1012.449) [-1006.744] (-1007.232) (-1006.757) * (-1009.584) (-1009.839) [-1007.019] (-1011.897) -- 0:00:56
      66500 -- [-1007.432] (-1008.389) (-1007.053) (-1007.468) * [-1011.861] (-1012.311) (-1008.935) (-1009.774) -- 0:00:56
      67000 -- (-1008.471) [-1009.037] (-1006.697) (-1006.931) * (-1012.236) (-1013.866) (-1007.257) [-1010.155] -- 0:00:55
      67500 -- (-1008.456) (-1013.728) [-1006.786] (-1015.025) * (-1012.388) (-1010.411) [-1007.777] (-1008.981) -- 0:00:55
      68000 -- [-1009.447] (-1007.013) (-1008.781) (-1009.344) * (-1007.432) (-1009.412) [-1008.392] (-1006.951) -- 0:00:54
      68500 -- [-1006.908] (-1007.827) (-1007.899) (-1009.623) * (-1010.383) (-1007.537) [-1008.001] (-1010.566) -- 0:00:54
      69000 -- (-1009.024) (-1010.421) [-1007.372] (-1009.056) * (-1009.564) [-1007.327] (-1007.342) (-1009.211) -- 0:00:53
      69500 -- [-1008.668] (-1008.026) (-1011.226) (-1009.195) * (-1012.202) (-1009.316) [-1007.376] (-1009.444) -- 0:00:53
      70000 -- (-1012.286) (-1007.132) [-1010.128] (-1007.293) * (-1015.857) (-1008.862) (-1008.281) [-1007.293] -- 0:00:53

      Average standard deviation of split frequencies: 0.025683

      70500 -- (-1013.131) (-1008.683) (-1010.409) [-1010.735] * (-1007.879) (-1008.523) [-1007.821] (-1007.685) -- 0:00:52
      71000 -- (-1009.706) (-1008.290) [-1009.712] (-1009.849) * (-1010.094) (-1008.831) (-1007.489) [-1007.823] -- 0:00:52
      71500 -- (-1011.546) [-1008.288] (-1008.643) (-1012.118) * (-1009.863) [-1010.265] (-1008.203) (-1008.102) -- 0:00:51
      72000 -- [-1011.026] (-1007.975) (-1012.981) (-1010.269) * (-1010.435) (-1012.016) (-1008.672) [-1009.435] -- 0:00:51
      72500 -- [-1007.965] (-1011.651) (-1008.496) (-1009.713) * (-1008.319) (-1012.171) (-1006.826) [-1009.292] -- 0:00:51
      73000 -- (-1008.193) (-1008.991) (-1008.981) [-1008.234] * (-1007.590) [-1011.642] (-1009.868) (-1008.556) -- 0:00:50
      73500 -- (-1007.505) (-1011.028) (-1007.500) [-1007.251] * (-1009.628) [-1009.991] (-1008.596) (-1009.872) -- 0:01:03
      74000 -- (-1010.656) (-1008.774) [-1007.529] (-1006.721) * (-1012.622) (-1007.577) (-1007.879) [-1008.940] -- 0:01:02
      74500 -- (-1011.011) (-1008.706) [-1008.451] (-1007.429) * [-1008.279] (-1007.451) (-1016.922) (-1010.029) -- 0:01:02
      75000 -- [-1008.174] (-1006.860) (-1009.260) (-1007.563) * (-1008.056) [-1008.121] (-1015.839) (-1010.811) -- 0:01:01

      Average standard deviation of split frequencies: 0.026770

      75500 -- [-1011.326] (-1006.990) (-1008.726) (-1007.996) * [-1008.230] (-1007.653) (-1014.426) (-1013.309) -- 0:01:01
      76000 -- (-1010.740) (-1008.020) (-1009.229) [-1014.613] * (-1009.136) (-1006.941) (-1009.508) [-1011.320] -- 0:01:00
      76500 -- (-1009.113) (-1009.877) [-1008.090] (-1010.186) * (-1010.087) [-1007.896] (-1010.385) (-1010.259) -- 0:01:00
      77000 -- (-1009.699) [-1007.104] (-1008.538) (-1012.082) * (-1010.119) (-1010.827) [-1010.940] (-1009.450) -- 0:00:59
      77500 -- (-1008.250) [-1007.653] (-1009.802) (-1012.326) * [-1010.830] (-1010.563) (-1009.259) (-1008.878) -- 0:00:59
      78000 -- [-1009.437] (-1008.295) (-1008.007) (-1009.477) * (-1010.040) [-1008.881] (-1010.415) (-1008.966) -- 0:00:59
      78500 -- (-1011.169) (-1008.754) (-1007.592) [-1010.547] * [-1010.697] (-1015.029) (-1010.332) (-1010.778) -- 0:00:58
      79000 -- [-1009.973] (-1009.827) (-1011.801) (-1009.543) * (-1008.748) (-1012.013) [-1012.330] (-1008.777) -- 0:00:58
      79500 -- (-1015.240) [-1008.107] (-1008.511) (-1010.768) * (-1008.205) [-1006.799] (-1010.311) (-1011.402) -- 0:00:57
      80000 -- (-1011.445) [-1008.534] (-1010.073) (-1015.462) * [-1008.103] (-1007.017) (-1011.868) (-1011.468) -- 0:00:57

      Average standard deviation of split frequencies: 0.024674

      80500 -- (-1010.644) (-1008.179) [-1007.204] (-1010.602) * (-1008.648) (-1008.084) [-1007.625] (-1010.084) -- 0:00:57
      81000 -- [-1006.858] (-1007.809) (-1009.132) (-1017.190) * (-1011.060) (-1007.267) (-1010.677) [-1008.580] -- 0:00:56
      81500 -- (-1008.807) (-1008.335) [-1007.647] (-1011.137) * [-1010.591] (-1009.321) (-1010.333) (-1010.241) -- 0:00:56
      82000 -- [-1008.327] (-1011.389) (-1009.810) (-1009.913) * [-1007.420] (-1007.414) (-1008.753) (-1014.382) -- 0:00:55
      82500 -- (-1008.326) (-1012.604) [-1009.248] (-1008.273) * [-1009.012] (-1012.665) (-1007.946) (-1009.925) -- 0:00:55
      83000 -- (-1006.594) (-1008.334) (-1008.110) [-1007.857] * (-1008.166) [-1008.312] (-1007.334) (-1008.324) -- 0:00:55
      83500 -- [-1006.646] (-1009.793) (-1008.669) (-1007.761) * (-1013.957) [-1007.879] (-1008.170) (-1010.916) -- 0:00:54
      84000 -- (-1006.915) (-1009.118) (-1011.340) [-1009.170] * (-1009.418) (-1009.627) [-1010.797] (-1011.310) -- 0:00:54
      84500 -- (-1006.688) [-1007.130] (-1011.616) (-1009.762) * (-1010.333) (-1009.285) [-1010.058] (-1010.030) -- 0:00:54
      85000 -- (-1008.264) (-1007.028) (-1009.215) [-1009.371] * [-1009.637] (-1011.098) (-1010.890) (-1008.712) -- 0:00:53

      Average standard deviation of split frequencies: 0.023753

      85500 -- (-1007.526) [-1007.896] (-1007.873) (-1010.550) * (-1008.672) (-1007.455) [-1008.496] (-1013.071) -- 0:00:53
      86000 -- (-1008.242) (-1011.145) [-1008.302] (-1006.531) * [-1009.794] (-1011.661) (-1006.770) (-1011.536) -- 0:00:53
      86500 -- (-1010.021) (-1013.695) [-1007.902] (-1006.479) * [-1008.772] (-1009.254) (-1008.902) (-1008.548) -- 0:00:52
      87000 -- (-1008.281) (-1010.391) [-1008.226] (-1006.572) * (-1009.754) (-1012.946) (-1013.637) [-1007.580] -- 0:00:52
      87500 -- (-1008.746) (-1009.925) [-1008.288] (-1008.286) * (-1007.840) (-1011.012) [-1010.803] (-1009.300) -- 0:00:52
      88000 -- [-1008.160] (-1008.909) (-1010.438) (-1009.926) * [-1009.194] (-1008.837) (-1012.833) (-1008.410) -- 0:00:51
      88500 -- (-1008.185) (-1008.489) [-1010.419] (-1006.913) * [-1009.260] (-1008.309) (-1009.912) (-1008.367) -- 0:00:51
      89000 -- (-1007.022) [-1008.035] (-1007.081) (-1013.393) * (-1011.073) (-1010.266) [-1012.633] (-1007.157) -- 0:00:51
      89500 -- (-1007.204) (-1007.684) [-1009.408] (-1007.946) * (-1010.390) (-1009.578) (-1016.191) [-1006.670] -- 0:00:50
      90000 -- [-1008.441] (-1008.623) (-1007.163) (-1008.987) * (-1009.209) (-1010.244) (-1010.563) [-1007.211] -- 0:01:00

      Average standard deviation of split frequencies: 0.027441

      90500 -- (-1012.771) (-1008.340) (-1009.106) [-1007.660] * (-1007.202) (-1008.456) (-1013.185) [-1006.859] -- 0:01:00
      91000 -- [-1008.543] (-1008.060) (-1007.792) (-1008.009) * (-1011.268) (-1006.567) [-1010.964] (-1006.995) -- 0:00:59
      91500 -- (-1009.283) (-1008.060) [-1008.660] (-1007.896) * (-1008.629) (-1007.307) (-1009.500) [-1007.451] -- 0:00:59
      92000 -- (-1006.813) (-1008.305) [-1006.959] (-1013.293) * (-1010.481) [-1008.642] (-1009.584) (-1007.190) -- 0:00:59
      92500 -- [-1006.733] (-1009.166) (-1009.649) (-1011.744) * (-1008.453) [-1008.457] (-1010.294) (-1007.776) -- 0:00:58
      93000 -- [-1007.900] (-1007.728) (-1007.988) (-1008.152) * [-1008.019] (-1008.415) (-1011.456) (-1008.867) -- 0:00:58
      93500 -- [-1007.774] (-1008.949) (-1011.414) (-1008.838) * (-1008.033) [-1007.495] (-1011.604) (-1011.475) -- 0:00:58
      94000 -- (-1009.858) [-1007.444] (-1012.298) (-1009.691) * (-1008.640) [-1008.982] (-1010.621) (-1012.436) -- 0:00:57
      94500 -- [-1008.221] (-1009.432) (-1008.192) (-1012.943) * (-1008.256) [-1007.579] (-1011.199) (-1011.872) -- 0:00:57
      95000 -- (-1009.124) (-1012.234) [-1010.429] (-1013.893) * [-1009.769] (-1009.157) (-1010.272) (-1010.170) -- 0:00:57

      Average standard deviation of split frequencies: 0.026574

      95500 -- (-1009.114) [-1009.416] (-1009.856) (-1011.850) * (-1007.881) [-1008.500] (-1009.759) (-1010.337) -- 0:00:56
      96000 -- (-1007.821) (-1009.334) [-1007.469] (-1013.932) * (-1008.501) (-1008.046) (-1008.645) [-1009.841] -- 0:00:56
      96500 -- [-1007.827] (-1009.579) (-1007.858) (-1013.302) * (-1007.627) [-1007.884] (-1008.753) (-1013.647) -- 0:00:56
      97000 -- (-1008.244) [-1008.582] (-1012.557) (-1012.915) * (-1007.679) (-1008.134) (-1009.149) [-1010.643] -- 0:00:55
      97500 -- (-1006.840) [-1007.862] (-1011.093) (-1010.702) * (-1010.180) [-1009.010] (-1010.120) (-1009.362) -- 0:00:55
      98000 -- (-1007.501) (-1012.188) [-1008.476] (-1012.045) * (-1009.794) [-1008.820] (-1008.347) (-1008.949) -- 0:00:55
      98500 -- [-1008.433] (-1007.598) (-1008.306) (-1009.806) * [-1007.444] (-1008.585) (-1008.748) (-1008.318) -- 0:00:54
      99000 -- (-1012.716) (-1009.320) (-1008.762) [-1010.197] * (-1011.883) (-1007.661) (-1009.489) [-1009.304] -- 0:00:54
      99500 -- [-1009.261] (-1009.376) (-1008.133) (-1011.514) * (-1009.440) (-1009.188) (-1006.798) [-1010.489] -- 0:00:54
      100000 -- (-1007.686) (-1013.489) [-1007.448] (-1011.897) * [-1007.098] (-1010.221) (-1007.674) (-1010.750) -- 0:00:54

      Average standard deviation of split frequencies: 0.027577

      100500 -- [-1009.561] (-1009.157) (-1012.562) (-1009.425) * (-1007.596) (-1007.300) (-1006.962) [-1008.937] -- 0:00:53
      101000 -- (-1007.405) (-1008.338) [-1007.745] (-1011.669) * [-1007.812] (-1008.678) (-1009.782) (-1011.380) -- 0:00:53
      101500 -- [-1007.877] (-1010.991) (-1010.121) (-1009.676) * (-1007.518) [-1007.992] (-1008.536) (-1010.545) -- 0:00:53
      102000 -- (-1009.923) [-1009.729] (-1013.381) (-1011.123) * (-1008.247) [-1009.697] (-1008.900) (-1010.285) -- 0:00:52
      102500 -- [-1009.664] (-1011.074) (-1009.662) (-1009.370) * (-1009.051) (-1007.897) [-1008.090] (-1009.392) -- 0:00:52
      103000 -- (-1011.038) [-1007.960] (-1009.229) (-1008.370) * (-1006.886) (-1007.803) [-1007.171] (-1008.557) -- 0:00:52
      103500 -- (-1011.068) (-1008.298) [-1010.588] (-1010.219) * (-1007.935) [-1007.590] (-1007.261) (-1009.668) -- 0:00:51
      104000 -- (-1010.661) (-1009.948) (-1008.087) [-1008.028] * (-1007.382) [-1009.080] (-1007.767) (-1017.825) -- 0:00:51
      104500 -- (-1007.637) [-1007.156] (-1007.549) (-1008.848) * (-1008.041) (-1010.706) [-1007.069] (-1013.503) -- 0:00:51
      105000 -- (-1009.085) [-1008.599] (-1008.118) (-1009.743) * (-1008.835) (-1007.836) (-1007.338) [-1008.907] -- 0:00:51

      Average standard deviation of split frequencies: 0.026449

      105500 -- (-1007.560) [-1008.579] (-1007.514) (-1010.331) * [-1008.453] (-1012.244) (-1008.384) (-1009.269) -- 0:00:50
      106000 -- (-1009.129) [-1008.949] (-1010.510) (-1011.308) * [-1010.887] (-1010.586) (-1009.081) (-1008.882) -- 0:00:59
      106500 -- (-1008.370) (-1008.029) (-1011.708) [-1011.997] * (-1009.422) [-1009.820] (-1008.038) (-1010.081) -- 0:00:58
      107000 -- (-1009.140) [-1007.595] (-1009.394) (-1010.515) * [-1009.047] (-1008.268) (-1010.039) (-1007.952) -- 0:00:58
      107500 -- [-1007.798] (-1011.475) (-1013.575) (-1008.206) * (-1009.949) (-1008.450) [-1009.172] (-1009.854) -- 0:00:58
      108000 -- (-1006.688) (-1011.964) (-1007.489) [-1008.588] * (-1009.612) (-1006.608) (-1011.224) [-1009.578] -- 0:00:57
      108500 -- [-1006.597] (-1011.770) (-1008.170) (-1008.528) * (-1007.967) [-1009.252] (-1011.313) (-1011.162) -- 0:00:57
      109000 -- (-1008.892) (-1009.420) [-1009.181] (-1011.480) * [-1011.416] (-1009.740) (-1007.832) (-1010.015) -- 0:00:57
      109500 -- (-1008.698) [-1010.611] (-1010.036) (-1009.200) * [-1008.985] (-1012.460) (-1010.329) (-1009.807) -- 0:00:56
      110000 -- [-1009.920] (-1008.501) (-1009.734) (-1009.631) * (-1011.043) [-1008.986] (-1013.439) (-1010.651) -- 0:00:56

      Average standard deviation of split frequencies: 0.026679

      110500 -- (-1015.006) (-1009.085) (-1012.632) [-1009.288] * (-1009.361) [-1010.175] (-1008.978) (-1013.596) -- 0:00:56
      111000 -- [-1009.427] (-1009.814) (-1014.859) (-1009.878) * (-1008.386) (-1010.121) [-1009.883] (-1008.204) -- 0:00:56
      111500 -- (-1007.574) (-1007.964) (-1009.353) [-1007.368] * (-1011.186) [-1007.115] (-1009.014) (-1008.210) -- 0:00:55
      112000 -- [-1008.145] (-1007.557) (-1009.838) (-1007.196) * [-1012.053] (-1009.621) (-1012.566) (-1009.299) -- 0:00:55
      112500 -- (-1013.362) (-1006.821) [-1007.917] (-1009.941) * (-1010.086) [-1006.961] (-1008.470) (-1008.775) -- 0:00:55
      113000 -- (-1008.187) (-1011.496) [-1007.010] (-1017.727) * (-1010.106) (-1009.642) [-1007.875] (-1010.428) -- 0:00:54
      113500 -- (-1007.694) [-1008.369] (-1011.110) (-1009.052) * (-1009.903) [-1010.363] (-1012.597) (-1009.896) -- 0:00:54
      114000 -- (-1012.451) (-1010.047) [-1008.293] (-1009.519) * (-1008.425) [-1008.296] (-1014.030) (-1008.827) -- 0:00:54
      114500 -- [-1007.534] (-1008.147) (-1008.409) (-1010.956) * (-1006.983) [-1007.040] (-1008.065) (-1010.306) -- 0:00:54
      115000 -- [-1008.927] (-1008.600) (-1011.657) (-1007.899) * (-1006.972) [-1008.645] (-1010.201) (-1014.028) -- 0:00:53

      Average standard deviation of split frequencies: 0.025060

      115500 -- (-1010.375) (-1009.475) (-1008.111) [-1009.560] * [-1007.288] (-1010.337) (-1009.163) (-1009.327) -- 0:00:53
      116000 -- (-1011.109) [-1009.067] (-1009.523) (-1009.741) * (-1007.661) (-1007.708) (-1008.270) [-1007.676] -- 0:00:53
      116500 -- (-1011.840) (-1010.294) [-1010.253] (-1010.143) * (-1007.360) (-1007.951) [-1007.400] (-1008.334) -- 0:00:53
      117000 -- (-1008.808) (-1010.350) [-1008.474] (-1010.437) * [-1009.597] (-1008.131) (-1009.515) (-1010.897) -- 0:00:52
      117500 -- [-1008.301] (-1007.420) (-1009.756) (-1008.469) * [-1006.858] (-1008.407) (-1008.845) (-1010.810) -- 0:00:52
      118000 -- (-1008.442) [-1007.465] (-1008.271) (-1010.894) * (-1007.416) (-1011.267) (-1009.288) [-1009.093] -- 0:00:52
      118500 -- (-1013.316) (-1007.867) [-1009.770] (-1009.731) * [-1007.606] (-1014.559) (-1008.909) (-1008.156) -- 0:00:52
      119000 -- (-1010.251) (-1009.754) (-1010.274) [-1009.968] * (-1011.344) (-1007.902) [-1009.298] (-1010.460) -- 0:00:51
      119500 -- (-1009.011) [-1012.318] (-1010.112) (-1011.747) * (-1012.366) (-1006.690) [-1007.211] (-1007.754) -- 0:00:51
      120000 -- (-1008.607) (-1010.262) [-1007.895] (-1008.783) * [-1009.629] (-1008.330) (-1008.253) (-1011.242) -- 0:00:51

      Average standard deviation of split frequencies: 0.023440

      120500 -- (-1008.481) (-1009.832) [-1007.329] (-1008.889) * [-1007.911] (-1008.531) (-1011.318) (-1006.957) -- 0:00:51
      121000 -- [-1008.964] (-1011.362) (-1006.541) (-1009.188) * (-1010.618) (-1007.727) [-1008.028] (-1009.402) -- 0:00:50
      121500 -- (-1007.631) (-1009.584) [-1006.821] (-1009.557) * (-1008.768) (-1012.600) [-1009.764] (-1008.088) -- 0:00:50
      122000 -- (-1009.111) (-1008.058) (-1007.364) [-1009.924] * (-1008.607) [-1014.618] (-1010.185) (-1007.862) -- 0:00:57
      122500 -- (-1012.031) [-1009.219] (-1008.673) (-1008.569) * (-1008.866) (-1013.112) (-1013.347) [-1007.798] -- 0:00:57
      123000 -- (-1010.187) [-1010.511] (-1008.781) (-1008.517) * (-1009.262) (-1008.887) (-1013.581) [-1008.118] -- 0:00:57
      123500 -- (-1009.830) (-1010.851) [-1007.557] (-1009.430) * (-1008.766) [-1008.462] (-1011.068) (-1010.178) -- 0:00:56
      124000 -- (-1010.052) (-1009.533) [-1008.282] (-1010.351) * [-1009.720] (-1008.638) (-1010.652) (-1007.632) -- 0:00:56
      124500 -- (-1011.308) [-1007.431] (-1009.102) (-1013.049) * [-1012.685] (-1009.544) (-1007.395) (-1007.327) -- 0:00:56
      125000 -- (-1012.605) (-1009.171) (-1010.295) [-1007.366] * (-1009.924) (-1012.014) (-1010.263) [-1008.571] -- 0:00:56

      Average standard deviation of split frequencies: 0.023768

      125500 -- (-1009.114) [-1008.114] (-1007.761) (-1009.964) * (-1008.825) (-1016.345) (-1009.553) [-1008.150] -- 0:00:55
      126000 -- [-1008.817] (-1007.728) (-1012.274) (-1010.247) * (-1011.249) [-1008.561] (-1008.745) (-1006.862) -- 0:00:55
      126500 -- (-1011.093) (-1006.916) [-1011.096] (-1009.608) * (-1008.616) (-1006.994) [-1008.968] (-1012.489) -- 0:00:55
      127000 -- [-1008.915] (-1008.405) (-1009.744) (-1008.441) * (-1011.148) [-1008.398] (-1007.247) (-1013.799) -- 0:00:54
      127500 -- (-1008.915) [-1008.374] (-1009.341) (-1010.967) * [-1008.582] (-1008.865) (-1007.276) (-1008.945) -- 0:00:54
      128000 -- (-1007.484) [-1009.129] (-1007.385) (-1010.113) * (-1010.280) (-1007.695) [-1011.031] (-1007.396) -- 0:00:54
      128500 -- [-1010.335] (-1007.534) (-1008.228) (-1009.900) * [-1007.306] (-1007.532) (-1017.832) (-1007.832) -- 0:00:54
      129000 -- [-1008.834] (-1007.921) (-1008.660) (-1010.040) * (-1007.357) (-1008.484) (-1009.260) [-1009.440] -- 0:00:54
      129500 -- (-1006.947) [-1007.471] (-1009.484) (-1013.317) * (-1016.228) (-1007.751) [-1007.217] (-1010.453) -- 0:00:53
      130000 -- (-1007.120) (-1012.910) (-1008.425) [-1009.944] * (-1009.918) (-1008.472) [-1007.897] (-1010.315) -- 0:00:53

      Average standard deviation of split frequencies: 0.026739

      130500 -- (-1007.163) (-1009.919) (-1008.090) [-1011.010] * [-1008.463] (-1008.532) (-1008.606) (-1006.848) -- 0:00:53
      131000 -- (-1007.306) (-1012.934) (-1008.079) [-1008.445] * [-1008.402] (-1008.723) (-1009.275) (-1006.889) -- 0:00:53
      131500 -- (-1011.652) (-1010.048) (-1013.277) [-1007.715] * (-1008.342) [-1011.013] (-1007.056) (-1006.697) -- 0:00:52
      132000 -- (-1008.686) (-1009.064) (-1009.380) [-1008.394] * (-1008.471) (-1010.426) (-1009.059) [-1011.063] -- 0:00:52
      132500 -- (-1013.745) (-1013.455) (-1009.372) [-1008.514] * (-1008.174) (-1009.359) (-1007.509) [-1009.991] -- 0:00:52
      133000 -- (-1011.538) [-1014.810] (-1009.175) (-1007.682) * [-1008.317] (-1008.110) (-1006.943) (-1008.323) -- 0:00:52
      133500 -- (-1008.739) (-1011.990) (-1009.467) [-1006.714] * [-1007.989] (-1009.923) (-1007.465) (-1008.196) -- 0:00:51
      134000 -- [-1007.216] (-1008.935) (-1013.677) (-1007.260) * (-1007.586) [-1007.781] (-1008.635) (-1008.865) -- 0:00:51
      134500 -- (-1009.826) [-1007.816] (-1009.164) (-1007.747) * (-1007.899) [-1009.027] (-1009.358) (-1007.000) -- 0:00:51
      135000 -- [-1010.356] (-1008.554) (-1008.991) (-1008.062) * (-1011.437) (-1009.451) (-1009.956) [-1011.372] -- 0:00:51

      Average standard deviation of split frequencies: 0.025804

      135500 -- (-1009.925) (-1009.226) [-1010.163] (-1008.319) * (-1008.492) (-1007.261) [-1014.103] (-1010.828) -- 0:00:51
      136000 -- [-1008.998] (-1006.809) (-1011.450) (-1010.733) * (-1010.004) [-1010.217] (-1008.429) (-1009.350) -- 0:00:50
      136500 -- [-1009.812] (-1008.436) (-1012.922) (-1008.827) * [-1008.801] (-1007.986) (-1010.086) (-1008.589) -- 0:00:50
      137000 -- [-1008.313] (-1009.044) (-1009.781) (-1009.949) * (-1009.097) (-1007.489) (-1007.557) [-1009.498] -- 0:00:50
      137500 -- (-1009.533) (-1008.778) (-1009.473) [-1009.624] * [-1008.195] (-1006.994) (-1012.875) (-1008.110) -- 0:00:50
      138000 -- (-1011.113) (-1009.211) (-1009.708) [-1010.755] * [-1007.124] (-1009.397) (-1008.226) (-1007.830) -- 0:00:49
      138500 -- (-1013.520) (-1007.889) [-1007.791] (-1010.390) * [-1007.609] (-1009.472) (-1008.348) (-1009.558) -- 0:00:55
      139000 -- (-1008.016) [-1009.262] (-1010.246) (-1008.645) * (-1007.711) [-1008.086] (-1010.750) (-1008.610) -- 0:00:55
      139500 -- (-1008.388) (-1012.313) (-1008.381) [-1007.101] * (-1010.615) [-1010.760] (-1010.531) (-1007.459) -- 0:00:55
      140000 -- [-1007.911] (-1007.417) (-1009.817) (-1011.620) * (-1011.327) (-1007.975) (-1008.740) [-1007.530] -- 0:00:55

      Average standard deviation of split frequencies: 0.024948

      140500 -- (-1007.886) [-1010.495] (-1008.365) (-1006.900) * (-1009.962) [-1007.339] (-1008.365) (-1007.023) -- 0:00:55
      141000 -- (-1007.791) (-1008.381) (-1007.149) [-1010.479] * (-1008.825) (-1007.715) [-1009.376] (-1007.091) -- 0:00:54
      141500 -- (-1010.541) [-1008.635] (-1007.852) (-1008.381) * (-1013.551) [-1009.151] (-1008.039) (-1007.788) -- 0:00:54
      142000 -- (-1007.903) (-1007.633) (-1007.893) [-1007.288] * (-1013.250) (-1009.395) (-1009.571) [-1007.286] -- 0:00:54
      142500 -- (-1010.208) (-1008.777) [-1006.866] (-1011.276) * (-1010.369) (-1009.627) [-1011.366] (-1009.222) -- 0:00:54
      143000 -- (-1012.933) (-1007.252) [-1007.323] (-1009.927) * (-1014.645) (-1010.026) [-1009.233] (-1009.774) -- 0:00:53
      143500 -- [-1007.038] (-1013.093) (-1007.797) (-1008.495) * [-1011.520] (-1013.279) (-1009.984) (-1010.417) -- 0:00:53
      144000 -- (-1008.057) (-1007.242) [-1007.795] (-1009.879) * (-1008.619) [-1008.603] (-1008.707) (-1011.401) -- 0:00:53
      144500 -- [-1007.568] (-1010.721) (-1008.399) (-1008.671) * (-1012.050) (-1006.969) [-1010.465] (-1010.633) -- 0:00:53
      145000 -- (-1008.998) [-1009.347] (-1010.775) (-1009.161) * (-1012.809) (-1007.750) (-1009.356) [-1010.604] -- 0:00:53

      Average standard deviation of split frequencies: 0.022763

      145500 -- [-1009.544] (-1007.718) (-1012.414) (-1008.670) * (-1017.514) [-1008.302] (-1010.846) (-1009.708) -- 0:00:52
      146000 -- (-1010.847) [-1011.134] (-1012.812) (-1010.416) * [-1007.547] (-1007.350) (-1013.554) (-1010.282) -- 0:00:52
      146500 -- (-1009.369) (-1009.234) (-1010.898) [-1009.396] * (-1006.898) [-1007.784] (-1011.718) (-1008.251) -- 0:00:52
      147000 -- (-1007.076) (-1007.724) (-1009.399) [-1008.724] * [-1007.633] (-1013.441) (-1008.496) (-1008.951) -- 0:00:52
      147500 -- (-1007.368) [-1008.052] (-1007.451) (-1006.670) * [-1007.851] (-1015.917) (-1008.254) (-1008.499) -- 0:00:52
      148000 -- [-1007.748] (-1012.942) (-1012.560) (-1008.002) * [-1008.403] (-1008.552) (-1008.495) (-1008.134) -- 0:00:51
      148500 -- (-1008.873) (-1009.800) [-1007.773] (-1010.245) * (-1008.768) (-1011.996) [-1009.042] (-1007.716) -- 0:00:51
      149000 -- (-1008.669) [-1008.752] (-1008.240) (-1010.358) * [-1007.423] (-1006.825) (-1008.241) (-1009.383) -- 0:00:51
      149500 -- [-1006.734] (-1009.498) (-1010.314) (-1013.786) * (-1010.193) (-1007.314) [-1009.958] (-1011.908) -- 0:00:51
      150000 -- (-1007.933) (-1010.991) [-1009.715] (-1007.564) * [-1008.510] (-1007.811) (-1012.618) (-1008.354) -- 0:00:51

      Average standard deviation of split frequencies: 0.022058

      150500 -- (-1009.760) (-1015.466) [-1009.450] (-1006.945) * (-1007.653) (-1007.888) [-1010.152] (-1008.299) -- 0:00:50
      151000 -- (-1008.361) (-1009.565) [-1009.567] (-1007.319) * (-1008.896) (-1008.102) [-1010.885] (-1008.417) -- 0:00:50
      151500 -- (-1007.988) [-1008.396] (-1009.169) (-1007.316) * (-1010.477) [-1007.206] (-1008.423) (-1007.935) -- 0:00:50
      152000 -- (-1008.134) (-1008.115) (-1010.572) [-1008.749] * (-1010.477) (-1009.160) [-1007.389] (-1009.173) -- 0:00:50
      152500 -- (-1008.777) (-1008.583) [-1010.073] (-1009.603) * (-1010.515) (-1012.911) [-1007.421] (-1007.527) -- 0:00:50
      153000 -- (-1009.599) (-1009.661) (-1009.041) [-1009.682] * (-1011.628) (-1012.906) (-1007.039) [-1007.759] -- 0:00:49
      153500 -- (-1006.820) (-1008.168) [-1006.930] (-1008.434) * (-1008.478) (-1009.671) (-1007.638) [-1007.643] -- 0:00:49
      154000 -- [-1007.081] (-1008.089) (-1007.897) (-1013.334) * [-1008.368] (-1010.692) (-1007.715) (-1007.257) -- 0:00:49
      154500 -- [-1009.782] (-1007.604) (-1009.188) (-1012.229) * (-1007.875) (-1008.793) [-1008.095] (-1007.257) -- 0:00:49
      155000 -- [-1008.889] (-1010.575) (-1008.051) (-1011.585) * (-1016.128) (-1008.442) (-1010.121) [-1009.686] -- 0:00:54

      Average standard deviation of split frequencies: 0.022210

      155500 -- [-1008.847] (-1006.682) (-1009.150) (-1010.936) * (-1008.389) [-1013.036] (-1008.242) (-1011.083) -- 0:00:54
      156000 -- (-1011.399) [-1009.367] (-1009.143) (-1009.414) * (-1008.586) (-1008.458) [-1007.949] (-1008.027) -- 0:00:54
      156500 -- [-1008.276] (-1008.590) (-1007.822) (-1010.243) * (-1010.409) (-1012.134) (-1011.081) [-1008.716] -- 0:00:53
      157000 -- (-1008.870) (-1009.325) [-1007.798] (-1008.738) * [-1006.682] (-1009.056) (-1010.455) (-1008.436) -- 0:00:53
      157500 -- (-1007.644) (-1007.425) (-1007.626) [-1008.790] * (-1006.577) (-1009.145) [-1007.636] (-1008.769) -- 0:00:53
      158000 -- (-1009.696) (-1008.333) (-1008.745) [-1008.152] * (-1007.017) [-1008.159] (-1014.887) (-1011.890) -- 0:00:53
      158500 -- (-1009.538) (-1009.031) (-1007.187) [-1007.806] * [-1008.407] (-1013.550) (-1009.124) (-1008.467) -- 0:00:53
      159000 -- [-1008.326] (-1008.414) (-1008.896) (-1010.128) * (-1007.828) (-1009.446) (-1011.623) [-1008.780] -- 0:00:52
      159500 -- (-1008.690) (-1008.373) (-1008.392) [-1008.787] * (-1010.212) (-1009.098) [-1012.941] (-1007.903) -- 0:00:52
      160000 -- (-1011.748) (-1007.872) [-1007.067] (-1009.047) * (-1009.570) (-1010.352) [-1013.694] (-1007.946) -- 0:00:52

      Average standard deviation of split frequencies: 0.019612

      160500 -- (-1009.015) [-1008.360] (-1007.612) (-1008.703) * (-1010.537) [-1009.284] (-1007.426) (-1009.380) -- 0:00:52
      161000 -- [-1010.068] (-1008.966) (-1007.435) (-1010.212) * (-1007.500) (-1009.001) [-1010.933] (-1011.869) -- 0:00:52
      161500 -- [-1007.546] (-1008.509) (-1007.461) (-1010.414) * [-1008.683] (-1008.224) (-1007.552) (-1012.176) -- 0:00:51
      162000 -- (-1010.209) (-1007.449) (-1008.941) [-1007.086] * (-1012.564) (-1010.152) [-1007.539] (-1008.914) -- 0:00:51
      162500 -- (-1014.642) [-1008.148] (-1009.215) (-1007.700) * [-1011.156] (-1008.246) (-1008.537) (-1008.369) -- 0:00:51
      163000 -- (-1017.493) (-1006.735) [-1007.753] (-1007.594) * (-1011.942) (-1007.838) [-1008.702] (-1008.931) -- 0:00:51
      163500 -- [-1010.865] (-1009.465) (-1006.920) (-1007.562) * (-1007.890) (-1007.215) [-1009.695] (-1007.988) -- 0:00:51
      164000 -- [-1008.382] (-1011.060) (-1013.896) (-1007.196) * (-1007.641) [-1010.384] (-1008.075) (-1010.605) -- 0:00:50
      164500 -- [-1013.401] (-1006.958) (-1010.078) (-1008.118) * (-1009.678) (-1010.422) [-1007.567] (-1009.833) -- 0:00:50
      165000 -- (-1013.251) (-1008.102) (-1006.827) [-1008.357] * (-1006.966) (-1007.267) (-1007.547) [-1010.012] -- 0:00:50

      Average standard deviation of split frequencies: 0.018885

      165500 -- [-1009.016] (-1008.674) (-1009.276) (-1008.284) * (-1006.731) (-1007.704) [-1007.347] (-1010.626) -- 0:00:50
      166000 -- (-1010.288) (-1008.442) [-1006.808] (-1009.574) * (-1008.800) (-1007.512) (-1007.656) [-1011.982] -- 0:00:50
      166500 -- (-1009.974) (-1008.565) [-1006.732] (-1008.514) * (-1011.547) (-1007.703) (-1006.741) [-1009.579] -- 0:00:50
      167000 -- (-1009.217) [-1008.507] (-1006.648) (-1008.455) * (-1009.618) (-1014.467) [-1008.813] (-1009.239) -- 0:00:49
      167500 -- (-1016.153) (-1009.284) (-1010.791) [-1007.993] * [-1007.027] (-1007.770) (-1008.278) (-1009.839) -- 0:00:49
      168000 -- (-1011.393) (-1011.590) [-1006.580] (-1008.051) * (-1008.458) [-1007.491] (-1009.659) (-1006.920) -- 0:00:49
      168500 -- (-1009.972) [-1010.320] (-1007.326) (-1007.718) * [-1008.051] (-1016.383) (-1008.951) (-1007.330) -- 0:00:49
      169000 -- (-1010.626) (-1014.831) [-1010.039] (-1007.445) * [-1008.246] (-1014.452) (-1009.712) (-1007.689) -- 0:00:49
      169500 -- [-1009.354] (-1012.867) (-1007.525) (-1007.504) * (-1008.383) (-1010.020) [-1010.559] (-1007.896) -- 0:00:48
      170000 -- (-1013.030) [-1009.858] (-1009.904) (-1007.183) * [-1008.434] (-1007.276) (-1015.356) (-1013.600) -- 0:00:48

      Average standard deviation of split frequencies: 0.016987

      170500 -- (-1007.404) (-1010.765) [-1008.448] (-1008.644) * (-1009.462) [-1008.094] (-1011.131) (-1012.767) -- 0:00:48
      171000 -- (-1008.441) [-1009.166] (-1009.347) (-1008.066) * (-1010.650) (-1009.467) (-1011.756) [-1009.687] -- 0:00:53
      171500 -- (-1008.422) (-1010.544) [-1008.066] (-1007.763) * [-1008.488] (-1009.464) (-1008.197) (-1011.935) -- 0:00:53
      172000 -- [-1008.388] (-1007.389) (-1006.880) (-1006.861) * [-1010.109] (-1008.497) (-1010.191) (-1014.332) -- 0:00:52
      172500 -- (-1007.696) (-1011.160) [-1009.001] (-1008.766) * (-1008.418) (-1014.660) [-1007.952] (-1008.810) -- 0:00:52
      173000 -- [-1007.945] (-1009.391) (-1008.269) (-1007.556) * (-1008.118) [-1007.810] (-1008.112) (-1008.970) -- 0:00:52
      173500 -- (-1008.566) (-1008.799) (-1007.150) [-1009.543] * (-1012.289) (-1009.093) [-1008.812] (-1008.921) -- 0:00:52
      174000 -- [-1007.577] (-1007.995) (-1009.457) (-1011.629) * (-1011.342) [-1006.802] (-1008.806) (-1009.798) -- 0:00:52
      174500 -- (-1007.689) [-1009.219] (-1008.209) (-1007.610) * (-1009.549) [-1006.772] (-1011.888) (-1007.777) -- 0:00:52
      175000 -- (-1007.453) (-1012.137) (-1007.566) [-1012.212] * [-1012.549] (-1008.142) (-1013.508) (-1007.777) -- 0:00:51

      Average standard deviation of split frequencies: 0.016634

      175500 -- (-1006.970) (-1009.891) (-1007.753) [-1007.980] * (-1008.600) (-1010.424) [-1008.000] (-1007.484) -- 0:00:51
      176000 -- (-1007.677) (-1009.316) [-1007.771] (-1009.621) * (-1008.514) (-1007.952) [-1009.595] (-1011.186) -- 0:00:51
      176500 -- [-1007.487] (-1009.058) (-1007.771) (-1007.015) * [-1008.414] (-1008.734) (-1007.528) (-1010.819) -- 0:00:51
      177000 -- (-1012.620) [-1009.645] (-1008.410) (-1010.801) * [-1009.212] (-1007.596) (-1008.554) (-1014.948) -- 0:00:51
      177500 -- [-1012.735] (-1008.031) (-1008.101) (-1006.784) * (-1010.182) [-1007.585] (-1009.051) (-1010.518) -- 0:00:50
      178000 -- (-1008.962) (-1007.596) (-1008.121) [-1007.952] * (-1010.104) (-1009.264) [-1009.221] (-1011.726) -- 0:00:50
      178500 -- (-1011.548) (-1011.063) (-1008.994) [-1011.375] * (-1007.553) (-1009.764) [-1008.446] (-1008.946) -- 0:00:50
      179000 -- (-1008.489) (-1009.035) [-1010.132] (-1009.987) * [-1010.491] (-1009.257) (-1008.017) (-1009.218) -- 0:00:50
      179500 -- (-1009.665) (-1007.311) [-1011.996] (-1008.627) * (-1007.964) [-1007.674] (-1007.427) (-1008.863) -- 0:00:50
      180000 -- (-1007.410) [-1008.853] (-1010.791) (-1008.890) * [-1008.106] (-1007.003) (-1012.643) (-1007.760) -- 0:00:50

      Average standard deviation of split frequencies: 0.016235

      180500 -- [-1009.462] (-1012.215) (-1008.051) (-1007.613) * (-1010.745) (-1006.985) [-1008.277] (-1008.686) -- 0:00:49
      181000 -- [-1008.224] (-1007.217) (-1009.817) (-1007.808) * (-1010.659) [-1011.463] (-1009.353) (-1010.754) -- 0:00:49
      181500 -- [-1008.882] (-1011.275) (-1010.060) (-1012.462) * (-1009.255) [-1008.046] (-1011.761) (-1011.356) -- 0:00:49
      182000 -- (-1007.551) (-1006.844) [-1008.437] (-1010.767) * (-1008.165) (-1009.680) (-1008.688) [-1009.501] -- 0:00:49
      182500 -- (-1008.451) (-1008.946) [-1008.987] (-1008.010) * [-1009.782] (-1007.436) (-1009.380) (-1008.549) -- 0:00:49
      183000 -- [-1010.675] (-1010.373) (-1013.200) (-1007.373) * (-1007.026) [-1008.619] (-1013.032) (-1012.932) -- 0:00:49
      183500 -- [-1007.689] (-1009.439) (-1009.172) (-1009.185) * (-1007.028) (-1007.071) [-1012.161] (-1009.020) -- 0:00:48
      184000 -- [-1007.684] (-1007.787) (-1007.206) (-1008.231) * (-1008.015) (-1007.404) [-1010.047] (-1011.326) -- 0:00:48
      184500 -- (-1010.458) [-1008.304] (-1010.660) (-1008.364) * (-1008.232) [-1007.575] (-1007.689) (-1015.905) -- 0:00:48
      185000 -- (-1008.086) (-1007.269) [-1008.837] (-1008.257) * (-1012.336) (-1008.831) [-1008.175] (-1012.761) -- 0:00:48

      Average standard deviation of split frequencies: 0.015740

      185500 -- (-1008.035) (-1008.711) (-1008.247) [-1007.529] * (-1009.571) (-1010.794) [-1009.071] (-1007.438) -- 0:00:48
      186000 -- [-1007.019] (-1011.136) (-1008.329) (-1009.874) * (-1008.490) (-1009.312) [-1009.999] (-1010.818) -- 0:00:48
      186500 -- (-1011.158) (-1011.506) [-1007.062] (-1007.367) * (-1009.294) (-1010.809) (-1010.811) [-1007.334] -- 0:00:47
      187000 -- (-1013.182) [-1008.798] (-1007.245) (-1007.894) * (-1008.986) (-1009.982) [-1008.789] (-1007.459) -- 0:00:47
      187500 -- (-1012.290) [-1008.589] (-1007.278) (-1011.664) * (-1011.413) (-1010.821) [-1008.980] (-1007.666) -- 0:00:52
      188000 -- (-1012.136) [-1010.180] (-1008.226) (-1008.210) * (-1009.497) (-1011.364) [-1007.991] (-1007.920) -- 0:00:51
      188500 -- [-1008.922] (-1010.565) (-1009.508) (-1009.923) * (-1009.130) [-1010.794] (-1007.373) (-1007.921) -- 0:00:51
      189000 -- [-1008.596] (-1009.139) (-1007.042) (-1007.239) * (-1010.287) (-1007.855) [-1007.126] (-1007.978) -- 0:00:51
      189500 -- (-1007.892) (-1009.574) [-1008.384] (-1007.239) * (-1010.434) (-1006.922) [-1008.022] (-1007.977) -- 0:00:51
      190000 -- [-1012.023] (-1007.760) (-1009.083) (-1007.022) * (-1011.421) (-1007.284) [-1009.563] (-1008.666) -- 0:00:51

      Average standard deviation of split frequencies: 0.014010

      190500 -- (-1008.122) (-1008.657) [-1008.107] (-1007.706) * (-1008.453) (-1007.114) [-1013.726] (-1011.819) -- 0:00:50
      191000 -- (-1007.353) (-1008.819) (-1008.375) [-1009.554] * (-1007.450) (-1007.789) [-1017.854] (-1009.602) -- 0:00:50
      191500 -- (-1007.800) (-1008.039) [-1009.818] (-1009.729) * [-1008.290] (-1012.025) (-1015.929) (-1009.371) -- 0:00:50
      192000 -- (-1007.892) (-1007.115) [-1008.224] (-1010.630) * (-1008.840) (-1009.649) [-1007.341] (-1014.903) -- 0:00:50
      192500 -- (-1007.185) [-1008.250] (-1009.615) (-1014.449) * (-1006.903) (-1007.244) (-1010.402) [-1009.310] -- 0:00:50
      193000 -- [-1008.173] (-1011.203) (-1008.325) (-1015.098) * [-1006.497] (-1008.222) (-1007.832) (-1010.541) -- 0:00:50
      193500 -- (-1011.225) (-1011.881) [-1008.183] (-1009.108) * (-1006.774) (-1007.833) (-1007.464) [-1010.286] -- 0:00:50
      194000 -- (-1008.173) (-1010.459) [-1007.947] (-1008.880) * (-1007.953) (-1010.539) (-1007.477) [-1007.219] -- 0:00:49
      194500 -- [-1009.914] (-1008.726) (-1014.640) (-1007.721) * [-1009.212] (-1010.523) (-1008.779) (-1008.643) -- 0:00:49
      195000 -- (-1007.241) (-1009.356) (-1012.684) [-1009.216] * [-1007.949] (-1008.745) (-1013.035) (-1011.643) -- 0:00:49

      Average standard deviation of split frequencies: 0.011892

      195500 -- (-1009.976) [-1010.334] (-1009.044) (-1009.024) * (-1007.819) [-1011.010] (-1009.022) (-1009.987) -- 0:00:49
      196000 -- (-1008.456) (-1009.804) [-1009.363] (-1009.058) * (-1006.623) (-1009.653) [-1008.935] (-1009.124) -- 0:00:49
      196500 -- (-1007.933) (-1007.703) (-1010.027) [-1007.944] * (-1006.527) (-1008.092) (-1007.181) [-1009.429] -- 0:00:49
      197000 -- (-1007.521) [-1008.549] (-1008.513) (-1009.656) * [-1007.765] (-1014.205) (-1008.949) (-1007.640) -- 0:00:48
      197500 -- (-1007.958) (-1007.987) (-1008.555) [-1010.119] * (-1008.958) (-1012.141) (-1008.362) [-1008.973] -- 0:00:48
      198000 -- (-1007.140) (-1008.433) (-1008.868) [-1009.137] * (-1007.967) (-1010.829) (-1008.585) [-1012.429] -- 0:00:48
      198500 -- (-1006.998) [-1009.455] (-1012.665) (-1008.126) * [-1009.736] (-1007.774) (-1007.818) (-1008.449) -- 0:00:48
      199000 -- (-1008.750) (-1007.740) [-1008.656] (-1007.548) * [-1007.786] (-1008.597) (-1012.047) (-1008.154) -- 0:00:48
      199500 -- [-1007.136] (-1006.848) (-1008.271) (-1009.726) * [-1009.407] (-1011.871) (-1009.622) (-1009.441) -- 0:00:48
      200000 -- [-1006.869] (-1009.630) (-1007.706) (-1011.483) * (-1009.054) (-1008.467) [-1008.275] (-1008.788) -- 0:00:48

      Average standard deviation of split frequencies: 0.014837

      200500 -- [-1006.807] (-1011.265) (-1008.098) (-1009.663) * [-1008.061] (-1007.995) (-1011.738) (-1008.114) -- 0:00:47
      201000 -- (-1009.208) (-1007.496) [-1008.042] (-1009.424) * (-1010.649) (-1011.943) (-1014.067) [-1009.340] -- 0:00:47
      201500 -- (-1013.522) (-1007.232) (-1007.358) [-1010.131] * (-1010.019) (-1009.410) [-1009.682] (-1010.447) -- 0:00:47
      202000 -- (-1009.756) (-1007.007) (-1007.200) [-1008.907] * (-1012.855) (-1008.298) (-1009.626) [-1007.131] -- 0:00:47
      202500 -- (-1007.058) (-1007.145) (-1013.540) [-1008.563] * (-1008.998) (-1011.099) [-1011.905] (-1007.617) -- 0:00:47
      203000 -- (-1010.307) (-1007.261) (-1008.020) [-1008.272] * [-1006.713] (-1014.321) (-1010.179) (-1008.609) -- 0:00:47
      203500 -- (-1008.697) [-1008.538] (-1007.506) (-1009.184) * (-1007.538) (-1009.039) [-1009.323] (-1007.532) -- 0:00:50
      204000 -- [-1006.872] (-1009.576) (-1006.996) (-1008.960) * (-1010.438) (-1014.132) [-1007.320] (-1007.068) -- 0:00:50
      204500 -- (-1008.032) (-1008.181) (-1007.697) [-1007.739] * (-1007.900) (-1011.878) (-1010.629) [-1008.263] -- 0:00:50
      205000 -- (-1007.395) (-1007.519) [-1007.648] (-1009.344) * (-1010.849) (-1008.437) (-1008.910) [-1007.704] -- 0:00:50

      Average standard deviation of split frequencies: 0.014935

      205500 -- [-1006.706] (-1008.431) (-1008.230) (-1010.763) * (-1010.751) (-1008.863) [-1011.154] (-1008.962) -- 0:00:50
      206000 -- (-1006.706) [-1009.118] (-1012.580) (-1014.591) * (-1008.417) (-1007.624) [-1008.810] (-1013.295) -- 0:00:50
      206500 -- [-1009.304] (-1008.825) (-1007.128) (-1011.754) * (-1011.082) [-1008.070] (-1008.413) (-1007.897) -- 0:00:49
      207000 -- [-1007.164] (-1009.628) (-1008.412) (-1014.995) * (-1012.812) (-1007.324) (-1008.719) [-1006.677] -- 0:00:49
      207500 -- (-1010.570) (-1010.892) (-1010.803) [-1009.515] * [-1007.999] (-1008.337) (-1009.183) (-1008.103) -- 0:00:49
      208000 -- [-1010.643] (-1012.641) (-1007.234) (-1008.242) * (-1007.776) (-1007.489) (-1006.977) [-1006.769] -- 0:00:49
      208500 -- [-1007.640] (-1011.724) (-1008.338) (-1008.229) * (-1006.963) (-1013.279) (-1007.881) [-1009.039] -- 0:00:49
      209000 -- (-1008.975) (-1009.803) (-1009.629) [-1008.734] * [-1006.963] (-1008.824) (-1009.291) (-1008.161) -- 0:00:49
      209500 -- (-1010.875) [-1009.144] (-1008.413) (-1008.743) * (-1008.725) (-1008.367) (-1010.380) [-1013.821] -- 0:00:49
      210000 -- [-1009.142] (-1007.994) (-1011.598) (-1008.721) * (-1010.459) (-1008.568) (-1011.597) [-1009.711] -- 0:00:48

      Average standard deviation of split frequencies: 0.015193

      210500 -- (-1010.534) (-1007.624) (-1010.211) [-1009.193] * (-1007.188) (-1008.234) [-1009.151] (-1008.139) -- 0:00:48
      211000 -- (-1014.222) (-1009.274) [-1008.140] (-1007.498) * [-1007.785] (-1010.744) (-1009.022) (-1009.971) -- 0:00:48
      211500 -- (-1010.434) [-1011.365] (-1007.883) (-1009.697) * (-1012.841) [-1010.292] (-1012.238) (-1007.505) -- 0:00:48
      212000 -- (-1010.508) (-1010.229) [-1007.304] (-1010.530) * (-1016.969) [-1010.309] (-1012.099) (-1011.840) -- 0:00:48
      212500 -- (-1010.792) [-1012.044] (-1007.763) (-1009.068) * (-1010.224) [-1006.671] (-1012.043) (-1007.711) -- 0:00:48
      213000 -- (-1012.470) (-1010.967) [-1007.920] (-1008.671) * [-1011.350] (-1007.937) (-1007.099) (-1010.921) -- 0:00:48
      213500 -- (-1012.021) [-1008.222] (-1009.326) (-1007.281) * (-1009.381) (-1008.493) (-1008.563) [-1011.236] -- 0:00:47
      214000 -- (-1016.101) (-1007.082) (-1009.138) [-1008.782] * (-1011.113) (-1009.323) [-1007.626] (-1008.240) -- 0:00:47
      214500 -- (-1009.773) [-1007.126] (-1013.339) (-1007.696) * (-1012.249) [-1010.018] (-1009.598) (-1008.151) -- 0:00:47
      215000 -- (-1011.379) [-1006.870] (-1008.334) (-1009.026) * [-1007.921] (-1009.845) (-1009.365) (-1008.821) -- 0:00:47

      Average standard deviation of split frequencies: 0.014703

      215500 -- (-1008.321) (-1010.788) (-1009.443) [-1010.177] * (-1008.429) [-1010.631] (-1012.069) (-1009.735) -- 0:00:47
      216000 -- [-1008.858] (-1009.361) (-1009.911) (-1011.271) * (-1006.817) (-1009.966) (-1013.272) [-1007.939] -- 0:00:47
      216500 -- (-1007.280) (-1009.835) [-1011.464] (-1008.316) * (-1008.564) (-1008.471) (-1010.041) [-1009.013] -- 0:00:47
      217000 -- [-1007.429] (-1008.945) (-1009.255) (-1009.651) * [-1010.117] (-1010.405) (-1009.836) (-1009.695) -- 0:00:46
      217500 -- (-1007.387) (-1008.945) (-1009.884) [-1008.905] * (-1007.761) [-1010.409] (-1009.979) (-1010.754) -- 0:00:46
      218000 -- (-1011.227) (-1009.278) (-1007.430) [-1008.122] * (-1012.491) [-1009.122] (-1008.703) (-1009.763) -- 0:00:46
      218500 -- (-1012.895) [-1007.253] (-1008.775) (-1006.869) * (-1009.595) (-1008.385) (-1007.852) [-1009.657] -- 0:00:46
      219000 -- (-1008.296) (-1008.558) [-1009.662] (-1007.375) * [-1007.551] (-1009.636) (-1007.022) (-1008.844) -- 0:00:46
      219500 -- [-1008.335] (-1008.713) (-1010.090) (-1007.641) * [-1007.696] (-1010.886) (-1010.881) (-1008.699) -- 0:00:46
      220000 -- [-1008.251] (-1011.035) (-1010.691) (-1011.792) * [-1012.428] (-1009.434) (-1013.277) (-1007.758) -- 0:00:49

      Average standard deviation of split frequencies: 0.014847

      220500 -- (-1009.003) [-1008.689] (-1009.520) (-1009.945) * (-1010.212) [-1007.947] (-1013.264) (-1009.510) -- 0:00:49
      221000 -- [-1010.554] (-1009.349) (-1010.700) (-1010.964) * (-1007.811) (-1007.748) [-1007.801] (-1013.623) -- 0:00:49
      221500 -- (-1012.638) [-1007.802] (-1007.819) (-1009.426) * (-1006.566) (-1007.221) [-1008.294] (-1011.563) -- 0:00:49
      222000 -- (-1007.646) [-1007.815] (-1010.297) (-1010.096) * (-1006.794) (-1014.014) [-1010.565] (-1007.565) -- 0:00:49
      222500 -- (-1008.542) [-1009.044] (-1010.493) (-1009.936) * (-1010.042) [-1009.475] (-1008.619) (-1009.525) -- 0:00:48
      223000 -- (-1009.527) (-1010.210) (-1013.809) [-1008.296] * (-1007.949) [-1008.808] (-1008.737) (-1008.466) -- 0:00:48
      223500 -- (-1009.953) (-1012.757) [-1008.791] (-1008.655) * (-1007.233) (-1007.413) [-1010.666] (-1010.528) -- 0:00:48
      224000 -- (-1011.500) (-1011.900) [-1007.589] (-1009.671) * (-1008.121) (-1009.207) (-1013.053) [-1007.614] -- 0:00:48
      224500 -- (-1008.820) (-1011.096) [-1007.196] (-1009.067) * (-1012.405) (-1009.697) (-1009.877) [-1008.216] -- 0:00:48
      225000 -- [-1010.538] (-1010.963) (-1012.172) (-1009.272) * (-1008.561) (-1017.956) (-1010.149) [-1010.121] -- 0:00:48

      Average standard deviation of split frequencies: 0.014810

      225500 -- [-1007.463] (-1008.043) (-1009.973) (-1010.039) * [-1007.830] (-1011.265) (-1012.775) (-1009.084) -- 0:00:48
      226000 -- (-1010.958) (-1009.277) [-1012.745] (-1007.098) * (-1008.800) (-1009.043) (-1009.539) [-1008.489] -- 0:00:47
      226500 -- (-1010.955) [-1009.150] (-1009.574) (-1007.097) * (-1007.804) (-1008.409) (-1007.816) [-1007.473] -- 0:00:47
      227000 -- (-1014.792) (-1008.271) [-1009.355] (-1009.680) * (-1010.852) [-1009.072] (-1008.219) (-1006.793) -- 0:00:47
      227500 -- (-1015.026) (-1009.018) [-1007.499] (-1010.490) * (-1010.856) (-1011.096) (-1008.734) [-1007.423] -- 0:00:47
      228000 -- [-1010.986] (-1007.227) (-1008.120) (-1010.629) * (-1008.896) (-1013.371) [-1009.084] (-1009.337) -- 0:00:47
      228500 -- [-1009.280] (-1007.224) (-1009.112) (-1009.725) * (-1008.972) (-1013.970) [-1010.448] (-1012.348) -- 0:00:47
      229000 -- (-1006.479) (-1006.813) (-1011.339) [-1009.387] * (-1008.200) [-1007.650] (-1012.401) (-1008.640) -- 0:00:47
      229500 -- [-1006.476] (-1006.888) (-1012.601) (-1008.827) * (-1009.489) (-1009.073) [-1007.928] (-1012.199) -- 0:00:47
      230000 -- [-1006.876] (-1012.461) (-1007.629) (-1008.709) * (-1008.458) [-1010.977] (-1014.227) (-1011.272) -- 0:00:46

      Average standard deviation of split frequencies: 0.012603

      230500 -- (-1008.596) (-1007.419) (-1007.619) [-1007.374] * (-1011.156) (-1007.806) [-1009.112] (-1007.348) -- 0:00:46
      231000 -- (-1007.269) (-1007.866) [-1007.952] (-1015.405) * (-1009.364) [-1007.028] (-1009.545) (-1009.743) -- 0:00:46
      231500 -- [-1006.760] (-1009.866) (-1007.577) (-1009.924) * (-1008.502) [-1007.308] (-1007.970) (-1008.169) -- 0:00:46
      232000 -- (-1008.027) [-1009.896] (-1007.581) (-1007.355) * (-1007.178) (-1011.863) (-1011.132) [-1008.329] -- 0:00:46
      232500 -- [-1007.518] (-1011.383) (-1010.942) (-1009.311) * (-1007.571) (-1007.670) (-1007.815) [-1008.481] -- 0:00:46
      233000 -- (-1012.890) (-1009.050) [-1008.903] (-1008.542) * (-1007.201) (-1010.456) (-1010.419) [-1008.151] -- 0:00:46
      233500 -- (-1009.441) (-1009.430) [-1007.746] (-1008.647) * [-1007.910] (-1008.660) (-1012.397) (-1007.979) -- 0:00:45
      234000 -- (-1009.608) (-1010.284) [-1007.054] (-1008.589) * (-1008.608) (-1009.328) (-1011.168) [-1011.314] -- 0:00:45
      234500 -- [-1009.094] (-1008.784) (-1008.507) (-1007.605) * (-1009.388) [-1007.147] (-1008.229) (-1012.951) -- 0:00:45
      235000 -- (-1008.169) [-1011.982] (-1012.343) (-1007.778) * (-1010.040) (-1006.855) [-1007.292] (-1012.896) -- 0:00:45

      Average standard deviation of split frequencies: 0.012651

      235500 -- [-1007.784] (-1008.963) (-1009.455) (-1011.004) * (-1012.230) (-1007.722) [-1007.348] (-1012.241) -- 0:00:45
      236000 -- (-1008.864) (-1009.670) [-1009.844] (-1009.971) * (-1009.465) (-1007.647) [-1007.873] (-1012.299) -- 0:00:48
      236500 -- [-1006.653] (-1008.444) (-1010.726) (-1009.294) * [-1008.145] (-1012.706) (-1007.212) (-1009.880) -- 0:00:48
      237000 -- (-1008.625) [-1008.264] (-1011.300) (-1007.882) * (-1007.480) (-1016.900) [-1007.786] (-1010.430) -- 0:00:48
      237500 -- (-1011.126) (-1007.322) [-1008.482] (-1009.065) * (-1007.921) [-1010.796] (-1007.167) (-1009.601) -- 0:00:48
      238000 -- [-1006.985] (-1010.446) (-1009.333) (-1006.891) * (-1009.456) [-1010.042] (-1008.069) (-1008.610) -- 0:00:48
      238500 -- (-1012.594) [-1007.828] (-1012.754) (-1006.826) * [-1007.520] (-1009.562) (-1008.882) (-1009.082) -- 0:00:47
      239000 -- (-1007.551) (-1009.427) [-1010.926] (-1007.764) * (-1010.536) (-1009.671) (-1008.842) [-1008.594] -- 0:00:47
      239500 -- (-1008.634) [-1007.540] (-1008.573) (-1007.761) * (-1009.436) [-1008.079] (-1009.706) (-1014.176) -- 0:00:47
      240000 -- (-1008.298) (-1006.964) (-1010.938) [-1008.518] * (-1011.802) (-1009.574) [-1007.541] (-1010.471) -- 0:00:47

      Average standard deviation of split frequencies: 0.013820

      240500 -- (-1006.814) (-1010.717) (-1008.258) [-1008.292] * (-1008.969) (-1011.049) [-1008.189] (-1007.712) -- 0:00:47
      241000 -- [-1007.525] (-1011.112) (-1008.688) (-1008.799) * (-1009.319) (-1009.650) [-1007.378] (-1009.973) -- 0:00:47
      241500 -- [-1008.029] (-1010.696) (-1009.146) (-1009.595) * (-1007.406) (-1009.940) [-1008.267] (-1007.922) -- 0:00:47
      242000 -- (-1009.921) (-1007.326) [-1008.803] (-1010.191) * (-1007.838) (-1007.829) (-1006.837) [-1011.655] -- 0:00:46
      242500 -- (-1007.207) (-1007.394) (-1010.356) [-1007.809] * [-1007.373] (-1007.898) (-1009.089) (-1014.420) -- 0:00:46
      243000 -- [-1007.111] (-1007.270) (-1010.676) (-1007.984) * (-1009.200) (-1009.199) (-1007.646) [-1009.511] -- 0:00:46
      243500 -- [-1007.743] (-1007.237) (-1007.161) (-1010.201) * [-1009.459] (-1008.947) (-1009.791) (-1007.829) -- 0:00:46
      244000 -- [-1007.576] (-1009.299) (-1008.260) (-1008.171) * (-1006.690) (-1007.527) [-1011.280] (-1009.553) -- 0:00:46
      244500 -- (-1007.916) [-1007.293] (-1008.566) (-1007.986) * (-1007.161) (-1007.716) [-1008.679] (-1009.014) -- 0:00:46
      245000 -- [-1010.042] (-1008.014) (-1006.436) (-1010.252) * (-1011.665) (-1011.193) [-1008.301] (-1006.687) -- 0:00:46

      Average standard deviation of split frequencies: 0.013011

      245500 -- (-1007.761) (-1006.947) [-1007.472] (-1011.660) * [-1007.019] (-1008.072) (-1007.000) (-1006.630) -- 0:00:46
      246000 -- [-1008.956] (-1007.483) (-1007.507) (-1010.189) * [-1011.293] (-1009.255) (-1006.778) (-1006.925) -- 0:00:45
      246500 -- (-1011.179) (-1007.588) [-1006.889] (-1016.085) * (-1011.690) [-1008.285] (-1008.324) (-1007.622) -- 0:00:45
      247000 -- (-1012.733) [-1010.066] (-1009.398) (-1007.133) * (-1009.944) (-1010.481) [-1011.839] (-1010.498) -- 0:00:45
      247500 -- (-1011.319) (-1008.828) (-1008.816) [-1008.694] * (-1010.951) [-1008.852] (-1006.719) (-1008.558) -- 0:00:45
      248000 -- (-1006.752) [-1007.878] (-1009.152) (-1007.053) * (-1008.492) (-1007.296) [-1008.101] (-1009.177) -- 0:00:45
      248500 -- (-1007.763) (-1007.411) [-1008.338] (-1009.894) * [-1007.486] (-1011.897) (-1008.413) (-1014.667) -- 0:00:45
      249000 -- [-1007.268] (-1009.132) (-1008.142) (-1010.622) * [-1009.998] (-1007.834) (-1009.168) (-1013.877) -- 0:00:45
      249500 -- (-1007.481) [-1008.037] (-1009.057) (-1007.241) * [-1008.000] (-1008.148) (-1008.645) (-1008.349) -- 0:00:45
      250000 -- (-1010.445) (-1009.441) [-1009.539] (-1008.855) * (-1008.045) (-1008.541) (-1008.449) [-1008.244] -- 0:00:45

      Average standard deviation of split frequencies: 0.012669

      250500 -- (-1007.987) (-1018.033) (-1008.520) [-1009.242] * [-1009.239] (-1008.509) (-1010.266) (-1011.026) -- 0:00:44
      251000 -- [-1007.377] (-1008.396) (-1011.420) (-1008.084) * (-1008.501) (-1010.153) [-1011.827] (-1010.819) -- 0:00:44
      251500 -- (-1007.619) (-1009.892) [-1009.607] (-1008.091) * (-1007.406) (-1007.421) (-1011.571) [-1010.339] -- 0:00:44
      252000 -- (-1007.424) (-1014.742) [-1007.859] (-1008.170) * (-1007.378) (-1007.162) (-1008.244) [-1007.350] -- 0:00:44
      252500 -- [-1008.394] (-1012.325) (-1008.686) (-1008.000) * (-1007.223) (-1006.778) (-1010.550) [-1007.408] -- 0:00:47
      253000 -- (-1008.074) (-1010.926) [-1011.284] (-1007.131) * (-1009.526) (-1018.934) (-1007.771) [-1008.822] -- 0:00:47
      253500 -- [-1010.448] (-1008.915) (-1008.202) (-1007.466) * (-1009.762) (-1012.248) (-1008.880) [-1007.917] -- 0:00:47
      254000 -- (-1008.279) (-1008.247) (-1009.229) [-1008.669] * (-1008.412) [-1011.237] (-1012.298) (-1008.806) -- 0:00:46
      254500 -- (-1008.460) [-1008.362] (-1007.970) (-1013.247) * (-1010.877) (-1010.839) [-1007.862] (-1006.646) -- 0:00:46
      255000 -- (-1011.904) [-1008.736] (-1007.936) (-1009.229) * (-1011.163) [-1008.779] (-1012.294) (-1009.387) -- 0:00:46

      Average standard deviation of split frequencies: 0.013627

      255500 -- (-1008.780) [-1009.905] (-1010.306) (-1009.193) * (-1010.630) (-1008.927) [-1007.057] (-1010.420) -- 0:00:46
      256000 -- [-1010.190] (-1013.087) (-1007.981) (-1009.737) * (-1009.354) (-1011.126) (-1007.961) [-1008.193] -- 0:00:46
      256500 -- [-1007.766] (-1009.528) (-1009.061) (-1011.813) * (-1008.527) [-1008.714] (-1008.041) (-1008.167) -- 0:00:46
      257000 -- (-1009.193) (-1009.127) [-1013.101] (-1009.756) * (-1009.263) [-1006.945] (-1007.349) (-1008.204) -- 0:00:46
      257500 -- (-1011.194) (-1012.780) [-1008.094] (-1007.758) * (-1009.276) (-1007.355) (-1009.197) [-1010.010] -- 0:00:46
      258000 -- (-1007.787) (-1011.670) [-1008.772] (-1006.755) * (-1008.465) (-1007.891) (-1012.781) [-1009.866] -- 0:00:46
      258500 -- [-1009.046] (-1008.740) (-1008.228) (-1007.870) * (-1009.521) [-1009.004] (-1011.674) (-1012.466) -- 0:00:45
      259000 -- (-1009.293) (-1013.040) [-1007.880] (-1010.217) * (-1012.101) [-1010.381] (-1016.894) (-1013.505) -- 0:00:45
      259500 -- (-1009.714) (-1011.604) (-1007.932) [-1009.240] * [-1009.557] (-1009.400) (-1014.420) (-1008.277) -- 0:00:45
      260000 -- (-1008.446) (-1011.207) [-1010.382] (-1008.473) * (-1008.967) [-1008.220] (-1009.482) (-1007.086) -- 0:00:45

      Average standard deviation of split frequencies: 0.013706

      260500 -- (-1007.265) (-1009.394) [-1010.514] (-1008.926) * (-1009.990) [-1008.964] (-1010.800) (-1008.379) -- 0:00:45
      261000 -- (-1007.481) [-1009.381] (-1008.451) (-1008.634) * (-1010.245) (-1012.957) [-1010.637] (-1009.154) -- 0:00:45
      261500 -- (-1009.696) (-1008.516) [-1009.441] (-1009.640) * (-1008.863) (-1011.783) [-1008.583] (-1012.050) -- 0:00:45
      262000 -- (-1009.304) [-1009.888] (-1007.575) (-1009.206) * (-1009.404) (-1011.923) (-1007.601) [-1008.100] -- 0:00:45
      262500 -- (-1009.701) (-1013.615) [-1009.449] (-1007.975) * (-1009.162) (-1014.658) [-1008.180] (-1008.061) -- 0:00:44
      263000 -- (-1008.484) (-1011.916) (-1008.365) [-1011.120] * (-1009.780) (-1011.863) [-1009.024] (-1011.926) -- 0:00:44
      263500 -- (-1009.758) (-1008.872) (-1009.469) [-1007.792] * [-1009.116] (-1009.568) (-1008.403) (-1009.569) -- 0:00:44
      264000 -- (-1011.026) (-1008.710) (-1009.149) [-1008.601] * (-1012.190) [-1010.912] (-1010.069) (-1007.821) -- 0:00:44
      264500 -- (-1008.421) (-1007.478) [-1008.311] (-1009.479) * [-1009.761] (-1010.369) (-1008.054) (-1008.295) -- 0:00:44
      265000 -- [-1009.854] (-1007.994) (-1009.067) (-1011.668) * (-1010.034) [-1011.904] (-1012.463) (-1014.455) -- 0:00:44

      Average standard deviation of split frequencies: 0.012494

      265500 -- [-1008.798] (-1010.750) (-1006.960) (-1008.098) * (-1006.867) [-1012.624] (-1008.263) (-1013.790) -- 0:00:44
      266000 -- [-1009.286] (-1009.416) (-1007.374) (-1010.078) * (-1007.997) (-1008.620) (-1010.381) [-1010.631] -- 0:00:44
      266500 -- (-1011.232) (-1008.642) [-1009.439] (-1010.359) * (-1009.910) (-1008.713) (-1008.788) [-1009.303] -- 0:00:44
      267000 -- (-1009.308) (-1008.459) (-1009.509) [-1008.421] * (-1008.372) (-1008.109) (-1008.250) [-1009.099] -- 0:00:43
      267500 -- [-1008.702] (-1007.401) (-1008.401) (-1015.600) * [-1009.540] (-1007.969) (-1008.028) (-1009.669) -- 0:00:43
      268000 -- (-1010.726) (-1007.394) (-1008.980) [-1009.133] * [-1008.234] (-1009.873) (-1007.408) (-1007.175) -- 0:00:43
      268500 -- (-1008.094) (-1007.434) (-1009.328) [-1010.438] * (-1010.025) (-1011.170) (-1009.975) [-1007.831] -- 0:00:46
      269000 -- (-1008.967) (-1010.739) (-1007.966) [-1008.425] * (-1009.456) (-1010.767) (-1014.491) [-1012.759] -- 0:00:46
      269500 -- [-1010.506] (-1009.480) (-1009.411) (-1007.550) * [-1010.830] (-1011.903) (-1007.160) (-1021.016) -- 0:00:46
      270000 -- (-1012.202) (-1010.310) (-1007.082) [-1006.858] * (-1012.299) (-1009.209) [-1007.886] (-1011.459) -- 0:00:45

      Average standard deviation of split frequencies: 0.012975

      270500 -- [-1011.081] (-1010.123) (-1007.364) (-1007.150) * (-1009.044) (-1008.971) [-1007.902] (-1009.047) -- 0:00:45
      271000 -- (-1012.948) (-1009.669) (-1009.045) [-1010.158] * (-1009.598) (-1014.915) (-1009.945) [-1008.673] -- 0:00:45
      271500 -- [-1011.952] (-1009.742) (-1008.787) (-1016.658) * [-1009.113] (-1009.931) (-1008.260) (-1009.050) -- 0:00:45
      272000 -- (-1017.174) [-1013.874] (-1006.684) (-1015.428) * (-1006.826) [-1009.665] (-1011.321) (-1008.491) -- 0:00:45
      272500 -- (-1012.064) (-1008.663) (-1007.775) [-1011.136] * (-1007.318) [-1007.473] (-1007.840) (-1009.945) -- 0:00:45
      273000 -- (-1008.251) (-1008.667) (-1006.743) [-1009.192] * (-1013.368) (-1007.187) (-1008.027) [-1007.733] -- 0:00:45
      273500 -- (-1009.746) (-1009.871) (-1007.614) [-1010.905] * (-1008.996) (-1009.345) [-1007.331] (-1009.166) -- 0:00:45
      274000 -- [-1008.077] (-1008.815) (-1008.610) (-1009.456) * (-1011.865) (-1010.088) [-1007.820] (-1008.753) -- 0:00:45
      274500 -- (-1017.303) (-1009.297) [-1009.472] (-1010.472) * (-1009.662) [-1009.783] (-1010.602) (-1010.042) -- 0:00:44
      275000 -- (-1008.886) (-1010.523) (-1015.801) [-1006.984] * [-1010.337] (-1008.131) (-1011.846) (-1009.398) -- 0:00:44

      Average standard deviation of split frequencies: 0.012495

      275500 -- (-1008.220) [-1009.965] (-1008.208) (-1007.905) * (-1008.041) (-1007.740) [-1007.471] (-1008.025) -- 0:00:44
      276000 -- (-1007.955) (-1013.946) [-1008.342] (-1008.154) * (-1008.377) (-1009.727) [-1007.052] (-1009.273) -- 0:00:44
      276500 -- (-1007.970) [-1007.173] (-1008.574) (-1008.936) * (-1007.838) [-1009.438] (-1010.444) (-1007.961) -- 0:00:44
      277000 -- (-1009.614) (-1009.588) (-1011.664) [-1006.921] * (-1008.038) [-1009.554] (-1007.382) (-1009.579) -- 0:00:44
      277500 -- (-1010.479) (-1008.908) (-1009.191) [-1006.952] * (-1007.882) (-1011.140) [-1013.556] (-1008.418) -- 0:00:44
      278000 -- (-1010.014) [-1007.457] (-1008.370) (-1006.722) * (-1010.199) (-1007.045) (-1009.157) [-1007.989] -- 0:00:44
      278500 -- (-1007.567) (-1007.792) (-1010.280) [-1008.141] * (-1009.234) (-1007.811) [-1008.221] (-1009.031) -- 0:00:44
      279000 -- (-1008.207) (-1008.422) (-1009.353) [-1009.389] * (-1008.804) (-1008.870) (-1008.534) [-1008.254] -- 0:00:43
      279500 -- (-1008.413) (-1006.847) [-1010.225] (-1014.139) * (-1012.376) [-1007.304] (-1009.705) (-1009.857) -- 0:00:43
      280000 -- [-1008.989] (-1006.958) (-1010.744) (-1015.056) * (-1012.931) (-1009.079) (-1008.338) [-1009.187] -- 0:00:43

      Average standard deviation of split frequencies: 0.013343

      280500 -- [-1006.755] (-1007.331) (-1008.988) (-1012.402) * (-1010.091) (-1007.947) (-1008.302) [-1012.191] -- 0:00:43
      281000 -- (-1007.456) (-1007.853) (-1010.106) [-1010.307] * (-1009.532) (-1008.279) (-1013.486) [-1008.481] -- 0:00:43
      281500 -- (-1012.488) [-1007.472] (-1007.936) (-1007.374) * [-1008.568] (-1009.189) (-1009.341) (-1009.876) -- 0:00:45
      282000 -- [-1009.816] (-1008.567) (-1006.764) (-1009.425) * (-1008.973) [-1009.478] (-1010.353) (-1009.823) -- 0:00:45
      282500 -- (-1008.649) (-1008.892) [-1008.158] (-1015.097) * (-1009.754) (-1010.201) [-1008.214] (-1007.180) -- 0:00:45
      283000 -- (-1012.368) (-1010.885) [-1008.153] (-1013.210) * (-1008.189) (-1011.760) [-1008.166] (-1007.983) -- 0:00:45
      283500 -- (-1013.172) (-1011.310) [-1009.872] (-1008.915) * [-1008.064] (-1013.269) (-1009.425) (-1007.114) -- 0:00:45
      284000 -- (-1012.951) (-1008.766) [-1009.390] (-1007.467) * (-1007.214) (-1008.810) (-1006.663) [-1009.599] -- 0:00:45
      284500 -- (-1010.637) [-1009.662] (-1010.577) (-1009.153) * (-1008.063) (-1015.747) (-1013.586) [-1008.239] -- 0:00:45
      285000 -- (-1010.814) (-1009.098) (-1009.556) [-1007.276] * (-1006.879) (-1011.922) (-1011.576) [-1010.299] -- 0:00:45

      Average standard deviation of split frequencies: 0.013269

      285500 -- [-1011.149] (-1008.539) (-1012.476) (-1010.096) * [-1009.842] (-1015.703) (-1011.598) (-1010.317) -- 0:00:45
      286000 -- (-1008.060) [-1007.977] (-1011.871) (-1011.144) * (-1007.849) (-1008.598) [-1009.065] (-1008.776) -- 0:00:44
      286500 -- (-1008.369) (-1007.969) [-1009.432] (-1009.301) * (-1007.268) [-1006.973] (-1009.472) (-1009.015) -- 0:00:44
      287000 -- (-1014.717) (-1006.839) (-1010.205) [-1008.533] * (-1014.645) (-1007.908) (-1009.307) [-1008.564] -- 0:00:44
      287500 -- (-1012.310) [-1007.052] (-1008.634) (-1009.859) * (-1014.118) (-1009.489) [-1008.807] (-1009.194) -- 0:00:44
      288000 -- (-1007.974) [-1007.246] (-1008.292) (-1012.351) * (-1007.891) [-1008.573] (-1007.407) (-1009.782) -- 0:00:44
      288500 -- [-1012.113] (-1008.763) (-1008.911) (-1007.469) * (-1007.439) [-1008.571] (-1006.760) (-1007.087) -- 0:00:44
      289000 -- (-1010.998) (-1009.234) (-1008.595) [-1008.708] * (-1010.173) [-1008.485] (-1007.744) (-1006.836) -- 0:00:44
      289500 -- (-1010.059) (-1009.941) (-1014.897) [-1008.386] * (-1008.719) (-1009.515) [-1008.433] (-1010.957) -- 0:00:44
      290000 -- (-1007.517) [-1007.400] (-1013.774) (-1010.753) * (-1008.878) [-1009.156] (-1007.363) (-1009.853) -- 0:00:44

      Average standard deviation of split frequencies: 0.012614

      290500 -- (-1008.660) [-1006.917] (-1008.197) (-1008.532) * (-1008.491) (-1011.313) [-1011.026] (-1013.043) -- 0:00:43
      291000 -- [-1009.911] (-1009.328) (-1007.465) (-1008.412) * (-1008.203) (-1009.738) (-1007.589) [-1009.770] -- 0:00:43
      291500 -- [-1008.496] (-1006.930) (-1009.293) (-1010.442) * (-1010.056) (-1008.330) (-1007.791) [-1006.575] -- 0:00:43
      292000 -- (-1009.858) [-1007.964] (-1010.316) (-1008.227) * [-1016.650] (-1007.689) (-1010.998) (-1009.419) -- 0:00:43
      292500 -- (-1012.353) [-1008.180] (-1011.535) (-1008.707) * (-1012.011) (-1009.406) (-1007.246) [-1006.502] -- 0:00:43
      293000 -- (-1007.880) (-1008.072) (-1009.738) [-1008.536] * (-1009.198) (-1011.160) (-1010.565) [-1007.579] -- 0:00:43
      293500 -- [-1006.593] (-1006.866) (-1008.419) (-1012.173) * (-1008.835) [-1010.518] (-1014.076) (-1007.578) -- 0:00:43
      294000 -- (-1012.905) [-1007.504] (-1008.713) (-1012.069) * (-1009.199) [-1012.428] (-1013.404) (-1009.191) -- 0:00:43
      294500 -- [-1008.735] (-1009.997) (-1011.691) (-1006.991) * (-1008.639) (-1011.432) (-1011.135) [-1009.169] -- 0:00:43
      295000 -- (-1011.427) (-1010.314) [-1010.737] (-1007.802) * [-1009.857] (-1008.929) (-1007.245) (-1011.377) -- 0:00:43

      Average standard deviation of split frequencies: 0.011944

      295500 -- (-1011.708) (-1011.025) (-1008.993) [-1007.805] * (-1007.919) (-1008.262) (-1012.459) [-1010.170] -- 0:00:42
      296000 -- (-1009.887) (-1008.079) (-1010.669) [-1007.422] * (-1008.192) [-1010.898] (-1009.438) (-1009.372) -- 0:00:42
      296500 -- (-1009.103) [-1008.308] (-1014.712) (-1008.462) * [-1014.252] (-1008.411) (-1009.559) (-1012.221) -- 0:00:45
      297000 -- [-1008.198] (-1008.581) (-1007.979) (-1008.832) * (-1009.241) (-1008.944) [-1007.509] (-1009.905) -- 0:00:44
      297500 -- (-1010.862) [-1007.897] (-1009.698) (-1010.769) * (-1013.645) (-1007.537) [-1008.038] (-1007.673) -- 0:00:44
      298000 -- [-1012.064] (-1009.251) (-1012.058) (-1007.173) * (-1007.903) (-1010.938) (-1007.954) [-1007.980] -- 0:00:44
      298500 -- (-1008.121) [-1008.827] (-1009.937) (-1015.388) * (-1007.842) [-1008.383] (-1008.091) (-1008.015) -- 0:00:44
      299000 -- (-1009.526) [-1009.302] (-1013.645) (-1010.187) * (-1007.686) (-1007.736) (-1013.213) [-1009.349] -- 0:00:44
      299500 -- [-1009.751] (-1014.050) (-1006.892) (-1013.466) * (-1007.898) [-1008.630] (-1009.919) (-1013.655) -- 0:00:44
      300000 -- (-1009.691) [-1017.025] (-1010.798) (-1013.172) * [-1007.023] (-1009.221) (-1012.965) (-1009.378) -- 0:00:44

      Average standard deviation of split frequencies: 0.012194

      300500 -- (-1014.070) [-1012.629] (-1010.564) (-1010.281) * (-1007.737) (-1013.664) (-1010.928) [-1007.257] -- 0:00:44
      301000 -- (-1012.208) (-1011.851) [-1010.502] (-1008.178) * (-1010.020) (-1010.816) (-1008.563) [-1007.376] -- 0:00:44
      301500 -- (-1008.462) (-1010.939) [-1009.197] (-1009.128) * (-1011.086) [-1006.952] (-1011.373) (-1006.854) -- 0:00:44
      302000 -- (-1011.636) (-1010.051) [-1008.264] (-1009.604) * (-1011.847) (-1009.016) (-1016.373) [-1007.195] -- 0:00:43
      302500 -- (-1011.832) [-1009.463] (-1009.062) (-1008.778) * (-1010.251) [-1009.555] (-1011.801) (-1010.138) -- 0:00:43
      303000 -- (-1012.009) (-1009.745) (-1010.106) [-1006.792] * (-1009.909) [-1012.097] (-1014.533) (-1011.648) -- 0:00:43
      303500 -- [-1009.160] (-1009.226) (-1011.518) (-1007.168) * (-1007.744) [-1008.598] (-1011.627) (-1009.274) -- 0:00:43
      304000 -- (-1008.763) (-1009.114) (-1008.473) [-1009.935] * (-1009.093) [-1009.621] (-1010.267) (-1011.667) -- 0:00:43
      304500 -- (-1012.680) [-1008.579] (-1008.583) (-1008.219) * (-1009.253) (-1013.179) [-1014.311] (-1010.290) -- 0:00:43
      305000 -- (-1010.919) (-1008.554) [-1008.663] (-1013.671) * [-1008.292] (-1010.793) (-1009.160) (-1007.340) -- 0:00:43

      Average standard deviation of split frequencies: 0.011896

      305500 -- (-1011.600) (-1008.549) [-1009.674] (-1008.248) * [-1006.645] (-1011.273) (-1008.807) (-1012.226) -- 0:00:43
      306000 -- (-1009.114) (-1009.186) [-1008.774] (-1008.794) * (-1006.561) [-1007.477] (-1009.215) (-1013.461) -- 0:00:43
      306500 -- (-1007.671) (-1010.054) (-1013.633) [-1007.909] * (-1008.864) (-1009.784) [-1008.232] (-1010.579) -- 0:00:42
      307000 -- (-1011.057) (-1012.887) (-1010.946) [-1007.119] * (-1011.944) (-1011.516) (-1010.575) [-1007.920] -- 0:00:42
      307500 -- (-1012.430) [-1007.828] (-1012.365) (-1009.775) * (-1007.911) [-1007.622] (-1008.199) (-1009.878) -- 0:00:42
      308000 -- [-1008.597] (-1015.074) (-1010.832) (-1007.691) * (-1007.500) (-1011.313) [-1008.178] (-1009.765) -- 0:00:42
      308500 -- (-1011.214) (-1012.328) [-1008.724] (-1009.342) * (-1008.607) (-1010.415) (-1008.818) [-1009.883] -- 0:00:42
      309000 -- (-1007.720) (-1008.142) [-1007.728] (-1010.842) * (-1007.458) (-1008.670) (-1013.784) [-1008.037] -- 0:00:42
      309500 -- (-1009.329) (-1011.239) (-1007.879) [-1008.344] * [-1007.166] (-1007.406) (-1011.131) (-1007.429) -- 0:00:44
      310000 -- [-1007.958] (-1006.565) (-1009.060) (-1009.907) * (-1006.861) (-1007.694) (-1011.491) [-1009.466] -- 0:00:44

      Average standard deviation of split frequencies: 0.011549

      310500 -- [-1007.451] (-1007.239) (-1007.505) (-1008.938) * (-1010.241) (-1011.551) (-1010.482) [-1008.308] -- 0:00:44
      311000 -- (-1009.222) [-1007.827] (-1008.219) (-1010.030) * (-1012.901) (-1009.925) [-1009.314] (-1009.030) -- 0:00:44
      311500 -- [-1007.739] (-1007.644) (-1010.606) (-1007.922) * [-1008.628] (-1009.091) (-1011.366) (-1008.240) -- 0:00:44
      312000 -- (-1006.607) (-1008.811) (-1008.490) [-1008.909] * [-1008.786] (-1012.109) (-1009.276) (-1007.793) -- 0:00:44
      312500 -- [-1006.861] (-1008.622) (-1007.456) (-1010.604) * (-1008.369) [-1007.721] (-1006.905) (-1008.006) -- 0:00:44
      313000 -- [-1008.519] (-1007.178) (-1008.310) (-1007.491) * (-1009.042) (-1010.323) (-1006.891) [-1007.471] -- 0:00:43
      313500 -- (-1007.073) (-1008.076) (-1010.250) [-1008.468] * (-1013.612) (-1008.150) [-1006.576] (-1011.728) -- 0:00:43
      314000 -- (-1008.379) (-1008.128) (-1008.887) [-1007.959] * (-1013.607) [-1010.044] (-1007.095) (-1009.664) -- 0:00:43
      314500 -- (-1008.022) (-1008.258) [-1010.305] (-1010.220) * (-1008.448) (-1009.476) [-1007.838] (-1008.595) -- 0:00:43
      315000 -- (-1007.687) [-1008.743] (-1013.017) (-1009.623) * (-1007.609) (-1007.348) [-1008.549] (-1010.607) -- 0:00:43

      Average standard deviation of split frequencies: 0.012183

      315500 -- (-1011.337) (-1011.120) [-1009.503] (-1008.219) * (-1007.844) [-1007.335] (-1014.374) (-1014.397) -- 0:00:43
      316000 -- (-1009.322) (-1010.646) [-1010.012] (-1008.220) * (-1007.539) [-1007.180] (-1013.122) (-1009.012) -- 0:00:43
      316500 -- [-1008.625] (-1012.698) (-1008.546) (-1007.769) * (-1009.019) (-1011.551) [-1007.909] (-1008.047) -- 0:00:43
      317000 -- (-1012.611) (-1009.719) [-1007.687] (-1006.971) * (-1011.693) (-1011.840) (-1011.052) [-1010.136] -- 0:00:43
      317500 -- (-1007.890) (-1010.406) (-1010.482) [-1007.823] * [-1010.414] (-1008.140) (-1015.960) (-1011.199) -- 0:00:42
      318000 -- (-1009.414) [-1008.622] (-1010.888) (-1010.796) * [-1012.298] (-1010.093) (-1014.348) (-1010.101) -- 0:00:42
      318500 -- (-1008.908) (-1009.116) [-1010.182] (-1008.434) * (-1009.482) (-1008.243) [-1009.374] (-1009.820) -- 0:00:42
      319000 -- (-1008.771) (-1008.395) [-1010.287] (-1008.466) * (-1007.145) [-1009.306] (-1007.958) (-1008.883) -- 0:00:42
      319500 -- (-1011.116) (-1011.901) [-1011.071] (-1009.150) * (-1011.281) [-1007.756] (-1009.737) (-1010.898) -- 0:00:42
      320000 -- (-1009.800) (-1011.677) (-1010.080) [-1010.782] * [-1009.583] (-1007.917) (-1007.640) (-1007.046) -- 0:00:42

      Average standard deviation of split frequencies: 0.012986

      320500 -- (-1007.738) (-1012.266) (-1011.775) [-1008.880] * (-1007.643) (-1007.584) [-1007.073] (-1007.017) -- 0:00:42
      321000 -- [-1007.850] (-1017.426) (-1013.740) (-1009.626) * [-1006.719] (-1010.679) (-1008.039) (-1007.179) -- 0:00:42
      321500 -- (-1006.718) (-1013.084) [-1015.223] (-1007.863) * (-1008.129) (-1007.607) [-1007.451] (-1017.013) -- 0:00:42
      322000 -- (-1006.829) (-1012.459) (-1008.911) [-1009.544] * (-1007.328) [-1008.575] (-1012.619) (-1014.964) -- 0:00:42
      322500 -- [-1008.945] (-1013.334) (-1010.322) (-1007.941) * (-1008.649) [-1011.568] (-1012.039) (-1013.144) -- 0:00:42
      323000 -- [-1009.448] (-1012.415) (-1010.381) (-1015.061) * (-1007.928) [-1009.607] (-1010.900) (-1009.221) -- 0:00:41
      323500 -- (-1009.733) (-1008.089) (-1007.545) [-1009.121] * (-1008.358) (-1007.397) [-1014.714] (-1007.948) -- 0:00:41
      324000 -- (-1008.551) [-1007.699] (-1006.911) (-1010.366) * (-1007.980) (-1009.730) [-1008.498] (-1009.869) -- 0:00:41
      324500 -- (-1010.264) (-1007.490) (-1007.340) [-1010.006] * (-1008.468) [-1007.957] (-1009.699) (-1013.217) -- 0:00:43
      325000 -- (-1007.401) [-1008.426] (-1006.882) (-1009.916) * [-1006.620] (-1009.546) (-1007.773) (-1008.940) -- 0:00:43

      Average standard deviation of split frequencies: 0.012613

      325500 -- [-1008.844] (-1008.291) (-1010.424) (-1010.200) * (-1007.880) [-1008.354] (-1007.311) (-1009.157) -- 0:00:43
      326000 -- (-1013.092) (-1009.590) (-1007.184) [-1006.977] * (-1008.446) (-1008.117) (-1006.925) [-1008.757] -- 0:00:43
      326500 -- (-1007.292) (-1006.877) [-1006.904] (-1008.742) * (-1009.438) [-1008.354] (-1008.822) (-1009.593) -- 0:00:43
      327000 -- (-1009.166) (-1010.777) (-1006.746) [-1010.691] * (-1008.079) (-1008.279) (-1008.373) [-1008.613] -- 0:00:43
      327500 -- (-1011.677) (-1008.461) [-1006.813] (-1010.753) * [-1009.408] (-1011.337) (-1010.500) (-1007.766) -- 0:00:43
      328000 -- [-1007.219] (-1008.189) (-1006.890) (-1010.807) * (-1007.106) (-1009.355) [-1009.625] (-1007.104) -- 0:00:43
      328500 -- (-1008.851) [-1007.661] (-1012.916) (-1009.777) * (-1006.993) [-1008.442] (-1008.821) (-1008.448) -- 0:00:42
      329000 -- [-1008.671] (-1008.337) (-1008.868) (-1009.113) * [-1008.529] (-1012.659) (-1007.897) (-1009.649) -- 0:00:42
      329500 -- (-1007.995) [-1008.592] (-1009.083) (-1007.505) * (-1007.445) (-1010.536) (-1007.843) [-1009.727] -- 0:00:42
      330000 -- (-1013.696) (-1007.358) [-1008.546] (-1007.625) * (-1010.072) [-1009.936] (-1008.904) (-1009.677) -- 0:00:42

      Average standard deviation of split frequencies: 0.012514

      330500 -- (-1012.866) (-1009.669) [-1007.421] (-1010.144) * (-1009.547) [-1008.700] (-1008.395) (-1010.926) -- 0:00:42
      331000 -- (-1009.616) (-1007.809) (-1007.932) [-1010.296] * (-1009.061) [-1008.647] (-1011.587) (-1007.916) -- 0:00:42
      331500 -- (-1009.401) [-1009.094] (-1009.473) (-1009.861) * (-1010.167) [-1010.870] (-1010.446) (-1008.920) -- 0:00:42
      332000 -- (-1006.785) [-1008.596] (-1010.767) (-1009.096) * (-1008.565) (-1013.466) [-1010.148] (-1009.403) -- 0:00:42
      332500 -- (-1006.785) (-1010.650) [-1008.874] (-1012.158) * (-1009.374) (-1013.649) [-1008.001] (-1009.367) -- 0:00:42
      333000 -- (-1007.187) (-1009.641) [-1007.934] (-1009.517) * (-1009.172) (-1010.108) [-1008.614] (-1006.766) -- 0:00:42
      333500 -- [-1010.291] (-1008.239) (-1007.879) (-1008.320) * (-1014.359) (-1009.319) (-1008.227) [-1007.308] -- 0:00:41
      334000 -- (-1012.731) (-1011.530) (-1008.079) [-1012.935] * (-1007.916) (-1013.220) [-1007.707] (-1006.994) -- 0:00:41
      334500 -- (-1007.565) (-1008.517) [-1009.503] (-1008.281) * [-1008.224] (-1011.120) (-1009.220) (-1009.886) -- 0:00:41
      335000 -- (-1007.127) (-1011.857) [-1007.041] (-1009.529) * [-1007.483] (-1007.667) (-1010.147) (-1006.617) -- 0:00:41

      Average standard deviation of split frequencies: 0.012861

      335500 -- (-1008.794) (-1012.104) [-1008.443] (-1009.001) * [-1009.260] (-1007.855) (-1010.058) (-1007.506) -- 0:00:41
      336000 -- (-1014.747) (-1014.132) [-1007.028] (-1008.438) * [-1010.420] (-1009.014) (-1008.998) (-1008.150) -- 0:00:41
      336500 -- (-1010.598) [-1008.104] (-1008.022) (-1010.004) * (-1007.867) [-1008.481] (-1010.444) (-1010.377) -- 0:00:41
      337000 -- (-1009.051) (-1010.429) [-1010.136] (-1008.515) * [-1007.813] (-1008.481) (-1012.850) (-1010.434) -- 0:00:41
      337500 -- [-1008.354] (-1007.982) (-1008.008) (-1009.953) * (-1008.245) (-1010.132) (-1009.269) [-1008.863] -- 0:00:41
      338000 -- (-1007.049) (-1008.971) (-1006.846) [-1008.746] * [-1009.631] (-1010.424) (-1009.992) (-1010.855) -- 0:00:41
      338500 -- (-1008.415) [-1009.313] (-1006.856) (-1008.815) * (-1009.085) (-1009.354) (-1008.006) [-1009.334] -- 0:00:41
      339000 -- (-1008.293) [-1009.406] (-1013.963) (-1009.447) * (-1009.378) [-1010.720] (-1009.858) (-1009.334) -- 0:00:40
      339500 -- (-1007.726) [-1010.645] (-1009.885) (-1011.647) * (-1007.622) [-1008.069] (-1010.370) (-1008.093) -- 0:00:42
      340000 -- (-1008.779) (-1010.050) [-1010.223] (-1010.798) * (-1007.241) (-1008.497) (-1007.505) [-1008.190] -- 0:00:42

      Average standard deviation of split frequencies: 0.013530

      340500 -- (-1007.435) (-1010.579) [-1009.609] (-1009.101) * [-1009.817] (-1008.639) (-1007.810) (-1011.716) -- 0:00:42
      341000 -- [-1007.912] (-1008.778) (-1008.040) (-1008.513) * [-1010.464] (-1009.593) (-1010.274) (-1012.857) -- 0:00:42
      341500 -- (-1006.983) (-1009.830) [-1007.536] (-1008.993) * [-1010.993] (-1008.906) (-1009.378) (-1012.787) -- 0:00:42
      342000 -- (-1009.299) (-1012.006) (-1008.155) [-1008.252] * [-1014.258] (-1009.359) (-1008.843) (-1007.823) -- 0:00:42
      342500 -- (-1007.398) (-1010.193) [-1008.023] (-1011.968) * (-1009.303) [-1008.522] (-1008.860) (-1007.500) -- 0:00:42
      343000 -- (-1011.387) (-1008.877) (-1008.403) [-1009.643] * (-1007.364) [-1010.846] (-1013.299) (-1007.567) -- 0:00:42
      343500 -- (-1009.884) (-1007.830) (-1008.274) [-1008.377] * [-1009.452] (-1012.744) (-1013.170) (-1007.219) -- 0:00:42
      344000 -- (-1007.906) (-1011.868) [-1008.918] (-1008.537) * [-1009.167] (-1012.792) (-1009.083) (-1009.265) -- 0:00:41
      344500 -- (-1009.697) (-1011.145) [-1007.283] (-1009.267) * [-1010.974] (-1008.439) (-1009.118) (-1007.838) -- 0:00:41
      345000 -- (-1010.186) [-1010.392] (-1008.092) (-1010.454) * (-1010.682) [-1009.676] (-1011.912) (-1008.440) -- 0:00:41

      Average standard deviation of split frequencies: 0.013776

      345500 -- (-1012.425) (-1010.006) (-1010.692) [-1008.156] * [-1007.492] (-1009.511) (-1012.046) (-1008.519) -- 0:00:41
      346000 -- [-1010.416] (-1009.640) (-1010.144) (-1010.698) * (-1008.529) [-1012.945] (-1011.715) (-1007.686) -- 0:00:41
      346500 -- [-1014.612] (-1013.940) (-1009.938) (-1007.003) * [-1010.628] (-1009.480) (-1009.777) (-1009.119) -- 0:00:41
      347000 -- (-1009.308) (-1015.119) (-1011.119) [-1006.576] * [-1007.338] (-1009.044) (-1010.311) (-1007.948) -- 0:00:41
      347500 -- (-1010.095) (-1008.765) [-1008.067] (-1011.958) * (-1008.690) (-1008.741) [-1008.997] (-1008.969) -- 0:00:41
      348000 -- (-1008.387) [-1009.454] (-1009.310) (-1007.021) * (-1007.108) (-1011.161) [-1009.024] (-1008.745) -- 0:00:41
      348500 -- [-1008.181] (-1011.856) (-1009.496) (-1009.474) * (-1007.115) (-1013.543) [-1009.456] (-1012.798) -- 0:00:41
      349000 -- (-1008.254) (-1011.221) (-1008.529) [-1007.583] * (-1007.584) [-1011.284] (-1008.844) (-1007.964) -- 0:00:41
      349500 -- (-1007.813) [-1009.180] (-1011.546) (-1009.757) * [-1010.255] (-1007.603) (-1011.730) (-1008.806) -- 0:00:40
      350000 -- (-1007.346) (-1008.632) (-1010.128) [-1010.186] * (-1011.874) (-1007.667) [-1007.393] (-1012.408) -- 0:00:40

      Average standard deviation of split frequencies: 0.014563

      350500 -- [-1008.004] (-1008.777) (-1013.972) (-1009.050) * (-1012.617) (-1008.285) (-1008.772) [-1013.789] -- 0:00:40
      351000 -- (-1008.935) [-1011.300] (-1013.352) (-1008.258) * (-1008.318) [-1008.616] (-1009.370) (-1008.631) -- 0:00:40
      351500 -- (-1007.878) (-1014.125) (-1007.844) [-1009.895] * [-1007.166] (-1006.960) (-1007.853) (-1010.490) -- 0:00:40
      352000 -- (-1009.315) (-1012.640) (-1008.729) [-1010.807] * [-1009.342] (-1007.216) (-1009.087) (-1014.261) -- 0:00:40
      352500 -- (-1007.335) (-1009.202) (-1007.437) [-1009.512] * (-1011.322) (-1010.619) [-1009.172] (-1012.424) -- 0:00:40
      353000 -- (-1008.862) [-1008.960] (-1009.703) (-1008.080) * (-1010.521) (-1010.612) [-1010.729] (-1011.167) -- 0:00:40
      353500 -- [-1008.101] (-1013.756) (-1007.163) (-1008.906) * [-1009.543] (-1012.920) (-1012.175) (-1008.676) -- 0:00:40
      354000 -- (-1008.594) [-1008.924] (-1008.856) (-1009.741) * (-1008.179) (-1010.052) (-1009.613) [-1008.099] -- 0:00:40
      354500 -- (-1008.551) (-1011.196) (-1006.922) [-1008.759] * (-1013.727) (-1007.589) (-1010.679) [-1010.056] -- 0:00:40
      355000 -- (-1010.444) [-1012.759] (-1014.727) (-1008.941) * (-1008.563) (-1010.325) [-1008.670] (-1008.418) -- 0:00:41

      Average standard deviation of split frequencies: 0.014488

      355500 -- (-1010.148) [-1008.949] (-1009.666) (-1007.319) * (-1009.019) (-1007.961) (-1008.555) [-1008.925] -- 0:00:41
      356000 -- (-1008.412) (-1010.447) (-1018.747) [-1007.244] * (-1007.900) (-1008.814) (-1007.934) [-1012.189] -- 0:00:41
      356500 -- (-1008.947) [-1007.178] (-1014.970) (-1008.566) * (-1012.093) (-1012.083) (-1011.868) [-1007.001] -- 0:00:41
      357000 -- (-1008.944) (-1007.219) (-1008.021) [-1008.195] * (-1007.849) [-1010.234] (-1008.176) (-1007.690) -- 0:00:41
      357500 -- (-1009.261) [-1008.377] (-1007.085) (-1011.227) * (-1010.237) (-1009.769) (-1008.689) [-1008.166] -- 0:00:41
      358000 -- (-1009.922) [-1007.631] (-1009.532) (-1010.169) * (-1007.634) [-1008.487] (-1008.055) (-1007.835) -- 0:00:41
      358500 -- (-1013.648) (-1007.355) [-1008.043] (-1007.646) * [-1013.336] (-1007.354) (-1011.561) (-1008.785) -- 0:00:41
      359000 -- (-1008.908) (-1008.015) [-1008.112] (-1009.277) * (-1011.348) (-1008.030) [-1009.971] (-1008.461) -- 0:00:41
      359500 -- (-1009.451) (-1007.100) [-1007.252] (-1010.943) * (-1011.031) [-1007.936] (-1008.573) (-1008.154) -- 0:00:40
      360000 -- (-1009.627) (-1008.090) [-1008.862] (-1010.931) * [-1010.635] (-1006.669) (-1013.198) (-1008.570) -- 0:00:40

      Average standard deviation of split frequencies: 0.014685

      360500 -- (-1009.395) (-1009.166) [-1008.483] (-1007.480) * (-1011.248) (-1006.554) (-1012.040) [-1008.461] -- 0:00:40
      361000 -- [-1009.544] (-1011.441) (-1010.452) (-1013.435) * (-1011.020) [-1007.812] (-1011.716) (-1009.706) -- 0:00:40
      361500 -- (-1013.385) (-1006.867) [-1008.514] (-1009.552) * (-1010.293) (-1007.148) [-1008.486] (-1007.774) -- 0:00:40
      362000 -- (-1007.655) (-1009.495) [-1007.248] (-1010.134) * (-1009.487) (-1007.981) (-1009.143) [-1008.421] -- 0:00:40
      362500 -- (-1008.899) (-1007.277) [-1007.199] (-1009.049) * (-1011.821) (-1008.236) (-1008.252) [-1007.704] -- 0:00:40
      363000 -- (-1008.689) [-1006.847] (-1010.022) (-1008.956) * (-1008.385) (-1007.910) [-1012.873] (-1011.871) -- 0:00:40
      363500 -- [-1008.051] (-1009.220) (-1010.394) (-1007.853) * (-1009.508) (-1008.046) [-1010.417] (-1014.739) -- 0:00:40
      364000 -- (-1008.623) (-1007.799) (-1011.646) [-1008.842] * (-1011.093) (-1010.591) [-1008.740] (-1008.569) -- 0:00:40
      364500 -- (-1012.488) (-1008.181) [-1010.913] (-1008.361) * (-1010.114) (-1015.642) [-1006.697] (-1008.569) -- 0:00:40
      365000 -- (-1010.965) (-1009.249) (-1011.409) [-1009.026] * (-1008.237) (-1008.236) [-1006.945] (-1008.471) -- 0:00:40

      Average standard deviation of split frequencies: 0.015027

      365500 -- (-1013.433) [-1009.643] (-1010.419) (-1012.299) * (-1012.441) [-1007.552] (-1008.433) (-1007.775) -- 0:00:39
      366000 -- (-1013.579) [-1008.494] (-1007.483) (-1008.532) * (-1009.390) (-1010.946) (-1008.041) [-1008.930] -- 0:00:39
      366500 -- (-1011.571) [-1010.161] (-1007.372) (-1008.393) * (-1010.261) (-1008.796) (-1010.473) [-1010.473] -- 0:00:39
      367000 -- [-1009.106] (-1008.344) (-1007.982) (-1010.718) * (-1008.090) (-1009.490) [-1010.810] (-1010.380) -- 0:00:39
      367500 -- (-1009.440) (-1010.006) [-1006.506] (-1007.666) * (-1011.258) (-1009.725) (-1007.548) [-1009.123] -- 0:00:39
      368000 -- (-1014.044) (-1007.048) [-1008.449] (-1010.220) * (-1008.795) (-1009.918) (-1009.847) [-1012.127] -- 0:00:39
      368500 -- (-1011.160) (-1007.048) [-1007.777] (-1012.694) * (-1011.707) (-1009.921) [-1011.415] (-1009.611) -- 0:00:39
      369000 -- (-1009.082) (-1008.108) [-1008.801] (-1009.561) * (-1008.782) (-1009.015) [-1007.758] (-1007.234) -- 0:00:39
      369500 -- (-1007.700) (-1007.808) (-1007.522) [-1008.588] * (-1009.806) (-1007.664) [-1007.818] (-1007.239) -- 0:00:39
      370000 -- (-1007.884) (-1011.702) [-1009.200] (-1009.485) * (-1007.693) (-1008.144) (-1008.448) [-1007.509] -- 0:00:39

      Average standard deviation of split frequencies: 0.014908

      370500 -- [-1009.342] (-1006.747) (-1009.295) (-1008.687) * (-1007.117) (-1010.732) [-1010.027] (-1012.378) -- 0:00:39
      371000 -- [-1010.235] (-1006.834) (-1009.766) (-1009.630) * (-1012.233) [-1009.698] (-1007.868) (-1009.676) -- 0:00:40
      371500 -- (-1009.680) [-1007.288] (-1007.394) (-1008.740) * (-1011.098) (-1008.425) (-1008.713) [-1009.578] -- 0:00:40
      372000 -- (-1011.421) (-1008.803) [-1008.073] (-1012.094) * (-1009.157) [-1007.149] (-1007.529) (-1009.832) -- 0:00:40
      372500 -- (-1009.661) (-1008.766) [-1008.340] (-1007.916) * (-1010.146) (-1009.909) (-1010.181) [-1011.209] -- 0:00:40
      373000 -- (-1009.322) (-1008.146) (-1008.036) [-1008.015] * (-1010.335) [-1009.016] (-1010.303) (-1008.634) -- 0:00:40
      373500 -- (-1010.193) [-1008.862] (-1009.365) (-1012.344) * (-1009.862) [-1010.340] (-1007.838) (-1008.552) -- 0:00:40
      374000 -- (-1012.853) (-1009.993) [-1007.971] (-1015.742) * (-1009.473) [-1009.972] (-1008.032) (-1007.731) -- 0:00:40
      374500 -- [-1008.182] (-1012.046) (-1008.166) (-1009.403) * (-1010.913) (-1009.708) [-1009.967] (-1010.302) -- 0:00:40
      375000 -- (-1009.661) [-1007.804] (-1007.497) (-1009.488) * (-1009.851) (-1010.142) (-1010.527) [-1007.727] -- 0:00:40

      Average standard deviation of split frequencies: 0.015184

      375500 -- [-1008.482] (-1009.748) (-1009.042) (-1012.925) * [-1008.808] (-1009.826) (-1007.795) (-1007.933) -- 0:00:39
      376000 -- (-1008.845) (-1010.542) (-1007.957) [-1007.965] * (-1008.683) [-1008.756] (-1008.398) (-1008.354) -- 0:00:39
      376500 -- (-1011.061) (-1008.823) (-1008.691) [-1010.328] * (-1008.799) (-1009.606) (-1007.598) [-1009.351] -- 0:00:39
      377000 -- [-1009.773] (-1009.893) (-1009.640) (-1009.738) * (-1008.769) [-1006.975] (-1010.708) (-1009.682) -- 0:00:39
      377500 -- [-1010.430] (-1010.726) (-1008.232) (-1011.143) * (-1008.958) (-1007.266) [-1013.712] (-1009.812) -- 0:00:39
      378000 -- (-1009.196) (-1007.502) (-1008.490) [-1008.320] * [-1009.283] (-1007.265) (-1007.463) (-1009.681) -- 0:00:39
      378500 -- (-1011.582) (-1008.506) (-1015.493) [-1008.136] * (-1009.715) (-1006.704) (-1008.583) [-1007.515] -- 0:00:39
      379000 -- [-1007.377] (-1011.491) (-1009.416) (-1008.787) * (-1012.735) (-1008.614) [-1009.785] (-1010.352) -- 0:00:39
      379500 -- (-1007.736) [-1011.004] (-1012.061) (-1009.584) * (-1010.039) (-1008.715) [-1008.280] (-1010.987) -- 0:00:39
      380000 -- (-1009.556) [-1010.700] (-1007.854) (-1011.443) * (-1008.925) (-1007.747) [-1012.513] (-1008.631) -- 0:00:39

      Average standard deviation of split frequencies: 0.015225

      380500 -- (-1009.157) [-1009.162] (-1015.083) (-1009.036) * (-1008.359) [-1008.831] (-1007.392) (-1009.408) -- 0:00:39
      381000 -- (-1008.996) [-1014.774] (-1007.541) (-1014.945) * [-1007.310] (-1007.413) (-1011.486) (-1007.608) -- 0:00:38
      381500 -- (-1011.203) (-1009.400) (-1008.204) [-1007.732] * (-1007.090) (-1011.847) [-1008.592] (-1010.311) -- 0:00:38
      382000 -- [-1007.470] (-1009.481) (-1013.145) (-1008.932) * (-1008.395) [-1007.048] (-1008.346) (-1008.536) -- 0:00:38
      382500 -- [-1007.925] (-1013.864) (-1008.751) (-1009.238) * [-1010.080] (-1006.965) (-1009.379) (-1008.230) -- 0:00:38
      383000 -- (-1008.194) [-1008.677] (-1007.739) (-1007.887) * (-1008.240) (-1007.186) (-1007.581) [-1006.790] -- 0:00:38
      383500 -- (-1009.049) (-1007.249) (-1009.369) [-1007.731] * (-1010.999) (-1009.335) (-1008.326) [-1009.999] -- 0:00:38
      384000 -- (-1007.121) [-1008.536] (-1010.834) (-1006.633) * [-1010.803] (-1008.826) (-1010.046) (-1011.006) -- 0:00:38
      384500 -- [-1007.735] (-1009.685) (-1011.636) (-1006.499) * (-1008.301) [-1007.605] (-1007.464) (-1011.162) -- 0:00:38
      385000 -- (-1007.315) [-1011.611] (-1016.251) (-1008.848) * (-1008.495) [-1009.669] (-1007.422) (-1011.159) -- 0:00:38

      Average standard deviation of split frequencies: 0.014859

      385500 -- [-1007.728] (-1010.968) (-1013.597) (-1012.234) * (-1007.453) (-1011.129) (-1007.525) [-1007.485] -- 0:00:38
      386000 -- (-1007.128) (-1009.831) [-1010.012] (-1008.760) * (-1008.984) (-1009.483) [-1007.426] (-1007.487) -- 0:00:38
      386500 -- (-1006.899) (-1009.590) [-1009.672] (-1008.508) * (-1008.236) [-1010.481] (-1009.392) (-1010.905) -- 0:00:38
      387000 -- (-1008.029) (-1008.206) (-1008.890) [-1007.060] * (-1007.356) (-1014.616) (-1011.481) [-1009.844] -- 0:00:38
      387500 -- (-1009.672) (-1007.762) [-1007.506] (-1012.903) * [-1008.874] (-1010.648) (-1008.374) (-1010.450) -- 0:00:39
      388000 -- (-1009.072) [-1010.176] (-1008.239) (-1008.840) * [-1007.406] (-1008.979) (-1008.031) (-1007.564) -- 0:00:39
      388500 -- (-1011.202) (-1010.318) (-1008.138) [-1010.660] * (-1006.693) [-1007.968] (-1008.317) (-1008.434) -- 0:00:39
      389000 -- (-1010.744) [-1006.718] (-1008.727) (-1008.780) * (-1007.366) (-1011.877) (-1009.964) [-1008.421] -- 0:00:39
      389500 -- [-1008.296] (-1010.610) (-1008.341) (-1010.750) * (-1008.712) (-1012.560) [-1009.315] (-1011.335) -- 0:00:39
      390000 -- [-1010.705] (-1010.146) (-1007.887) (-1014.897) * (-1007.636) (-1008.082) [-1007.787] (-1012.143) -- 0:00:39

      Average standard deviation of split frequencies: 0.014681

      390500 -- (-1008.819) (-1007.286) (-1008.511) [-1008.527] * (-1012.470) [-1008.436] (-1006.986) (-1007.489) -- 0:00:39
      391000 -- [-1007.545] (-1007.289) (-1008.117) (-1009.076) * (-1009.247) (-1008.048) (-1007.614) [-1007.824] -- 0:00:38
      391500 -- [-1008.188] (-1007.554) (-1008.121) (-1011.015) * (-1007.592) (-1009.407) (-1010.223) [-1007.126] -- 0:00:38
      392000 -- (-1011.439) [-1007.746] (-1007.371) (-1010.783) * (-1009.359) (-1009.513) [-1011.049] (-1007.754) -- 0:00:38
      392500 -- (-1012.843) (-1006.843) [-1010.524] (-1009.284) * (-1010.616) (-1011.223) (-1012.374) [-1008.928] -- 0:00:38
      393000 -- (-1012.773) (-1008.345) (-1009.467) [-1011.002] * (-1009.760) (-1011.220) (-1007.848) [-1007.678] -- 0:00:38
      393500 -- (-1012.493) [-1010.453] (-1008.481) (-1015.094) * (-1008.233) [-1008.736] (-1012.914) (-1014.625) -- 0:00:38
      394000 -- (-1011.758) (-1011.068) [-1008.806] (-1007.125) * (-1007.713) (-1008.634) [-1009.472] (-1008.827) -- 0:00:38
      394500 -- (-1011.496) (-1008.296) [-1006.746] (-1008.221) * (-1010.605) (-1009.218) [-1008.630] (-1011.565) -- 0:00:38
      395000 -- (-1008.822) (-1008.660) (-1008.727) [-1007.130] * (-1008.021) (-1009.385) [-1007.598] (-1013.820) -- 0:00:38

      Average standard deviation of split frequencies: 0.014915

      395500 -- (-1011.830) [-1007.598] (-1008.882) (-1010.103) * (-1011.752) (-1008.936) (-1009.147) [-1009.532] -- 0:00:38
      396000 -- (-1008.312) [-1008.824] (-1007.550) (-1007.188) * (-1009.212) [-1007.760] (-1008.268) (-1007.165) -- 0:00:38
      396500 -- (-1007.757) [-1008.316] (-1008.963) (-1007.685) * (-1009.119) (-1008.523) [-1009.192] (-1007.053) -- 0:00:38
      397000 -- (-1007.272) (-1008.721) (-1007.313) [-1007.368] * (-1009.207) [-1011.418] (-1006.856) (-1009.234) -- 0:00:37
      397500 -- (-1007.390) [-1010.056] (-1013.159) (-1011.042) * (-1010.135) (-1010.904) (-1007.656) [-1008.393] -- 0:00:37
      398000 -- (-1007.100) [-1008.377] (-1007.707) (-1013.704) * [-1007.743] (-1006.780) (-1010.376) (-1009.156) -- 0:00:37
      398500 -- (-1007.339) [-1007.987] (-1008.210) (-1008.140) * (-1009.975) [-1008.529] (-1008.392) (-1009.601) -- 0:00:37
      399000 -- (-1006.723) [-1007.175] (-1008.869) (-1010.065) * (-1007.759) (-1009.149) [-1007.717] (-1008.379) -- 0:00:37
      399500 -- (-1011.187) [-1008.079] (-1008.449) (-1009.797) * (-1007.387) [-1014.059] (-1007.746) (-1008.625) -- 0:00:37
      400000 -- (-1010.969) [-1009.709] (-1008.793) (-1010.995) * [-1008.259] (-1013.258) (-1011.146) (-1010.752) -- 0:00:37

      Average standard deviation of split frequencies: 0.014395

      400500 -- (-1010.961) [-1007.624] (-1017.349) (-1009.565) * (-1008.665) (-1014.041) (-1009.552) [-1012.238] -- 0:00:37
      401000 -- [-1010.264] (-1006.930) (-1016.652) (-1010.833) * (-1007.698) (-1011.746) (-1010.390) [-1007.084] -- 0:00:37
      401500 -- (-1011.482) (-1007.953) (-1008.723) [-1008.425] * [-1007.202] (-1008.556) (-1009.285) (-1008.442) -- 0:00:37
      402000 -- (-1009.314) [-1006.868] (-1006.728) (-1009.708) * (-1016.079) (-1010.118) (-1008.042) [-1008.204] -- 0:00:37
      402500 -- [-1011.680] (-1008.560) (-1010.161) (-1011.376) * (-1007.180) (-1012.961) [-1009.158] (-1008.473) -- 0:00:37
      403000 -- [-1010.034] (-1010.062) (-1009.555) (-1007.028) * (-1010.034) (-1010.300) (-1008.976) [-1007.224] -- 0:00:37
      403500 -- [-1010.443] (-1009.644) (-1010.833) (-1012.383) * (-1013.120) [-1009.452] (-1008.941) (-1008.397) -- 0:00:38
      404000 -- (-1008.696) (-1009.677) (-1007.235) [-1010.805] * (-1011.898) [-1011.921] (-1011.295) (-1011.558) -- 0:00:38
      404500 -- [-1007.117] (-1013.285) (-1008.626) (-1011.131) * (-1012.397) (-1008.175) (-1007.859) [-1007.423] -- 0:00:38
      405000 -- [-1006.969] (-1016.497) (-1010.616) (-1011.181) * (-1008.199) (-1008.050) [-1011.272] (-1008.710) -- 0:00:38

      Average standard deviation of split frequencies: 0.013592

      405500 -- (-1006.873) [-1009.590] (-1009.575) (-1008.972) * (-1011.967) (-1012.792) [-1008.133] (-1012.662) -- 0:00:38
      406000 -- [-1008.681] (-1009.995) (-1009.944) (-1011.925) * [-1008.819] (-1014.892) (-1007.355) (-1009.074) -- 0:00:38
      406500 -- (-1009.735) (-1008.469) (-1010.962) [-1008.329] * (-1007.417) (-1008.527) (-1007.574) [-1011.915] -- 0:00:37
      407000 -- (-1009.015) (-1009.725) [-1009.679] (-1006.785) * (-1007.835) (-1007.373) (-1008.749) [-1010.474] -- 0:00:37
      407500 -- (-1011.745) [-1009.168] (-1008.794) (-1006.847) * [-1008.669] (-1009.054) (-1011.901) (-1008.699) -- 0:00:37
      408000 -- (-1009.415) (-1011.104) (-1007.208) [-1010.034] * (-1007.408) [-1007.415] (-1008.407) (-1010.099) -- 0:00:37
      408500 -- [-1009.865] (-1007.826) (-1010.098) (-1009.800) * (-1008.623) (-1008.112) (-1009.294) [-1009.667] -- 0:00:37
      409000 -- (-1012.283) (-1009.526) (-1011.043) [-1009.400] * (-1012.760) (-1009.113) (-1010.794) [-1009.954] -- 0:00:37
      409500 -- (-1009.159) (-1012.295) (-1010.018) [-1009.197] * (-1008.276) (-1009.881) (-1009.308) [-1009.147] -- 0:00:37
      410000 -- (-1010.078) (-1009.184) [-1013.311] (-1007.452) * [-1007.705] (-1006.449) (-1009.132) (-1012.528) -- 0:00:37

      Average standard deviation of split frequencies: 0.013100

      410500 -- (-1008.784) (-1007.515) [-1009.535] (-1008.030) * (-1010.405) [-1006.745] (-1008.822) (-1009.072) -- 0:00:37
      411000 -- [-1007.353] (-1007.137) (-1008.521) (-1011.415) * [-1008.372] (-1008.600) (-1008.098) (-1010.509) -- 0:00:37
      411500 -- (-1007.307) [-1008.447] (-1007.900) (-1009.124) * (-1008.444) (-1007.727) [-1006.735] (-1010.648) -- 0:00:37
      412000 -- (-1007.641) [-1008.664] (-1008.161) (-1010.038) * (-1007.991) [-1007.101] (-1009.250) (-1007.802) -- 0:00:37
      412500 -- (-1011.231) [-1006.766] (-1009.381) (-1006.905) * (-1008.480) (-1007.514) [-1011.290] (-1007.122) -- 0:00:37
      413000 -- (-1011.155) (-1009.146) [-1007.323] (-1011.491) * (-1009.150) [-1010.322] (-1008.075) (-1007.089) -- 0:00:36
      413500 -- (-1008.147) (-1007.215) (-1008.863) [-1013.190] * (-1009.256) (-1010.348) [-1009.877] (-1008.297) -- 0:00:36
      414000 -- (-1009.296) [-1010.277] (-1007.205) (-1012.162) * (-1010.946) [-1007.857] (-1009.605) (-1008.432) -- 0:00:36
      414500 -- (-1006.923) (-1012.795) [-1009.473] (-1010.099) * (-1009.604) [-1008.275] (-1010.524) (-1007.073) -- 0:00:36
      415000 -- (-1008.308) [-1009.486] (-1010.684) (-1008.890) * (-1009.414) (-1011.591) [-1010.857] (-1009.135) -- 0:00:36

      Average standard deviation of split frequencies: 0.012890

      415500 -- [-1009.264] (-1008.101) (-1009.024) (-1017.417) * [-1011.729] (-1011.332) (-1013.870) (-1008.650) -- 0:00:36
      416000 -- (-1011.486) [-1008.601] (-1010.039) (-1015.655) * [-1007.516] (-1007.576) (-1012.950) (-1008.689) -- 0:00:36
      416500 -- (-1011.470) [-1010.989] (-1011.899) (-1013.384) * (-1010.454) [-1009.987] (-1009.045) (-1010.543) -- 0:00:36
      417000 -- [-1009.680] (-1010.029) (-1008.560) (-1009.648) * (-1009.122) (-1009.010) [-1011.486] (-1011.333) -- 0:00:36
      417500 -- [-1008.667] (-1009.273) (-1009.058) (-1007.528) * [-1008.895] (-1009.370) (-1008.592) (-1009.779) -- 0:00:36
      418000 -- [-1007.660] (-1007.800) (-1008.235) (-1007.825) * [-1009.199] (-1013.115) (-1007.900) (-1008.212) -- 0:00:36
      418500 -- [-1007.393] (-1008.005) (-1009.955) (-1006.666) * (-1010.631) (-1011.472) [-1008.714] (-1008.221) -- 0:00:36
      419000 -- (-1011.401) (-1009.662) (-1010.212) [-1008.141] * (-1009.991) [-1009.911] (-1007.368) (-1007.466) -- 0:00:36
      419500 -- (-1007.048) [-1012.233] (-1007.585) (-1008.200) * (-1008.854) (-1007.750) [-1007.010] (-1011.210) -- 0:00:35
      420000 -- (-1010.268) (-1007.530) (-1009.896) [-1008.290] * (-1011.801) (-1010.211) (-1008.666) [-1008.664] -- 0:00:37

      Average standard deviation of split frequencies: 0.012187

      420500 -- (-1008.653) (-1009.977) [-1014.033] (-1008.904) * (-1008.911) [-1009.222] (-1008.953) (-1014.008) -- 0:00:37
      421000 -- [-1009.289] (-1010.284) (-1008.376) (-1008.531) * (-1008.105) [-1008.255] (-1009.913) (-1012.707) -- 0:00:37
      421500 -- (-1010.228) (-1010.140) [-1012.219] (-1008.318) * [-1008.159] (-1007.290) (-1007.982) (-1009.345) -- 0:00:37
      422000 -- (-1007.781) (-1009.543) (-1008.946) [-1008.910] * (-1008.017) [-1009.736] (-1008.465) (-1010.610) -- 0:00:36
      422500 -- (-1010.443) [-1009.319] (-1011.443) (-1009.460) * [-1006.863] (-1009.529) (-1011.832) (-1008.816) -- 0:00:36
      423000 -- (-1008.798) (-1007.868) (-1009.012) [-1009.461] * (-1008.258) [-1010.830] (-1010.103) (-1008.391) -- 0:00:36
      423500 -- (-1010.290) (-1007.342) [-1009.128] (-1011.235) * [-1009.275] (-1009.863) (-1009.252) (-1015.236) -- 0:00:36
      424000 -- (-1008.503) [-1007.397] (-1013.003) (-1007.694) * [-1012.800] (-1010.778) (-1007.928) (-1015.524) -- 0:00:36
      424500 -- (-1019.274) (-1008.014) (-1011.309) [-1007.451] * (-1009.922) [-1007.729] (-1010.351) (-1010.041) -- 0:00:36
      425000 -- (-1013.350) (-1010.184) (-1011.467) [-1006.861] * [-1008.276] (-1008.957) (-1009.822) (-1009.533) -- 0:00:36

      Average standard deviation of split frequencies: 0.013214

      425500 -- (-1020.069) [-1012.077] (-1010.787) (-1009.933) * (-1009.594) (-1011.775) (-1011.002) [-1007.538] -- 0:00:36
      426000 -- (-1008.216) (-1008.453) [-1009.132] (-1009.844) * (-1007.546) [-1010.256] (-1006.999) (-1007.845) -- 0:00:36
      426500 -- (-1011.927) [-1006.930] (-1010.640) (-1008.218) * (-1015.481) (-1009.799) [-1007.778] (-1012.970) -- 0:00:36
      427000 -- (-1009.631) [-1007.004] (-1007.737) (-1009.860) * (-1008.195) (-1007.473) [-1008.002] (-1009.593) -- 0:00:36
      427500 -- (-1007.172) (-1007.011) (-1009.777) [-1008.029] * [-1008.179] (-1009.633) (-1013.784) (-1008.543) -- 0:00:36
      428000 -- (-1008.747) (-1007.935) [-1007.367] (-1010.490) * [-1009.160] (-1009.124) (-1009.398) (-1008.372) -- 0:00:36
      428500 -- (-1007.591) (-1006.963) [-1008.693] (-1011.577) * [-1007.786] (-1009.644) (-1008.224) (-1007.830) -- 0:00:36
      429000 -- (-1008.737) (-1007.029) [-1008.901] (-1011.282) * [-1009.416] (-1010.040) (-1010.350) (-1008.443) -- 0:00:35
      429500 -- (-1007.695) (-1007.215) [-1009.791] (-1010.619) * [-1007.715] (-1009.400) (-1008.619) (-1008.920) -- 0:00:35
      430000 -- (-1008.163) (-1007.687) [-1010.759] (-1008.923) * (-1009.318) (-1009.611) (-1011.604) [-1008.699] -- 0:00:35

      Average standard deviation of split frequencies: 0.013272

      430500 -- (-1008.247) (-1011.962) [-1014.330] (-1007.346) * (-1011.154) (-1008.435) (-1008.834) [-1006.970] -- 0:00:35
      431000 -- (-1009.558) (-1010.298) (-1015.634) [-1007.659] * [-1010.457] (-1007.960) (-1008.442) (-1006.974) -- 0:00:35
      431500 -- (-1012.930) [-1010.469] (-1011.045) (-1009.233) * (-1008.626) (-1007.969) (-1008.031) [-1006.965] -- 0:00:35
      432000 -- [-1006.987] (-1008.084) (-1007.676) (-1008.904) * (-1008.778) [-1010.626] (-1011.223) (-1006.900) -- 0:00:35
      432500 -- (-1007.449) [-1010.775] (-1006.979) (-1008.348) * (-1007.835) (-1012.387) [-1008.470] (-1015.714) -- 0:00:35
      433000 -- (-1007.663) [-1008.652] (-1014.044) (-1011.570) * (-1006.693) (-1010.725) [-1011.405] (-1013.646) -- 0:00:35
      433500 -- (-1011.815) [-1010.197] (-1015.107) (-1008.667) * [-1006.708] (-1008.432) (-1013.573) (-1012.475) -- 0:00:35
      434000 -- [-1011.413] (-1010.089) (-1011.914) (-1009.315) * (-1007.922) (-1008.072) (-1014.567) [-1008.104] -- 0:00:35
      434500 -- (-1012.879) (-1007.193) (-1008.728) [-1009.534] * (-1009.525) [-1010.321] (-1010.541) (-1011.589) -- 0:00:35
      435000 -- (-1012.607) (-1008.313) (-1009.232) [-1007.872] * (-1009.123) [-1009.216] (-1008.215) (-1011.972) -- 0:00:35

      Average standard deviation of split frequencies: 0.013583

      435500 -- (-1010.162) (-1008.747) (-1007.874) [-1008.934] * (-1007.340) (-1007.700) (-1010.513) [-1008.082] -- 0:00:34
      436000 -- (-1008.767) [-1007.840] (-1013.437) (-1008.262) * (-1007.495) [-1008.832] (-1007.659) (-1009.027) -- 0:00:36
      436500 -- [-1009.847] (-1007.353) (-1008.136) (-1007.934) * [-1010.931] (-1007.891) (-1008.855) (-1007.546) -- 0:00:36
      437000 -- (-1008.703) [-1007.492] (-1008.451) (-1007.901) * (-1008.847) (-1008.558) (-1010.025) [-1011.094] -- 0:00:36
      437500 -- (-1013.795) (-1008.632) [-1008.517] (-1009.288) * (-1006.547) [-1008.375] (-1008.431) (-1009.786) -- 0:00:36
      438000 -- [-1010.012] (-1013.240) (-1010.700) (-1011.600) * (-1008.017) (-1009.632) (-1009.221) [-1009.952] -- 0:00:35
      438500 -- (-1008.843) (-1009.116) [-1008.751] (-1009.801) * (-1007.878) [-1009.286] (-1008.122) (-1007.747) -- 0:00:35
      439000 -- (-1008.916) (-1007.612) [-1007.791] (-1010.823) * (-1010.820) (-1011.353) [-1007.440] (-1009.000) -- 0:00:35
      439500 -- [-1010.022] (-1008.134) (-1008.920) (-1011.183) * (-1009.559) (-1010.682) [-1008.965] (-1007.802) -- 0:00:35
      440000 -- [-1009.839] (-1011.778) (-1011.216) (-1007.856) * (-1007.627) [-1015.128] (-1012.969) (-1008.335) -- 0:00:35

      Average standard deviation of split frequencies: 0.012703

      440500 -- [-1009.018] (-1009.546) (-1008.038) (-1007.542) * (-1007.645) (-1011.597) [-1006.972] (-1010.582) -- 0:00:35
      441000 -- (-1008.621) [-1007.779] (-1008.315) (-1007.039) * (-1009.206) (-1008.596) [-1007.133] (-1009.335) -- 0:00:35
      441500 -- (-1007.309) [-1010.937] (-1010.116) (-1007.935) * (-1008.356) (-1007.365) [-1009.618] (-1007.924) -- 0:00:35
      442000 -- (-1008.083) (-1011.369) (-1010.954) [-1007.308] * (-1007.598) (-1008.378) [-1008.552] (-1009.193) -- 0:00:35
      442500 -- (-1011.429) (-1009.232) [-1007.096] (-1008.999) * (-1011.662) (-1007.767) [-1008.117] (-1008.960) -- 0:00:35
      443000 -- (-1007.411) (-1008.348) [-1007.833] (-1010.406) * (-1011.030) (-1008.825) [-1007.886] (-1007.145) -- 0:00:35
      443500 -- [-1008.074] (-1009.181) (-1008.061) (-1008.836) * (-1010.231) (-1009.319) [-1006.966] (-1007.895) -- 0:00:35
      444000 -- (-1007.771) [-1010.268] (-1008.343) (-1007.889) * [-1008.022] (-1008.787) (-1007.171) (-1007.266) -- 0:00:35
      444500 -- (-1010.894) (-1010.395) (-1010.065) [-1008.423] * (-1008.606) (-1007.447) [-1009.640] (-1008.076) -- 0:00:34
      445000 -- (-1013.027) [-1012.344] (-1008.185) (-1007.752) * (-1008.786) [-1008.612] (-1010.160) (-1007.246) -- 0:00:34

      Average standard deviation of split frequencies: 0.012621

      445500 -- (-1010.184) (-1011.849) [-1007.702] (-1008.768) * (-1008.722) [-1009.617] (-1009.638) (-1007.310) -- 0:00:34
      446000 -- (-1010.189) (-1012.179) (-1010.420) [-1008.330] * (-1008.224) (-1007.842) (-1014.470) [-1010.477] -- 0:00:34
      446500 -- (-1010.385) (-1006.641) [-1012.598] (-1008.482) * (-1011.931) (-1008.698) (-1012.404) [-1009.463] -- 0:00:34
      447000 -- [-1007.457] (-1008.584) (-1013.279) (-1013.945) * (-1007.846) [-1009.687] (-1011.271) (-1007.666) -- 0:00:34
      447500 -- (-1007.549) (-1007.476) (-1011.502) [-1010.452] * (-1007.146) (-1007.842) [-1010.532] (-1009.040) -- 0:00:34
      448000 -- (-1009.469) (-1007.677) [-1008.804] (-1006.992) * (-1010.366) (-1008.049) (-1010.047) [-1009.685] -- 0:00:34
      448500 -- (-1009.629) (-1007.405) (-1009.761) [-1010.035] * (-1008.791) (-1009.621) (-1014.030) [-1008.078] -- 0:00:34
      449000 -- (-1008.910) [-1011.000] (-1010.336) (-1013.104) * (-1012.286) (-1013.181) [-1008.134] (-1010.559) -- 0:00:34
      449500 -- (-1010.711) [-1007.818] (-1010.733) (-1012.863) * (-1010.927) (-1009.491) (-1009.309) [-1008.377] -- 0:00:34
      450000 -- [-1010.211] (-1013.894) (-1009.418) (-1008.676) * (-1008.516) [-1006.794] (-1014.304) (-1008.391) -- 0:00:34

      Average standard deviation of split frequencies: 0.013106

      450500 -- (-1008.937) (-1009.188) [-1008.869] (-1009.483) * (-1010.836) (-1008.150) (-1011.351) [-1008.844] -- 0:00:34
      451000 -- [-1008.148] (-1008.285) (-1009.756) (-1009.789) * (-1007.859) (-1008.307) [-1009.376] (-1008.310) -- 0:00:34
      451500 -- [-1014.973] (-1008.991) (-1008.840) (-1010.442) * (-1009.294) [-1008.996] (-1007.941) (-1007.962) -- 0:00:34
      452000 -- (-1013.511) (-1009.498) [-1007.481] (-1007.501) * [-1009.365] (-1008.709) (-1008.678) (-1012.553) -- 0:00:33
      452500 -- (-1012.145) (-1007.816) (-1010.250) [-1010.636] * (-1009.467) [-1008.646] (-1010.065) (-1009.106) -- 0:00:35
      453000 -- (-1011.797) (-1007.967) [-1007.876] (-1013.358) * (-1007.914) (-1010.990) (-1008.367) [-1006.854] -- 0:00:35
      453500 -- [-1009.083] (-1007.967) (-1008.052) (-1009.814) * (-1009.363) [-1007.077] (-1014.038) (-1009.525) -- 0:00:34
      454000 -- [-1010.284] (-1008.970) (-1009.441) (-1007.378) * (-1009.080) (-1006.953) (-1010.453) [-1007.179] -- 0:00:34
      454500 -- [-1008.927] (-1009.885) (-1008.035) (-1007.053) * (-1008.388) (-1008.032) (-1009.649) [-1010.454] -- 0:00:34
      455000 -- (-1008.298) [-1009.132] (-1010.168) (-1009.545) * [-1009.893] (-1006.656) (-1009.266) (-1008.529) -- 0:00:34

      Average standard deviation of split frequencies: 0.013310

      455500 -- (-1008.104) [-1008.383] (-1010.896) (-1012.188) * (-1010.297) [-1006.657] (-1007.368) (-1008.401) -- 0:00:34
      456000 -- (-1013.154) (-1009.220) [-1009.799] (-1009.909) * (-1011.732) (-1011.670) (-1007.361) [-1008.031] -- 0:00:34
      456500 -- (-1008.494) (-1007.748) (-1007.791) [-1010.164] * [-1007.735] (-1014.546) (-1007.122) (-1007.718) -- 0:00:34
      457000 -- (-1007.204) [-1009.097] (-1008.402) (-1011.969) * [-1009.588] (-1009.246) (-1008.805) (-1009.120) -- 0:00:34
      457500 -- [-1009.428] (-1008.535) (-1012.080) (-1010.541) * (-1008.344) (-1008.772) (-1008.030) [-1009.093] -- 0:00:34
      458000 -- (-1007.432) [-1007.729] (-1011.517) (-1010.397) * [-1008.150] (-1011.856) (-1008.695) (-1012.661) -- 0:00:34
      458500 -- (-1006.997) (-1007.229) [-1009.135] (-1014.564) * (-1008.921) (-1007.857) [-1011.032] (-1010.481) -- 0:00:34
      459000 -- [-1006.775] (-1010.669) (-1009.050) (-1009.020) * (-1007.531) [-1007.877] (-1008.079) (-1014.242) -- 0:00:34
      459500 -- [-1011.733] (-1011.056) (-1011.860) (-1007.277) * (-1013.796) (-1009.000) [-1007.234] (-1013.439) -- 0:00:34
      460000 -- (-1008.052) (-1010.079) [-1007.832] (-1008.306) * [-1007.305] (-1008.452) (-1006.795) (-1010.180) -- 0:00:34

      Average standard deviation of split frequencies: 0.013495

      460500 -- [-1011.941] (-1010.981) (-1007.011) (-1008.291) * (-1007.678) [-1008.082] (-1008.443) (-1009.240) -- 0:00:33
      461000 -- (-1009.366) [-1009.728] (-1012.672) (-1008.530) * [-1010.690] (-1007.863) (-1008.771) (-1011.299) -- 0:00:33
      461500 -- (-1009.763) [-1007.460] (-1008.135) (-1007.187) * (-1012.784) (-1012.401) [-1007.800] (-1012.177) -- 0:00:33
      462000 -- (-1007.003) (-1006.661) (-1009.749) [-1007.024] * (-1012.204) [-1008.126] (-1008.905) (-1010.020) -- 0:00:33
      462500 -- (-1012.098) (-1011.410) [-1011.043] (-1010.063) * (-1010.593) (-1007.470) (-1014.710) [-1012.612] -- 0:00:33
      463000 -- (-1014.937) (-1011.696) [-1008.627] (-1009.020) * (-1011.266) (-1006.743) [-1007.507] (-1014.286) -- 0:00:33
      463500 -- (-1013.248) [-1007.546] (-1010.075) (-1008.136) * [-1009.551] (-1009.251) (-1007.165) (-1009.213) -- 0:00:33
      464000 -- (-1009.825) [-1007.937] (-1007.195) (-1008.730) * [-1008.610] (-1009.440) (-1008.129) (-1010.365) -- 0:00:33
      464500 -- (-1009.194) (-1008.047) [-1007.311] (-1008.408) * (-1009.818) (-1006.857) [-1008.358] (-1007.729) -- 0:00:33
      465000 -- [-1008.327] (-1007.806) (-1008.607) (-1008.158) * (-1010.351) (-1007.646) [-1008.292] (-1012.601) -- 0:00:33

      Average standard deviation of split frequencies: 0.012645

      465500 -- [-1007.303] (-1009.054) (-1008.416) (-1012.782) * [-1008.230] (-1010.276) (-1008.414) (-1008.829) -- 0:00:33
      466000 -- (-1008.405) [-1007.046] (-1008.772) (-1008.951) * [-1007.337] (-1008.976) (-1011.812) (-1014.593) -- 0:00:33
      466500 -- (-1010.673) (-1008.749) [-1009.650] (-1008.929) * [-1010.993] (-1010.505) (-1009.181) (-1008.438) -- 0:00:33
      467000 -- (-1011.257) (-1012.233) [-1009.346] (-1010.069) * (-1010.932) [-1007.948] (-1011.956) (-1008.602) -- 0:00:33
      467500 -- (-1010.615) [-1011.355] (-1012.398) (-1010.824) * (-1008.578) (-1009.381) [-1010.060] (-1011.742) -- 0:00:33
      468000 -- (-1007.334) (-1010.646) [-1009.620] (-1008.684) * (-1008.103) [-1009.533] (-1009.627) (-1010.415) -- 0:00:32
      468500 -- [-1007.647] (-1011.472) (-1010.445) (-1009.716) * (-1009.964) (-1008.437) [-1006.909] (-1007.818) -- 0:00:32
      469000 -- (-1008.929) [-1009.329] (-1008.633) (-1014.753) * (-1008.996) [-1007.888] (-1008.898) (-1007.471) -- 0:00:33
      469500 -- (-1011.573) [-1008.786] (-1008.743) (-1007.555) * (-1008.908) (-1011.008) (-1013.456) [-1010.906] -- 0:00:33
      470000 -- [-1008.657] (-1011.462) (-1011.968) (-1006.869) * (-1010.662) (-1010.234) (-1014.475) [-1008.797] -- 0:00:33

      Average standard deviation of split frequencies: 0.012457

      470500 -- [-1009.151] (-1008.222) (-1010.113) (-1008.245) * [-1010.077] (-1008.031) (-1014.673) (-1011.832) -- 0:00:33
      471000 -- (-1009.219) (-1007.277) (-1012.481) [-1007.609] * (-1008.152) [-1007.513] (-1009.512) (-1011.993) -- 0:00:33
      471500 -- (-1012.413) (-1009.053) (-1011.041) [-1008.610] * (-1012.404) (-1011.102) [-1009.685] (-1013.530) -- 0:00:33
      472000 -- (-1009.732) (-1008.586) (-1007.587) [-1009.171] * (-1010.685) [-1008.333] (-1008.033) (-1011.172) -- 0:00:33
      472500 -- (-1008.725) (-1009.693) [-1007.531] (-1011.398) * (-1010.250) [-1009.733] (-1013.286) (-1009.415) -- 0:00:33
      473000 -- (-1007.885) (-1009.366) [-1009.115] (-1010.437) * [-1006.879] (-1008.355) (-1012.685) (-1009.272) -- 0:00:33
      473500 -- (-1010.096) (-1011.976) (-1007.681) [-1006.651] * (-1009.047) (-1007.452) (-1008.767) [-1007.805] -- 0:00:33
      474000 -- (-1011.046) [-1008.502] (-1009.082) (-1008.015) * (-1009.919) (-1008.262) [-1009.586] (-1008.249) -- 0:00:33
      474500 -- [-1008.992] (-1009.831) (-1007.762) (-1007.334) * (-1006.716) [-1007.352] (-1010.901) (-1007.342) -- 0:00:33
      475000 -- (-1012.465) (-1007.549) [-1008.348] (-1009.532) * (-1007.828) [-1007.057] (-1014.552) (-1007.420) -- 0:00:33

      Average standard deviation of split frequencies: 0.011698

      475500 -- (-1010.611) (-1011.074) [-1010.903] (-1010.270) * (-1011.326) (-1007.451) [-1014.301] (-1011.530) -- 0:00:33
      476000 -- (-1007.956) [-1009.786] (-1008.157) (-1009.629) * [-1008.123] (-1011.112) (-1009.505) (-1009.689) -- 0:00:33
      476500 -- (-1011.100) [-1009.885] (-1011.159) (-1007.557) * (-1010.150) (-1009.204) [-1008.892] (-1007.030) -- 0:00:32
      477000 -- (-1009.041) (-1014.187) [-1006.763] (-1007.376) * (-1013.653) (-1011.547) [-1011.750] (-1010.259) -- 0:00:32
      477500 -- (-1014.435) [-1009.991] (-1008.954) (-1009.459) * (-1009.609) (-1010.025) (-1011.313) [-1009.462] -- 0:00:32
      478000 -- (-1010.232) (-1009.474) [-1010.947] (-1009.402) * (-1008.428) (-1008.135) (-1015.286) [-1008.390] -- 0:00:32
      478500 -- [-1009.385] (-1010.478) (-1009.825) (-1010.436) * (-1007.325) (-1009.363) (-1011.568) [-1007.929] -- 0:00:32
      479000 -- (-1009.968) (-1008.605) (-1008.349) [-1014.019] * [-1007.615] (-1006.847) (-1009.826) (-1008.687) -- 0:00:32
      479500 -- [-1008.067] (-1009.632) (-1006.879) (-1010.637) * (-1008.254) [-1009.065] (-1008.532) (-1009.135) -- 0:00:32
      480000 -- (-1007.276) (-1008.617) [-1006.887] (-1010.176) * [-1008.811] (-1009.386) (-1008.427) (-1009.485) -- 0:00:32

      Average standard deviation of split frequencies: 0.012014

      480500 -- (-1011.190) (-1009.540) [-1007.287] (-1008.797) * (-1009.722) (-1009.125) [-1007.641] (-1007.094) -- 0:00:32
      481000 -- (-1007.374) (-1008.304) [-1008.967] (-1010.558) * [-1008.171] (-1007.535) (-1009.219) (-1010.117) -- 0:00:32
      481500 -- (-1012.628) (-1008.242) (-1011.072) [-1008.052] * (-1010.061) [-1011.702] (-1007.358) (-1008.720) -- 0:00:32
      482000 -- (-1007.873) [-1006.701] (-1007.034) (-1009.428) * (-1011.317) (-1012.262) [-1009.420] (-1008.296) -- 0:00:32
      482500 -- (-1010.401) (-1007.571) (-1007.472) [-1009.849] * (-1010.922) (-1009.363) [-1008.115] (-1010.670) -- 0:00:32
      483000 -- (-1008.159) [-1008.370] (-1007.472) (-1011.757) * [-1009.984] (-1008.205) (-1007.833) (-1009.015) -- 0:00:32
      483500 -- (-1016.143) (-1006.929) [-1008.603] (-1011.747) * (-1009.875) (-1008.809) [-1010.002] (-1010.172) -- 0:00:32
      484000 -- (-1011.834) (-1008.127) [-1008.195] (-1009.774) * (-1009.251) [-1009.281] (-1007.983) (-1010.032) -- 0:00:31
      484500 -- (-1010.602) (-1007.021) (-1008.878) [-1010.318] * (-1007.406) [-1007.565] (-1006.578) (-1011.348) -- 0:00:31
      485000 -- (-1008.646) [-1010.171] (-1009.081) (-1011.774) * (-1009.047) (-1008.059) [-1007.162] (-1009.815) -- 0:00:32

      Average standard deviation of split frequencies: 0.012367

      485500 -- (-1008.685) (-1008.254) (-1008.226) [-1008.706] * [-1009.473] (-1009.678) (-1007.902) (-1006.890) -- 0:00:32
      486000 -- (-1007.973) (-1008.213) [-1010.468] (-1007.905) * (-1009.524) (-1008.100) (-1007.131) [-1007.553] -- 0:00:32
      486500 -- (-1008.032) (-1010.256) (-1011.185) [-1008.244] * (-1008.752) (-1007.937) [-1011.010] (-1007.813) -- 0:00:32
      487000 -- (-1008.383) [-1007.592] (-1008.784) (-1007.648) * (-1009.184) (-1008.781) (-1008.711) [-1009.166] -- 0:00:32
      487500 -- (-1011.711) [-1007.770] (-1006.657) (-1007.726) * (-1009.291) (-1015.063) [-1007.911] (-1007.712) -- 0:00:32
      488000 -- [-1007.496] (-1008.227) (-1008.054) (-1009.611) * [-1007.791] (-1013.447) (-1008.316) (-1009.279) -- 0:00:32
      488500 -- (-1008.168) (-1009.967) [-1006.754] (-1008.493) * [-1008.272] (-1010.689) (-1006.990) (-1008.407) -- 0:00:32
      489000 -- [-1008.082] (-1007.635) (-1010.627) (-1006.880) * (-1010.224) (-1016.638) (-1006.990) [-1009.117] -- 0:00:32
      489500 -- [-1008.181] (-1007.350) (-1008.412) (-1007.532) * (-1008.640) [-1009.100] (-1007.371) (-1008.582) -- 0:00:32
      490000 -- [-1007.752] (-1010.475) (-1009.926) (-1009.846) * (-1008.730) (-1010.726) [-1007.627] (-1009.087) -- 0:00:32

      Average standard deviation of split frequencies: 0.012069

      490500 -- (-1009.992) (-1016.118) (-1009.903) [-1011.457] * (-1008.287) [-1010.395] (-1008.895) (-1012.596) -- 0:00:32
      491000 -- (-1007.790) (-1008.756) (-1009.766) [-1008.670] * (-1008.225) [-1007.172] (-1011.719) (-1010.626) -- 0:00:32
      491500 -- [-1006.934] (-1010.031) (-1007.210) (-1007.068) * [-1008.500] (-1007.649) (-1008.648) (-1010.588) -- 0:00:32
      492000 -- (-1007.543) [-1009.683] (-1011.252) (-1007.029) * [-1010.284] (-1008.418) (-1008.404) (-1010.849) -- 0:00:32
      492500 -- (-1007.556) (-1008.376) (-1009.130) [-1008.742] * (-1010.403) [-1009.576] (-1007.524) (-1011.641) -- 0:00:31
      493000 -- [-1009.476] (-1010.375) (-1007.779) (-1007.923) * [-1009.342] (-1010.775) (-1009.062) (-1007.883) -- 0:00:31
      493500 -- (-1008.771) (-1007.988) (-1015.756) [-1010.582] * (-1007.600) (-1008.861) (-1011.057) [-1008.522] -- 0:00:31
      494000 -- (-1011.272) [-1008.429] (-1009.227) (-1009.260) * [-1007.897] (-1012.895) (-1010.042) (-1009.371) -- 0:00:31
      494500 -- [-1008.953] (-1008.137) (-1009.102) (-1008.410) * (-1010.720) (-1010.226) [-1014.206] (-1009.242) -- 0:00:31
      495000 -- (-1007.818) [-1007.380] (-1009.090) (-1012.408) * [-1011.665] (-1007.397) (-1009.027) (-1013.494) -- 0:00:31

      Average standard deviation of split frequencies: 0.012712

      495500 -- [-1011.749] (-1007.721) (-1010.379) (-1011.484) * (-1009.035) [-1008.244] (-1011.087) (-1012.904) -- 0:00:31
      496000 -- (-1016.216) (-1009.793) (-1007.943) [-1008.149] * (-1008.363) (-1009.596) (-1007.907) [-1012.449] -- 0:00:31
      496500 -- (-1009.571) (-1007.922) (-1009.029) [-1009.266] * (-1010.484) (-1010.477) [-1011.248] (-1007.983) -- 0:00:31
      497000 -- (-1008.675) (-1008.879) [-1007.718] (-1009.764) * (-1006.819) (-1008.733) (-1009.068) [-1006.873] -- 0:00:31
      497500 -- [-1007.165] (-1006.905) (-1008.333) (-1006.955) * (-1010.145) [-1010.606] (-1009.319) (-1009.411) -- 0:00:31
      498000 -- (-1008.641) (-1007.233) [-1008.355] (-1010.624) * (-1007.266) [-1007.902] (-1013.444) (-1008.274) -- 0:00:31
      498500 -- (-1014.020) [-1007.047] (-1007.961) (-1011.984) * (-1008.170) (-1010.502) (-1009.787) [-1012.782] -- 0:00:31
      499000 -- (-1007.868) [-1007.595] (-1013.108) (-1010.378) * (-1009.501) [-1011.190] (-1007.859) (-1009.225) -- 0:00:31
      499500 -- (-1010.809) (-1008.260) [-1008.781] (-1009.917) * [-1006.747] (-1009.103) (-1012.772) (-1008.400) -- 0:00:31
      500000 -- [-1008.689] (-1009.843) (-1011.932) (-1007.613) * (-1011.728) (-1007.838) (-1012.227) [-1007.418] -- 0:00:31

      Average standard deviation of split frequencies: 0.012946

      500500 -- (-1007.209) (-1007.128) (-1007.836) [-1007.244] * (-1007.770) [-1007.554] (-1013.256) (-1007.663) -- 0:00:30
      501000 -- (-1014.949) (-1007.774) (-1010.030) [-1007.248] * [-1009.114] (-1013.066) (-1012.449) (-1010.810) -- 0:00:31
      501500 -- (-1014.225) (-1008.699) (-1010.364) [-1007.325] * (-1009.024) (-1009.232) [-1008.648] (-1007.265) -- 0:00:31
      502000 -- [-1011.418] (-1007.664) (-1009.963) (-1007.325) * [-1008.183] (-1009.139) (-1009.493) (-1006.600) -- 0:00:31
      502500 -- (-1012.146) [-1008.965] (-1009.115) (-1008.007) * [-1013.271] (-1007.126) (-1011.798) (-1006.602) -- 0:00:31
      503000 -- [-1007.337] (-1009.719) (-1008.973) (-1011.338) * (-1009.429) (-1008.045) [-1007.781] (-1008.800) -- 0:00:31
      503500 -- (-1008.115) (-1008.923) [-1009.837] (-1008.006) * [-1011.698] (-1008.156) (-1009.800) (-1008.171) -- 0:00:31
      504000 -- (-1009.707) (-1015.268) (-1011.583) [-1010.588] * (-1008.552) [-1009.516] (-1008.682) (-1008.063) -- 0:00:31
      504500 -- [-1007.313] (-1009.925) (-1011.829) (-1007.806) * [-1008.476] (-1010.453) (-1008.999) (-1008.726) -- 0:00:31
      505000 -- (-1008.369) (-1008.993) [-1007.811] (-1009.468) * (-1007.989) [-1008.144] (-1010.454) (-1007.667) -- 0:00:31

      Average standard deviation of split frequencies: 0.013207

      505500 -- [-1008.645] (-1006.806) (-1008.050) (-1008.992) * [-1009.625] (-1009.777) (-1008.294) (-1010.197) -- 0:00:31
      506000 -- (-1012.609) (-1008.050) (-1008.688) [-1009.611] * [-1010.197] (-1008.221) (-1008.011) (-1009.910) -- 0:00:31
      506500 -- (-1011.727) (-1008.713) (-1010.530) [-1007.859] * [-1007.963] (-1009.330) (-1009.269) (-1010.777) -- 0:00:31
      507000 -- [-1008.521] (-1008.142) (-1008.802) (-1006.823) * (-1015.332) (-1009.414) (-1007.498) [-1008.696] -- 0:00:31
      507500 -- (-1006.559) [-1009.382] (-1010.448) (-1008.397) * (-1011.340) (-1009.205) (-1010.230) [-1008.612] -- 0:00:31
      508000 -- (-1007.194) (-1009.251) [-1009.778] (-1006.832) * [-1009.851] (-1008.754) (-1010.232) (-1008.855) -- 0:00:30
      508500 -- (-1008.625) [-1008.718] (-1008.507) (-1009.664) * (-1009.694) [-1008.641] (-1009.461) (-1010.648) -- 0:00:30
      509000 -- (-1008.296) (-1006.544) [-1006.798] (-1010.923) * (-1008.738) (-1007.915) [-1007.846] (-1007.491) -- 0:00:30
      509500 -- (-1008.163) (-1010.096) (-1009.376) [-1007.974] * (-1011.747) (-1012.265) [-1013.046] (-1009.749) -- 0:00:30
      510000 -- [-1007.563] (-1007.810) (-1007.834) (-1011.858) * (-1009.103) (-1012.825) [-1007.609] (-1009.801) -- 0:00:30

      Average standard deviation of split frequencies: 0.013684

      510500 -- (-1006.621) (-1010.049) [-1008.038] (-1007.322) * (-1008.316) (-1016.647) [-1007.819] (-1014.414) -- 0:00:30
      511000 -- (-1008.503) (-1008.913) (-1009.489) [-1007.815] * (-1009.338) (-1012.549) [-1007.994] (-1008.605) -- 0:00:30
      511500 -- [-1008.095] (-1010.435) (-1008.508) (-1007.803) * [-1007.269] (-1008.444) (-1009.349) (-1007.450) -- 0:00:30
      512000 -- (-1008.388) [-1009.860] (-1010.942) (-1018.953) * (-1008.436) [-1007.373] (-1007.910) (-1006.584) -- 0:00:30
      512500 -- (-1007.762) (-1009.314) (-1007.955) [-1006.798] * (-1008.965) (-1008.072) (-1007.633) [-1012.969] -- 0:00:30
      513000 -- (-1010.606) (-1006.884) [-1009.459] (-1009.506) * [-1007.030] (-1010.022) (-1009.415) (-1007.345) -- 0:00:30
      513500 -- (-1016.348) [-1008.784] (-1007.952) (-1009.382) * (-1009.102) (-1007.702) (-1009.875) [-1009.306] -- 0:00:30
      514000 -- [-1012.476] (-1009.090) (-1009.559) (-1008.159) * (-1008.633) (-1008.031) (-1014.238) [-1007.599] -- 0:00:30
      514500 -- (-1008.377) (-1008.691) (-1009.654) [-1007.854] * (-1009.798) (-1009.328) (-1010.128) [-1007.604] -- 0:00:30
      515000 -- [-1007.779] (-1010.766) (-1009.155) (-1013.616) * (-1007.662) (-1008.026) (-1008.064) [-1008.756] -- 0:00:30

      Average standard deviation of split frequencies: 0.014566

      515500 -- [-1007.841] (-1009.857) (-1008.496) (-1007.868) * [-1007.891] (-1009.567) (-1008.181) (-1010.470) -- 0:00:30
      516000 -- (-1008.073) (-1009.174) (-1010.534) [-1007.338] * (-1008.043) (-1008.485) (-1007.048) [-1009.861] -- 0:00:30
      516500 -- (-1008.857) [-1009.611] (-1009.024) (-1008.526) * (-1010.093) (-1008.903) [-1009.563] (-1011.203) -- 0:00:29
      517000 -- (-1007.822) [-1007.813] (-1010.420) (-1009.591) * [-1007.574] (-1010.048) (-1010.078) (-1011.979) -- 0:00:29
      517500 -- (-1008.516) (-1009.213) (-1009.002) [-1007.885] * (-1010.353) (-1012.564) [-1008.317] (-1012.429) -- 0:00:30
      518000 -- (-1008.247) (-1008.976) [-1007.941] (-1007.417) * (-1012.607) (-1013.790) (-1008.917) [-1009.218] -- 0:00:30
      518500 -- [-1007.772] (-1008.765) (-1006.940) (-1009.623) * (-1008.386) [-1006.845] (-1011.344) (-1010.212) -- 0:00:30
      519000 -- [-1008.246] (-1007.858) (-1007.414) (-1009.180) * [-1012.234] (-1007.012) (-1013.828) (-1009.699) -- 0:00:30
      519500 -- (-1009.418) (-1008.074) [-1008.312] (-1008.986) * (-1014.899) [-1006.860] (-1010.199) (-1010.207) -- 0:00:30
      520000 -- (-1007.770) (-1011.672) (-1007.406) [-1008.219] * (-1008.643) (-1007.446) [-1011.683] (-1012.056) -- 0:00:30

      Average standard deviation of split frequencies: 0.014436

      520500 -- (-1007.905) (-1019.960) [-1009.667] (-1008.493) * (-1009.324) [-1008.339] (-1007.371) (-1007.613) -- 0:00:30
      521000 -- (-1010.633) [-1008.015] (-1011.013) (-1008.578) * (-1009.802) (-1010.253) (-1007.512) [-1007.831] -- 0:00:30
      521500 -- [-1008.267] (-1007.170) (-1010.627) (-1009.945) * (-1009.407) (-1009.200) (-1007.025) [-1007.990] -- 0:00:30
      522000 -- [-1009.102] (-1007.229) (-1007.822) (-1010.343) * (-1008.596) (-1008.338) [-1008.539] (-1008.714) -- 0:00:30
      522500 -- (-1007.744) [-1007.194] (-1008.720) (-1008.650) * (-1010.191) (-1008.025) (-1014.063) [-1007.525] -- 0:00:30
      523000 -- (-1008.838) [-1008.410] (-1007.020) (-1006.759) * (-1008.918) (-1009.599) (-1015.459) [-1007.184] -- 0:00:30
      523500 -- (-1012.279) (-1008.589) [-1008.222] (-1008.514) * (-1009.901) [-1009.574] (-1011.570) (-1010.489) -- 0:00:30
      524000 -- (-1011.217) (-1008.436) [-1009.855] (-1007.807) * [-1010.132] (-1008.218) (-1014.158) (-1010.799) -- 0:00:29
      524500 -- (-1009.914) (-1007.510) (-1012.659) [-1008.034] * (-1011.866) (-1007.670) (-1016.437) [-1009.794] -- 0:00:29
      525000 -- (-1009.798) [-1007.375] (-1009.668) (-1007.387) * (-1007.884) (-1008.619) [-1011.280] (-1011.037) -- 0:00:29

      Average standard deviation of split frequencies: 0.014240

      525500 -- (-1010.897) (-1009.461) [-1009.093] (-1010.218) * (-1007.661) [-1008.935] (-1012.683) (-1011.660) -- 0:00:29
      526000 -- [-1008.648] (-1008.055) (-1010.726) (-1009.972) * (-1011.659) (-1007.568) [-1008.752] (-1010.713) -- 0:00:29
      526500 -- (-1008.712) [-1010.471] (-1007.237) (-1009.877) * (-1007.768) [-1006.618] (-1010.213) (-1007.272) -- 0:00:29
      527000 -- (-1015.594) (-1010.248) [-1007.223] (-1007.899) * (-1008.433) (-1010.786) [-1008.486] (-1009.375) -- 0:00:29
      527500 -- (-1013.135) (-1014.140) [-1007.613] (-1008.745) * (-1008.473) (-1010.094) (-1009.374) [-1012.498] -- 0:00:29
      528000 -- (-1010.070) (-1013.626) [-1011.816] (-1009.918) * (-1010.158) (-1008.087) (-1014.498) [-1010.738] -- 0:00:29
      528500 -- (-1015.784) (-1012.218) (-1010.917) [-1007.187] * (-1006.931) [-1011.767] (-1009.062) (-1007.352) -- 0:00:29
      529000 -- [-1011.022] (-1016.824) (-1008.878) (-1008.844) * (-1007.505) [-1009.619] (-1011.739) (-1007.457) -- 0:00:29
      529500 -- (-1008.694) (-1008.055) (-1009.401) [-1007.235] * (-1007.624) (-1007.586) (-1009.222) [-1008.188] -- 0:00:29
      530000 -- (-1008.717) (-1007.958) [-1010.012] (-1007.405) * (-1008.767) (-1007.969) (-1008.041) [-1015.330] -- 0:00:29

      Average standard deviation of split frequencies: 0.013522

      530500 -- (-1009.348) (-1009.113) [-1008.212] (-1009.680) * (-1006.914) [-1008.038] (-1009.692) (-1012.117) -- 0:00:29
      531000 -- (-1012.259) (-1009.085) [-1007.837] (-1010.366) * (-1007.568) [-1011.015] (-1008.039) (-1009.716) -- 0:00:29
      531500 -- (-1015.400) (-1008.089) [-1007.121] (-1014.420) * (-1009.486) [-1008.336] (-1008.144) (-1008.493) -- 0:00:29
      532000 -- (-1011.017) [-1009.290] (-1008.553) (-1009.946) * (-1010.492) (-1006.722) [-1008.836] (-1013.458) -- 0:00:29
      532500 -- (-1008.021) [-1009.160] (-1011.407) (-1009.032) * (-1010.166) [-1008.045] (-1010.274) (-1009.917) -- 0:00:28
      533000 -- (-1009.581) (-1012.815) [-1011.649] (-1010.267) * [-1007.618] (-1010.296) (-1009.450) (-1012.684) -- 0:00:29
      533500 -- (-1008.256) [-1009.251] (-1010.263) (-1009.376) * (-1011.399) [-1010.874] (-1009.922) (-1011.087) -- 0:00:29
      534000 -- [-1007.734] (-1008.730) (-1007.349) (-1009.330) * [-1008.529] (-1011.183) (-1007.859) (-1007.695) -- 0:00:29
      534500 -- (-1010.868) (-1009.156) [-1007.494] (-1009.089) * [-1008.304] (-1006.993) (-1009.338) (-1008.762) -- 0:00:29
      535000 -- (-1008.605) [-1008.689] (-1012.156) (-1008.041) * (-1009.771) [-1010.223] (-1009.753) (-1008.530) -- 0:00:29

      Average standard deviation of split frequencies: 0.013388

      535500 -- (-1010.447) (-1008.117) (-1009.686) [-1008.299] * (-1009.608) [-1009.705] (-1008.848) (-1007.512) -- 0:00:29
      536000 -- [-1008.497] (-1008.003) (-1010.954) (-1011.942) * (-1008.029) (-1011.204) (-1008.550) [-1007.722] -- 0:00:29
      536500 -- (-1007.166) [-1008.179] (-1010.573) (-1009.294) * (-1009.241) (-1016.369) (-1011.006) [-1007.136] -- 0:00:29
      537000 -- (-1009.013) [-1007.588] (-1007.841) (-1010.740) * [-1010.474] (-1008.397) (-1014.694) (-1012.444) -- 0:00:29
      537500 -- [-1007.553] (-1007.316) (-1008.289) (-1006.638) * (-1008.451) (-1008.339) (-1010.759) [-1012.704] -- 0:00:29
      538000 -- [-1008.777] (-1010.146) (-1008.364) (-1007.115) * (-1009.432) (-1007.680) (-1009.565) [-1012.067] -- 0:00:29
      538500 -- [-1007.056] (-1012.957) (-1012.461) (-1008.720) * [-1009.341] (-1007.680) (-1008.330) (-1011.022) -- 0:00:29
      539000 -- (-1007.031) (-1013.425) [-1008.667] (-1007.965) * (-1012.205) (-1011.092) [-1009.247] (-1010.428) -- 0:00:29
      539500 -- [-1007.486] (-1007.597) (-1007.722) (-1010.184) * (-1011.011) [-1008.989] (-1010.576) (-1009.409) -- 0:00:29
      540000 -- (-1007.217) (-1008.457) (-1007.846) [-1009.171] * (-1014.130) (-1010.473) (-1007.852) [-1007.704] -- 0:00:28

      Average standard deviation of split frequencies: 0.013078

      540500 -- (-1008.126) (-1010.591) [-1008.584] (-1011.525) * (-1009.590) (-1020.550) (-1009.996) [-1008.608] -- 0:00:28
      541000 -- [-1006.853] (-1008.929) (-1010.556) (-1009.452) * (-1008.983) (-1011.400) [-1007.063] (-1008.765) -- 0:00:28
      541500 -- [-1006.741] (-1009.784) (-1010.487) (-1008.300) * (-1009.753) (-1008.185) (-1008.602) [-1010.072] -- 0:00:28
      542000 -- (-1007.957) (-1006.626) [-1008.284] (-1008.464) * (-1020.817) (-1010.005) [-1012.086] (-1007.167) -- 0:00:28
      542500 -- (-1007.956) (-1008.287) (-1009.179) [-1007.820] * (-1006.738) (-1010.074) [-1007.368] (-1014.209) -- 0:00:28
      543000 -- (-1008.163) [-1008.103] (-1009.964) (-1009.491) * (-1010.906) (-1007.520) [-1007.420] (-1007.786) -- 0:00:28
      543500 -- (-1007.184) (-1009.639) (-1009.452) [-1008.094] * (-1008.281) (-1008.814) [-1007.966] (-1012.894) -- 0:00:28
      544000 -- (-1012.473) (-1007.285) (-1007.758) [-1007.979] * (-1010.467) [-1008.183] (-1007.434) (-1012.008) -- 0:00:28
      544500 -- (-1008.507) [-1006.457] (-1008.222) (-1008.562) * (-1008.761) (-1011.137) (-1010.186) [-1008.553] -- 0:00:28
      545000 -- (-1008.523) (-1006.869) [-1008.268] (-1008.332) * (-1009.058) [-1011.275] (-1009.636) (-1007.748) -- 0:00:28

      Average standard deviation of split frequencies: 0.012567

      545500 -- (-1008.528) (-1007.462) [-1007.608] (-1008.904) * (-1011.095) [-1008.585] (-1008.645) (-1007.965) -- 0:00:28
      546000 -- (-1012.219) (-1007.812) (-1009.258) [-1007.568] * (-1009.555) (-1012.393) (-1007.458) [-1006.829] -- 0:00:28
      546500 -- [-1009.396] (-1010.095) (-1009.040) (-1011.295) * (-1009.647) (-1008.780) (-1007.024) [-1007.030] -- 0:00:28
      547000 -- [-1009.128] (-1008.231) (-1007.994) (-1011.225) * (-1009.745) (-1008.325) (-1012.614) [-1007.506] -- 0:00:28
      547500 -- (-1013.037) [-1008.217] (-1008.189) (-1008.001) * (-1008.056) (-1008.703) (-1011.088) [-1008.206] -- 0:00:28
      548000 -- (-1009.037) [-1009.885] (-1009.817) (-1014.442) * (-1008.017) (-1010.111) (-1012.864) [-1008.587] -- 0:00:28
      548500 -- (-1009.257) [-1013.265] (-1010.255) (-1013.170) * (-1009.165) [-1010.217] (-1009.742) (-1007.325) -- 0:00:28
      549000 -- (-1010.142) (-1013.072) [-1009.687] (-1009.483) * (-1008.925) [-1011.892] (-1010.339) (-1008.970) -- 0:00:28
      549500 -- (-1009.092) (-1008.712) [-1009.037] (-1010.463) * (-1010.230) (-1012.012) [-1008.588] (-1008.703) -- 0:00:28
      550000 -- (-1009.426) (-1007.808) [-1008.077] (-1008.668) * (-1010.193) (-1009.100) (-1007.794) [-1010.610] -- 0:00:28

      Average standard deviation of split frequencies: 0.012791

      550500 -- (-1009.587) (-1007.484) (-1007.819) [-1011.976] * (-1010.383) (-1008.176) (-1011.533) [-1008.536] -- 0:00:28
      551000 -- (-1010.886) (-1007.261) (-1012.889) [-1012.171] * (-1011.216) [-1008.481] (-1009.466) (-1008.439) -- 0:00:28
      551500 -- (-1009.720) [-1013.443] (-1009.195) (-1009.556) * [-1010.108] (-1009.817) (-1007.982) (-1008.439) -- 0:00:28
      552000 -- (-1010.428) (-1008.071) (-1008.587) [-1011.986] * (-1008.418) (-1007.128) [-1009.299] (-1010.838) -- 0:00:28
      552500 -- (-1013.628) [-1007.472] (-1008.788) (-1012.238) * (-1010.094) (-1012.202) (-1009.246) [-1008.967] -- 0:00:28
      553000 -- [-1008.481] (-1012.075) (-1011.848) (-1008.881) * (-1013.468) (-1007.493) [-1007.985] (-1008.260) -- 0:00:28
      553500 -- (-1007.392) [-1007.216] (-1015.828) (-1010.660) * (-1012.640) (-1007.303) (-1008.530) [-1007.162] -- 0:00:28
      554000 -- (-1009.450) (-1007.033) [-1009.545] (-1009.578) * (-1010.101) (-1010.843) (-1008.426) [-1007.566] -- 0:00:28
      554500 -- [-1007.242] (-1009.479) (-1010.294) (-1012.270) * [-1008.116] (-1010.108) (-1010.287) (-1008.017) -- 0:00:28
      555000 -- (-1007.978) (-1010.999) [-1009.405] (-1007.259) * (-1009.505) [-1007.799] (-1009.479) (-1010.594) -- 0:00:28

      Average standard deviation of split frequencies: 0.012718

      555500 -- (-1012.015) [-1009.834] (-1012.044) (-1008.983) * [-1007.334] (-1009.066) (-1009.677) (-1009.358) -- 0:00:28
      556000 -- (-1010.201) (-1007.133) (-1009.821) [-1007.164] * (-1010.368) (-1008.630) (-1008.486) [-1010.210] -- 0:00:27
      556500 -- [-1008.244] (-1009.513) (-1007.740) (-1007.820) * (-1009.514) (-1010.435) [-1010.736] (-1008.754) -- 0:00:27
      557000 -- (-1010.581) [-1009.771] (-1008.804) (-1008.337) * (-1010.943) (-1010.899) (-1007.729) [-1007.562] -- 0:00:27
      557500 -- (-1011.003) (-1009.644) [-1008.921] (-1008.810) * (-1010.656) (-1007.989) (-1007.400) [-1007.128] -- 0:00:27
      558000 -- (-1008.534) [-1007.919] (-1012.092) (-1008.810) * (-1011.933) (-1009.990) [-1009.083] (-1008.031) -- 0:00:27
      558500 -- (-1007.660) [-1008.555] (-1010.625) (-1008.939) * (-1010.122) (-1009.783) (-1009.763) [-1009.028] -- 0:00:27
      559000 -- [-1008.213] (-1008.263) (-1007.759) (-1007.773) * (-1007.450) (-1007.338) (-1008.848) [-1007.947] -- 0:00:27
      559500 -- (-1008.178) (-1008.601) (-1009.110) [-1008.231] * (-1007.884) [-1010.702] (-1011.994) (-1009.029) -- 0:00:27
      560000 -- (-1012.075) (-1009.619) [-1009.538] (-1010.814) * [-1007.782] (-1011.733) (-1008.759) (-1012.301) -- 0:00:27

      Average standard deviation of split frequencies: 0.013057

      560500 -- (-1009.576) [-1008.605] (-1009.924) (-1010.138) * [-1007.685] (-1013.168) (-1007.859) (-1013.887) -- 0:00:27
      561000 -- [-1007.025] (-1009.422) (-1007.857) (-1008.015) * (-1007.706) (-1009.315) [-1007.278] (-1009.534) -- 0:00:27
      561500 -- (-1010.028) (-1009.620) (-1007.950) [-1007.209] * (-1010.627) (-1009.814) [-1007.278] (-1007.215) -- 0:00:27
      562000 -- (-1010.579) (-1012.430) [-1009.246] (-1007.616) * (-1009.035) (-1009.919) (-1007.839) [-1009.714] -- 0:00:27
      562500 -- [-1008.638] (-1011.994) (-1008.493) (-1010.745) * (-1007.518) (-1009.214) (-1007.082) [-1007.882] -- 0:00:27
      563000 -- (-1008.358) (-1015.504) [-1006.951] (-1008.141) * (-1008.721) (-1008.015) [-1007.255] (-1011.210) -- 0:00:27
      563500 -- (-1010.323) (-1011.129) (-1009.977) [-1008.397] * (-1009.639) (-1010.954) [-1008.534] (-1011.073) -- 0:00:27
      564000 -- [-1010.005] (-1013.979) (-1010.720) (-1009.760) * [-1009.642] (-1010.252) (-1008.357) (-1011.005) -- 0:00:27
      564500 -- [-1007.461] (-1011.765) (-1009.469) (-1011.381) * (-1010.729) (-1011.604) (-1007.637) [-1008.573] -- 0:00:27
      565000 -- (-1008.727) (-1009.467) [-1007.119] (-1006.920) * (-1006.727) [-1008.727] (-1006.731) (-1008.650) -- 0:00:27

      Average standard deviation of split frequencies: 0.013032

      565500 -- (-1009.218) [-1007.317] (-1007.779) (-1008.278) * (-1009.283) (-1007.695) [-1009.962] (-1008.978) -- 0:00:27
      566000 -- [-1010.533] (-1007.255) (-1010.195) (-1009.279) * [-1008.967] (-1006.813) (-1007.372) (-1007.208) -- 0:00:27
      566500 -- (-1010.836) (-1011.977) (-1010.485) [-1009.318] * (-1009.274) (-1016.027) [-1007.098] (-1011.177) -- 0:00:27
      567000 -- [-1011.309] (-1018.306) (-1007.207) (-1009.139) * (-1007.702) [-1009.407] (-1008.299) (-1009.726) -- 0:00:27
      567500 -- (-1009.602) (-1008.854) [-1008.606] (-1010.865) * [-1007.226] (-1011.250) (-1012.448) (-1009.891) -- 0:00:27
      568000 -- (-1010.538) (-1006.960) [-1009.236] (-1008.647) * (-1007.399) [-1007.838] (-1011.280) (-1009.371) -- 0:00:27
      568500 -- (-1010.597) (-1006.819) [-1009.233] (-1009.388) * (-1008.502) [-1007.424] (-1008.484) (-1013.350) -- 0:00:27
      569000 -- (-1009.426) [-1006.792] (-1010.290) (-1009.412) * (-1007.319) (-1008.706) (-1010.288) [-1009.994] -- 0:00:27
      569500 -- (-1009.595) [-1006.647] (-1010.662) (-1008.944) * (-1008.392) (-1007.603) [-1006.703] (-1009.122) -- 0:00:27
      570000 -- [-1008.716] (-1006.939) (-1008.871) (-1010.865) * (-1010.195) (-1008.223) (-1009.172) [-1009.456] -- 0:00:27

      Average standard deviation of split frequencies: 0.013363

      570500 -- (-1009.772) (-1009.602) (-1009.599) [-1008.331] * (-1011.631) (-1009.849) (-1010.456) [-1008.687] -- 0:00:27
      571000 -- [-1014.925] (-1009.871) (-1008.684) (-1009.940) * (-1013.272) [-1010.277] (-1007.974) (-1010.217) -- 0:00:27
      571500 -- (-1012.458) (-1007.088) (-1008.566) [-1008.906] * (-1010.531) (-1007.583) (-1006.974) [-1007.868] -- 0:00:26
      572000 -- (-1008.530) [-1012.180] (-1009.329) (-1007.292) * [-1006.724] (-1008.592) (-1007.203) (-1007.616) -- 0:00:26
      572500 -- [-1012.102] (-1007.925) (-1007.702) (-1009.428) * (-1006.432) (-1009.278) (-1007.670) [-1007.906] -- 0:00:26
      573000 -- (-1012.853) [-1012.930] (-1007.184) (-1010.175) * (-1007.854) (-1006.726) (-1011.003) [-1008.543] -- 0:00:26
      573500 -- (-1009.284) (-1008.501) [-1012.772] (-1008.307) * (-1008.421) (-1008.513) (-1009.322) [-1010.133] -- 0:00:26
      574000 -- [-1007.834] (-1010.721) (-1009.930) (-1007.334) * (-1007.601) [-1010.757] (-1011.525) (-1008.719) -- 0:00:26
      574500 -- [-1009.233] (-1013.636) (-1007.973) (-1007.774) * [-1008.045] (-1009.105) (-1008.882) (-1007.596) -- 0:00:26
      575000 -- (-1008.932) (-1007.344) [-1007.874] (-1010.660) * (-1009.718) (-1014.332) [-1009.857] (-1006.964) -- 0:00:26

      Average standard deviation of split frequencies: 0.012902

      575500 -- (-1014.931) (-1007.480) [-1008.235] (-1009.782) * (-1006.948) [-1007.698] (-1009.794) (-1007.109) -- 0:00:26
      576000 -- (-1008.950) [-1010.772] (-1009.683) (-1008.563) * [-1006.995] (-1008.846) (-1010.057) (-1008.237) -- 0:00:26
      576500 -- [-1008.112] (-1008.078) (-1010.843) (-1007.837) * (-1006.546) (-1011.368) (-1009.064) [-1009.286] -- 0:00:26
      577000 -- (-1008.475) (-1011.915) (-1010.385) [-1009.707] * (-1008.426) (-1009.132) (-1012.562) [-1008.199] -- 0:00:26
      577500 -- [-1009.561] (-1009.301) (-1010.905) (-1009.229) * [-1009.319] (-1009.746) (-1008.713) (-1008.580) -- 0:00:26
      578000 -- [-1007.599] (-1007.538) (-1017.715) (-1011.856) * (-1007.323) (-1010.888) (-1012.161) [-1007.511] -- 0:00:26
      578500 -- (-1008.259) (-1008.057) [-1008.796] (-1009.312) * (-1007.111) (-1016.367) [-1008.495] (-1007.301) -- 0:00:26
      579000 -- (-1009.027) (-1010.616) (-1007.781) [-1007.863] * (-1008.663) (-1011.440) [-1006.572] (-1009.348) -- 0:00:26
      579500 -- (-1009.042) [-1008.493] (-1008.007) (-1006.934) * (-1008.446) (-1007.860) [-1007.652] (-1010.360) -- 0:00:26
      580000 -- (-1009.318) [-1008.363] (-1007.591) (-1009.930) * (-1008.122) [-1008.630] (-1008.525) (-1012.069) -- 0:00:26

      Average standard deviation of split frequencies: 0.012607

      580500 -- (-1010.613) (-1011.920) [-1007.274] (-1009.408) * [-1009.361] (-1010.079) (-1007.597) (-1007.962) -- 0:00:26
      581000 -- [-1013.467] (-1013.334) (-1007.646) (-1013.834) * [-1008.713] (-1006.882) (-1010.155) (-1011.957) -- 0:00:26
      581500 -- (-1010.081) [-1010.788] (-1008.042) (-1008.166) * (-1008.925) [-1007.940] (-1013.867) (-1013.999) -- 0:00:26
      582000 -- (-1007.073) (-1008.066) (-1007.280) [-1007.820] * (-1008.830) [-1008.897] (-1011.207) (-1014.507) -- 0:00:26
      582500 -- [-1009.931] (-1008.205) (-1009.445) (-1009.682) * (-1011.310) (-1008.732) (-1012.850) [-1008.828] -- 0:00:26
      583000 -- [-1008.199] (-1007.441) (-1011.912) (-1008.108) * [-1009.525] (-1008.776) (-1014.885) (-1010.034) -- 0:00:26
      583500 -- [-1009.942] (-1008.364) (-1012.059) (-1010.268) * (-1007.545) (-1013.601) [-1008.076] (-1013.900) -- 0:00:26
      584000 -- (-1009.218) [-1009.734] (-1011.790) (-1009.201) * (-1008.055) [-1012.061] (-1007.961) (-1010.416) -- 0:00:26
      584500 -- (-1012.155) [-1011.410] (-1011.350) (-1008.019) * (-1008.859) [-1013.416] (-1007.881) (-1010.350) -- 0:00:26
      585000 -- [-1010.107] (-1008.432) (-1007.825) (-1009.209) * [-1008.038] (-1014.508) (-1010.276) (-1007.380) -- 0:00:26

      Average standard deviation of split frequencies: 0.013202

      585500 -- (-1011.386) (-1009.316) (-1008.137) [-1009.862] * (-1010.112) (-1008.372) [-1009.700] (-1006.932) -- 0:00:26
      586000 -- (-1007.394) (-1007.964) [-1007.308] (-1007.665) * [-1007.037] (-1010.522) (-1009.536) (-1009.224) -- 0:00:26
      586500 -- (-1010.570) (-1009.260) [-1008.012] (-1009.397) * (-1008.206) (-1007.483) (-1011.498) [-1008.244] -- 0:00:26
      587000 -- (-1007.033) (-1012.997) [-1011.219] (-1012.655) * (-1007.377) (-1006.929) (-1008.067) [-1008.244] -- 0:00:26
      587500 -- [-1009.507] (-1008.287) (-1007.766) (-1011.967) * (-1008.954) (-1009.066) (-1008.664) [-1008.173] -- 0:00:25
      588000 -- (-1008.053) (-1009.795) [-1009.917] (-1007.298) * (-1011.746) (-1008.336) (-1007.773) [-1010.083] -- 0:00:25
      588500 -- [-1008.110] (-1007.796) (-1010.404) (-1007.282) * (-1007.811) [-1008.531] (-1012.050) (-1011.466) -- 0:00:25
      589000 -- (-1007.865) (-1010.553) [-1010.161] (-1008.236) * (-1008.479) (-1008.809) (-1008.334) [-1007.899] -- 0:00:25
      589500 -- (-1009.511) (-1008.054) [-1010.244] (-1009.117) * [-1009.653] (-1009.415) (-1009.106) (-1006.963) -- 0:00:25
      590000 -- [-1009.340] (-1007.642) (-1010.571) (-1010.002) * [-1006.571] (-1010.842) (-1010.803) (-1006.838) -- 0:00:25

      Average standard deviation of split frequencies: 0.013051

      590500 -- [-1011.482] (-1009.647) (-1010.491) (-1008.517) * [-1009.624] (-1008.410) (-1008.935) (-1007.200) -- 0:00:25
      591000 -- (-1009.227) [-1008.931] (-1007.815) (-1010.624) * (-1009.573) [-1007.856] (-1012.368) (-1009.828) -- 0:00:25
      591500 -- (-1009.489) (-1010.670) [-1007.433] (-1009.834) * (-1008.736) (-1007.877) [-1009.148] (-1007.371) -- 0:00:25
      592000 -- [-1006.906] (-1011.516) (-1013.639) (-1008.613) * (-1008.631) (-1009.854) [-1013.550] (-1013.089) -- 0:00:25
      592500 -- [-1008.159] (-1013.177) (-1007.680) (-1008.868) * (-1009.659) (-1013.391) [-1008.350] (-1017.825) -- 0:00:25
      593000 -- (-1009.306) (-1009.330) (-1007.632) [-1009.673] * (-1013.344) [-1008.787] (-1007.500) (-1012.439) -- 0:00:25
      593500 -- (-1007.039) (-1009.866) [-1007.388] (-1011.455) * (-1012.540) (-1010.679) (-1007.097) [-1007.968] -- 0:00:25
      594000 -- [-1007.968] (-1010.370) (-1007.910) (-1008.661) * (-1009.497) [-1007.593] (-1007.414) (-1010.992) -- 0:00:25
      594500 -- [-1008.060] (-1014.489) (-1008.093) (-1007.523) * (-1007.413) (-1009.909) (-1009.395) [-1007.450] -- 0:00:25
      595000 -- (-1007.952) [-1010.956] (-1008.409) (-1006.801) * (-1011.161) (-1007.199) [-1008.648] (-1009.476) -- 0:00:25

      Average standard deviation of split frequencies: 0.012655

      595500 -- (-1008.569) (-1008.726) (-1008.081) [-1007.059] * [-1007.648] (-1007.226) (-1010.796) (-1009.484) -- 0:00:25
      596000 -- (-1009.165) [-1008.717] (-1008.600) (-1011.330) * [-1008.812] (-1008.841) (-1007.920) (-1008.104) -- 0:00:25
      596500 -- [-1009.608] (-1009.442) (-1008.377) (-1009.090) * [-1009.356] (-1008.998) (-1008.005) (-1007.749) -- 0:00:25
      597000 -- [-1008.192] (-1010.588) (-1008.999) (-1009.782) * (-1008.869) [-1009.244] (-1008.198) (-1007.250) -- 0:00:25
      597500 -- (-1008.189) (-1014.739) (-1009.238) [-1009.546] * (-1012.139) (-1008.709) [-1008.247] (-1011.181) -- 0:00:25
      598000 -- (-1008.786) (-1013.925) (-1008.036) [-1010.034] * (-1009.174) (-1007.135) (-1007.798) [-1007.378] -- 0:00:25
      598500 -- [-1008.103] (-1007.038) (-1009.370) (-1009.889) * (-1010.974) (-1006.906) (-1009.963) [-1009.808] -- 0:00:25
      599000 -- (-1009.894) [-1008.554] (-1007.722) (-1010.452) * (-1008.558) (-1007.576) (-1010.266) [-1011.206] -- 0:00:25
      599500 -- (-1009.384) [-1007.058] (-1008.270) (-1010.758) * (-1008.794) (-1009.113) (-1008.197) [-1009.165] -- 0:00:25
      600000 -- [-1009.908] (-1007.313) (-1007.749) (-1010.093) * [-1012.573] (-1007.936) (-1017.135) (-1011.537) -- 0:00:25

      Average standard deviation of split frequencies: 0.012095

      600500 -- (-1007.703) (-1012.763) [-1008.672] (-1012.207) * (-1013.713) (-1008.301) (-1010.562) [-1009.461] -- 0:00:25
      601000 -- (-1010.620) (-1017.609) (-1010.250) [-1009.671] * (-1009.237) (-1007.058) [-1008.013] (-1009.462) -- 0:00:25
      601500 -- (-1008.091) [-1007.885] (-1009.185) (-1008.049) * [-1007.740] (-1008.700) (-1007.979) (-1007.100) -- 0:00:25
      602000 -- (-1007.540) [-1008.085] (-1011.097) (-1008.519) * (-1011.871) [-1008.828] (-1007.498) (-1008.237) -- 0:00:25
      602500 -- [-1011.596] (-1010.180) (-1009.952) (-1007.593) * (-1009.162) (-1009.721) (-1008.097) [-1006.718] -- 0:00:25
      603000 -- (-1011.545) (-1012.792) [-1014.179] (-1006.813) * [-1008.164] (-1008.629) (-1007.436) (-1010.076) -- 0:00:25
      603500 -- (-1009.121) (-1012.890) [-1008.557] (-1008.137) * (-1009.497) [-1008.975] (-1008.283) (-1009.618) -- 0:00:24
      604000 -- (-1007.637) [-1010.138] (-1009.335) (-1015.389) * (-1008.471) [-1006.655] (-1008.922) (-1010.109) -- 0:00:24
      604500 -- (-1011.235) (-1012.869) (-1010.907) [-1007.825] * (-1012.519) (-1007.708) (-1009.253) [-1013.718] -- 0:00:24
      605000 -- (-1008.943) [-1013.718] (-1011.155) (-1009.503) * (-1009.204) [-1009.327] (-1007.433) (-1009.662) -- 0:00:24

      Average standard deviation of split frequencies: 0.011814

      605500 -- (-1009.454) [-1009.345] (-1009.047) (-1008.527) * [-1008.556] (-1008.212) (-1009.042) (-1011.022) -- 0:00:24
      606000 -- (-1008.018) [-1009.145] (-1009.359) (-1007.090) * [-1009.290] (-1009.886) (-1007.863) (-1009.805) -- 0:00:24
      606500 -- [-1008.653] (-1007.204) (-1011.104) (-1009.426) * (-1007.521) (-1010.494) (-1009.625) [-1010.675] -- 0:00:24
      607000 -- (-1007.874) (-1009.607) (-1011.473) [-1011.784] * [-1007.549] (-1007.703) (-1013.596) (-1007.811) -- 0:00:24
      607500 -- [-1010.435] (-1008.583) (-1010.013) (-1010.353) * [-1012.498] (-1010.035) (-1008.045) (-1008.030) -- 0:00:24
      608000 -- [-1007.346] (-1007.253) (-1008.198) (-1006.963) * (-1009.609) (-1008.866) [-1010.631] (-1011.882) -- 0:00:24
      608500 -- (-1007.557) (-1007.210) [-1010.070] (-1008.144) * [-1008.239] (-1008.339) (-1010.050) (-1011.521) -- 0:00:24
      609000 -- [-1009.356] (-1008.817) (-1007.891) (-1007.029) * (-1009.684) (-1008.870) (-1011.828) [-1010.023] -- 0:00:24
      609500 -- (-1011.748) (-1007.141) (-1010.652) [-1007.886] * (-1009.227) (-1007.459) (-1007.963) [-1010.921] -- 0:00:24
      610000 -- (-1008.321) (-1009.306) [-1007.434] (-1008.831) * (-1008.093) [-1007.437] (-1008.631) (-1011.602) -- 0:00:24

      Average standard deviation of split frequencies: 0.011097

      610500 -- (-1009.224) [-1008.328] (-1009.063) (-1012.992) * (-1009.095) (-1008.346) (-1014.560) [-1009.110] -- 0:00:24
      611000 -- (-1011.150) (-1009.517) [-1007.343] (-1009.354) * (-1008.018) (-1009.235) (-1010.325) [-1006.732] -- 0:00:24
      611500 -- (-1009.200) (-1007.519) (-1008.155) [-1006.505] * (-1010.502) [-1008.181] (-1007.679) (-1010.399) -- 0:00:24
      612000 -- (-1007.314) (-1011.310) [-1008.229] (-1008.788) * (-1007.113) (-1009.592) (-1010.924) [-1010.468] -- 0:00:24
      612500 -- (-1007.542) (-1008.670) [-1009.104] (-1008.794) * (-1008.027) (-1007.918) (-1009.042) [-1010.014] -- 0:00:24
      613000 -- [-1007.250] (-1007.510) (-1009.834) (-1010.982) * (-1007.216) (-1007.190) [-1007.927] (-1007.469) -- 0:00:24
      613500 -- (-1007.250) (-1009.491) (-1009.191) [-1011.405] * [-1009.104] (-1007.880) (-1009.098) (-1007.530) -- 0:00:24
      614000 -- (-1010.038) (-1007.333) [-1008.681] (-1008.671) * (-1008.178) (-1013.105) (-1010.547) [-1008.735] -- 0:00:24
      614500 -- (-1009.045) (-1008.028) [-1008.093] (-1010.689) * [-1008.690] (-1009.409) (-1009.812) (-1009.593) -- 0:00:24
      615000 -- [-1009.658] (-1007.801) (-1007.370) (-1010.449) * (-1009.614) (-1007.855) [-1008.996] (-1013.247) -- 0:00:24

      Average standard deviation of split frequencies: 0.011670

      615500 -- (-1009.686) (-1007.984) [-1007.450] (-1011.529) * (-1007.406) [-1009.005] (-1013.958) (-1008.586) -- 0:00:24
      616000 -- (-1009.365) [-1007.266] (-1006.994) (-1013.015) * (-1008.663) [-1007.890] (-1017.899) (-1009.009) -- 0:00:24
      616500 -- [-1007.623] (-1008.580) (-1007.784) (-1007.080) * [-1007.254] (-1011.314) (-1007.048) (-1007.457) -- 0:00:24
      617000 -- (-1011.769) (-1007.735) (-1009.854) [-1008.034] * (-1006.965) (-1011.540) [-1007.158] (-1013.414) -- 0:00:24
      617500 -- (-1008.634) (-1010.891) [-1013.737] (-1007.985) * (-1007.274) (-1007.247) [-1006.854] (-1013.839) -- 0:00:24
      618000 -- (-1008.329) [-1009.180] (-1008.053) (-1011.119) * [-1008.405] (-1010.867) (-1011.459) (-1009.550) -- 0:00:24
      618500 -- (-1008.330) (-1007.523) [-1008.310] (-1011.834) * (-1008.181) (-1013.576) [-1009.156] (-1007.297) -- 0:00:24
      619000 -- (-1006.971) [-1007.378] (-1008.697) (-1012.606) * (-1008.902) (-1012.663) (-1009.008) [-1006.940] -- 0:00:24
      619500 -- (-1015.612) [-1008.524] (-1007.248) (-1011.601) * [-1007.458] (-1010.769) (-1012.267) (-1010.500) -- 0:00:23
      620000 -- (-1016.496) (-1009.320) (-1010.454) [-1008.125] * (-1007.478) (-1009.807) [-1008.640] (-1008.551) -- 0:00:23

      Average standard deviation of split frequencies: 0.012342

      620500 -- [-1010.733] (-1011.171) (-1008.755) (-1007.841) * (-1008.763) (-1012.148) [-1008.321] (-1011.849) -- 0:00:23
      621000 -- (-1008.636) [-1007.920] (-1009.153) (-1010.044) * (-1008.288) (-1010.111) (-1008.819) [-1010.740] -- 0:00:23
      621500 -- (-1008.972) (-1014.074) [-1009.214] (-1008.782) * [-1010.385] (-1009.016) (-1009.999) (-1009.466) -- 0:00:23
      622000 -- (-1008.345) (-1009.361) [-1008.486] (-1008.685) * [-1009.222] (-1013.241) (-1008.825) (-1007.640) -- 0:00:23
      622500 -- (-1010.628) (-1008.125) [-1008.864] (-1008.400) * [-1008.525] (-1007.813) (-1008.466) (-1007.720) -- 0:00:23
      623000 -- [-1012.156] (-1009.902) (-1008.860) (-1008.852) * [-1009.236] (-1012.587) (-1007.344) (-1011.628) -- 0:00:23
      623500 -- (-1011.290) (-1008.403) (-1007.306) [-1008.333] * (-1011.268) [-1007.692] (-1012.435) (-1011.022) -- 0:00:23
      624000 -- (-1009.092) (-1007.866) (-1008.974) [-1007.401] * (-1010.624) [-1011.663] (-1015.058) (-1008.180) -- 0:00:23
      624500 -- (-1007.604) (-1008.934) (-1007.754) [-1008.659] * (-1009.997) [-1008.360] (-1011.341) (-1007.069) -- 0:00:23
      625000 -- (-1009.685) (-1008.652) (-1009.414) [-1008.424] * (-1007.167) [-1006.827] (-1009.736) (-1006.866) -- 0:00:23

      Average standard deviation of split frequencies: 0.012190

      625500 -- [-1011.352] (-1008.455) (-1008.155) (-1008.368) * (-1010.126) (-1007.311) (-1011.321) [-1009.144] -- 0:00:23
      626000 -- (-1011.117) [-1010.002] (-1008.276) (-1009.048) * (-1011.763) (-1010.589) (-1007.106) [-1006.738] -- 0:00:23
      626500 -- (-1010.380) (-1012.054) (-1011.560) [-1008.588] * (-1015.456) (-1010.711) [-1009.041] (-1009.827) -- 0:00:23
      627000 -- (-1009.543) (-1008.583) [-1009.390] (-1012.327) * (-1008.033) [-1007.686] (-1007.794) (-1008.280) -- 0:00:23
      627500 -- (-1010.304) (-1010.535) [-1009.136] (-1009.050) * [-1007.839] (-1007.933) (-1007.340) (-1008.795) -- 0:00:23
      628000 -- [-1006.982] (-1008.344) (-1007.527) (-1015.229) * (-1007.818) (-1010.498) (-1010.149) [-1008.899] -- 0:00:23
      628500 -- (-1007.418) (-1008.672) [-1007.133] (-1008.642) * (-1008.783) (-1010.569) [-1008.211] (-1009.939) -- 0:00:23
      629000 -- (-1008.560) [-1008.634] (-1008.526) (-1008.703) * (-1007.590) [-1006.594] (-1007.108) (-1008.414) -- 0:00:23
      629500 -- (-1008.463) (-1007.861) [-1009.353] (-1006.891) * [-1008.893] (-1008.711) (-1008.627) (-1015.492) -- 0:00:23
      630000 -- (-1007.187) (-1007.109) [-1008.969] (-1011.305) * (-1016.022) (-1007.133) (-1007.870) [-1010.356] -- 0:00:23

      Average standard deviation of split frequencies: 0.011586

      630500 -- [-1010.577] (-1007.265) (-1007.905) (-1008.794) * (-1008.820) [-1007.062] (-1014.945) (-1009.879) -- 0:00:23
      631000 -- (-1011.236) (-1014.685) (-1008.289) [-1009.396] * (-1006.910) [-1009.880] (-1016.668) (-1013.304) -- 0:00:23
      631500 -- (-1009.652) (-1015.408) (-1008.211) [-1009.644] * (-1008.654) (-1012.282) (-1011.140) [-1009.529] -- 0:00:23
      632000 -- (-1010.212) (-1013.299) (-1009.555) [-1007.728] * (-1007.451) [-1008.411] (-1023.316) (-1009.498) -- 0:00:23
      632500 -- (-1012.068) [-1008.568] (-1009.350) (-1008.348) * (-1007.404) [-1011.487] (-1019.081) (-1012.521) -- 0:00:23
      633000 -- (-1008.499) (-1012.824) (-1010.187) [-1009.046] * [-1007.697] (-1009.489) (-1010.198) (-1011.275) -- 0:00:23
      633500 -- (-1010.745) (-1009.192) [-1010.117] (-1007.834) * [-1007.381] (-1009.671) (-1010.980) (-1009.664) -- 0:00:23
      634000 -- [-1011.112] (-1009.866) (-1012.128) (-1007.735) * (-1006.727) (-1008.300) (-1009.077) [-1008.578] -- 0:00:23
      634500 -- (-1009.316) (-1006.538) (-1007.943) [-1006.767] * (-1008.078) (-1008.137) [-1007.094] (-1008.229) -- 0:00:23
      635000 -- (-1007.671) [-1009.590] (-1007.163) (-1009.260) * (-1009.953) (-1008.508) (-1006.938) [-1007.196] -- 0:00:22

      Average standard deviation of split frequencies: 0.011813

      635500 -- (-1007.639) (-1009.583) [-1009.523] (-1007.707) * (-1010.324) (-1011.409) (-1007.163) [-1006.790] -- 0:00:22
      636000 -- (-1010.579) [-1011.331] (-1008.470) (-1007.569) * (-1010.659) (-1009.743) [-1007.410] (-1007.466) -- 0:00:22
      636500 -- [-1012.081] (-1008.807) (-1006.632) (-1008.464) * (-1007.111) (-1010.130) [-1009.259] (-1006.879) -- 0:00:22
      637000 -- (-1013.237) (-1011.712) (-1007.905) [-1007.851] * (-1008.907) (-1009.130) (-1007.766) [-1007.191] -- 0:00:22
      637500 -- (-1007.557) (-1015.281) [-1007.979] (-1007.878) * (-1008.874) (-1008.845) [-1007.835] (-1010.300) -- 0:00:22
      638000 -- (-1007.884) (-1012.479) [-1009.537] (-1015.418) * (-1007.810) [-1007.474] (-1011.364) (-1009.303) -- 0:00:22
      638500 -- (-1006.916) [-1008.092] (-1009.569) (-1009.144) * (-1008.038) [-1008.880] (-1011.876) (-1009.939) -- 0:00:22
      639000 -- (-1007.496) (-1010.825) (-1007.664) [-1008.820] * [-1007.499] (-1008.388) (-1009.128) (-1010.963) -- 0:00:22
      639500 -- [-1006.708] (-1009.312) (-1008.396) (-1012.022) * [-1007.994] (-1008.217) (-1007.660) (-1008.056) -- 0:00:22
      640000 -- (-1008.501) [-1006.573] (-1007.721) (-1010.995) * [-1007.113] (-1011.822) (-1011.421) (-1007.182) -- 0:00:22

      Average standard deviation of split frequencies: 0.011819

      640500 -- (-1013.567) [-1008.419] (-1008.229) (-1011.246) * (-1009.070) (-1007.043) (-1008.342) [-1006.903] -- 0:00:22
      641000 -- [-1010.293] (-1011.375) (-1007.041) (-1009.640) * (-1010.261) (-1007.193) [-1011.635] (-1007.161) -- 0:00:22
      641500 -- (-1014.466) [-1012.943] (-1013.148) (-1009.122) * (-1009.776) (-1008.785) [-1009.759] (-1007.028) -- 0:00:22
      642000 -- (-1010.358) (-1007.472) [-1009.264] (-1007.941) * [-1009.606] (-1007.843) (-1009.128) (-1008.360) -- 0:00:22
      642500 -- (-1008.934) (-1011.035) (-1010.747) [-1008.474] * (-1008.309) (-1007.477) [-1010.162] (-1009.900) -- 0:00:22
      643000 -- [-1008.908] (-1009.687) (-1008.186) (-1012.651) * (-1009.873) (-1011.810) (-1011.488) [-1010.142] -- 0:00:22
      643500 -- (-1009.208) [-1009.947] (-1009.227) (-1011.535) * (-1012.093) (-1010.122) [-1007.530] (-1009.468) -- 0:00:22
      644000 -- (-1007.319) (-1010.326) (-1008.459) [-1008.470] * [-1010.595] (-1007.714) (-1008.649) (-1010.461) -- 0:00:22
      644500 -- [-1007.700] (-1011.483) (-1009.048) (-1008.337) * (-1011.982) (-1012.759) (-1009.694) [-1010.824] -- 0:00:22
      645000 -- (-1008.067) (-1008.152) [-1008.570] (-1008.121) * (-1007.048) [-1008.493] (-1009.019) (-1008.357) -- 0:00:22

      Average standard deviation of split frequencies: 0.011539

      645500 -- [-1007.744] (-1007.807) (-1009.693) (-1009.337) * (-1007.378) [-1007.639] (-1007.333) (-1007.255) -- 0:00:22
      646000 -- [-1008.322] (-1007.903) (-1010.037) (-1007.884) * (-1008.861) (-1007.932) [-1011.773] (-1017.618) -- 0:00:22
      646500 -- (-1013.083) [-1007.438] (-1013.063) (-1008.565) * (-1009.369) (-1008.109) [-1011.157] (-1008.897) -- 0:00:22
      647000 -- (-1009.488) (-1007.834) (-1011.451) [-1006.855] * (-1008.297) [-1009.483] (-1009.936) (-1008.744) -- 0:00:22
      647500 -- (-1007.030) (-1009.755) [-1009.453] (-1011.968) * (-1007.917) [-1008.962] (-1011.360) (-1007.865) -- 0:00:22
      648000 -- (-1008.535) [-1010.557] (-1007.164) (-1008.786) * [-1007.095] (-1007.765) (-1009.744) (-1008.550) -- 0:00:22
      648500 -- (-1010.289) (-1007.201) (-1008.666) [-1010.599] * (-1008.564) (-1007.444) (-1010.246) [-1007.510] -- 0:00:22
      649000 -- (-1008.257) [-1007.176] (-1008.768) (-1010.911) * (-1007.584) (-1009.641) (-1010.070) [-1007.346] -- 0:00:22
      649500 -- (-1008.832) (-1011.031) [-1008.380] (-1010.929) * (-1007.529) (-1009.362) [-1008.246] (-1006.808) -- 0:00:22
      650000 -- (-1010.384) (-1009.409) [-1008.481] (-1009.119) * [-1009.307] (-1011.393) (-1007.899) (-1010.267) -- 0:00:22

      Average standard deviation of split frequencies: 0.011637

      650500 -- [-1006.923] (-1009.818) (-1008.879) (-1008.155) * (-1007.842) [-1010.481] (-1009.181) (-1008.836) -- 0:00:22
      651000 -- (-1008.353) (-1008.639) (-1013.021) [-1008.033] * [-1009.309] (-1009.755) (-1009.317) (-1013.549) -- 0:00:21
      651500 -- (-1007.843) (-1007.288) [-1009.409] (-1015.457) * [-1008.353] (-1010.166) (-1010.698) (-1009.090) -- 0:00:21
      652000 -- (-1007.995) (-1006.850) [-1008.423] (-1009.209) * [-1007.938] (-1007.348) (-1013.642) (-1008.152) -- 0:00:21
      652500 -- (-1009.971) (-1010.235) (-1008.390) [-1008.251] * (-1014.223) [-1007.911] (-1022.182) (-1006.949) -- 0:00:21
      653000 -- (-1006.765) (-1008.950) (-1008.152) [-1010.157] * (-1011.328) (-1008.200) [-1008.303] (-1011.828) -- 0:00:21
      653500 -- (-1010.637) [-1011.317] (-1006.856) (-1006.639) * (-1008.354) (-1008.186) [-1007.843] (-1009.713) -- 0:00:21
      654000 -- (-1007.681) (-1009.464) [-1007.893] (-1006.763) * (-1009.070) (-1008.490) (-1009.248) [-1007.454] -- 0:00:21
      654500 -- (-1007.125) (-1007.442) (-1008.319) [-1010.118] * [-1008.832] (-1007.080) (-1010.489) (-1011.947) -- 0:00:21
      655000 -- (-1008.733) [-1007.000] (-1008.225) (-1008.265) * [-1006.592] (-1007.526) (-1009.288) (-1007.428) -- 0:00:21

      Average standard deviation of split frequencies: 0.011228

      655500 -- (-1007.350) [-1008.982] (-1007.255) (-1011.286) * (-1008.621) (-1009.558) (-1009.425) [-1009.652] -- 0:00:21
      656000 -- (-1009.401) (-1009.915) [-1007.439] (-1010.521) * (-1009.244) (-1008.992) [-1010.814] (-1009.202) -- 0:00:21
      656500 -- (-1009.728) [-1009.489] (-1007.994) (-1009.121) * [-1008.060] (-1006.835) (-1012.279) (-1009.096) -- 0:00:21
      657000 -- [-1008.484] (-1011.749) (-1008.512) (-1009.917) * [-1008.155] (-1008.620) (-1010.232) (-1009.580) -- 0:00:21
      657500 -- [-1008.203] (-1009.826) (-1010.216) (-1009.942) * [-1015.365] (-1008.446) (-1008.233) (-1009.409) -- 0:00:21
      658000 -- (-1006.788) (-1011.456) [-1013.615] (-1008.069) * (-1010.057) [-1010.355] (-1008.027) (-1007.900) -- 0:00:21
      658500 -- (-1009.109) [-1007.972] (-1010.080) (-1013.205) * (-1011.559) (-1012.177) (-1008.641) [-1007.776] -- 0:00:21
      659000 -- (-1007.885) (-1008.029) (-1012.826) [-1009.150] * [-1010.602] (-1010.171) (-1016.122) (-1008.433) -- 0:00:21
      659500 -- (-1007.500) [-1007.572] (-1008.728) (-1010.522) * [-1008.564] (-1009.205) (-1006.983) (-1011.626) -- 0:00:21
      660000 -- (-1009.926) (-1009.329) [-1009.728] (-1009.646) * [-1007.662] (-1007.966) (-1007.308) (-1009.159) -- 0:00:21

      Average standard deviation of split frequencies: 0.010792

      660500 -- (-1010.785) [-1007.505] (-1007.679) (-1008.232) * [-1007.628] (-1006.990) (-1009.456) (-1007.333) -- 0:00:21
      661000 -- (-1008.068) (-1007.403) [-1013.794] (-1007.856) * (-1010.402) (-1007.019) [-1008.736] (-1007.116) -- 0:00:21
      661500 -- [-1007.764] (-1012.475) (-1009.155) (-1007.085) * (-1012.338) (-1007.976) [-1008.387] (-1008.476) -- 0:00:21
      662000 -- [-1006.959] (-1011.773) (-1007.941) (-1007.830) * (-1013.682) (-1007.025) [-1011.820] (-1009.574) -- 0:00:21
      662500 -- (-1007.022) (-1008.768) [-1008.357] (-1006.768) * (-1009.505) (-1007.552) [-1009.842] (-1007.251) -- 0:00:21
      663000 -- [-1009.521] (-1007.548) (-1012.255) (-1007.910) * (-1008.844) (-1009.854) [-1009.655] (-1009.015) -- 0:00:21
      663500 -- [-1008.919] (-1008.120) (-1009.694) (-1007.660) * (-1007.908) [-1013.738] (-1008.031) (-1008.260) -- 0:00:21
      664000 -- [-1008.963] (-1010.657) (-1013.777) (-1007.699) * (-1015.737) [-1009.497] (-1009.902) (-1011.036) -- 0:00:21
      664500 -- (-1011.339) (-1012.518) (-1012.773) [-1007.495] * (-1007.964) [-1011.722] (-1011.733) (-1010.192) -- 0:00:21
      665000 -- (-1007.434) (-1011.549) (-1008.367) [-1009.679] * (-1010.564) (-1010.829) (-1011.886) [-1009.055] -- 0:00:21

      Average standard deviation of split frequencies: 0.010883

      665500 -- (-1008.411) (-1009.981) [-1008.397] (-1008.277) * (-1008.656) (-1008.687) [-1006.999] (-1009.274) -- 0:00:21
      666000 -- (-1007.613) (-1007.175) (-1009.702) [-1008.790] * [-1007.872] (-1007.412) (-1008.869) (-1008.747) -- 0:00:21
      666500 -- (-1007.939) [-1007.607] (-1009.842) (-1008.808) * (-1011.851) (-1006.886) [-1009.769] (-1008.509) -- 0:00:21
      667000 -- (-1009.937) [-1011.416] (-1007.095) (-1013.430) * (-1007.863) (-1007.525) [-1009.299] (-1010.097) -- 0:00:20
      667500 -- [-1009.599] (-1008.602) (-1007.794) (-1008.033) * (-1008.363) [-1006.566] (-1008.743) (-1011.706) -- 0:00:20
      668000 -- (-1008.797) (-1007.661) (-1008.731) [-1008.688] * (-1007.121) [-1006.809] (-1009.604) (-1010.344) -- 0:00:20
      668500 -- (-1008.612) (-1007.529) [-1011.344] (-1008.551) * (-1007.130) [-1007.232] (-1008.897) (-1008.468) -- 0:00:20
      669000 -- (-1009.997) (-1011.247) (-1008.945) [-1007.362] * (-1008.672) [-1007.750] (-1008.171) (-1009.960) -- 0:00:20
      669500 -- (-1008.105) (-1007.036) (-1010.564) [-1008.813] * (-1008.957) (-1010.590) (-1007.216) [-1007.632] -- 0:00:20
      670000 -- [-1008.362] (-1009.123) (-1009.877) (-1009.662) * (-1007.192) (-1010.239) (-1008.478) [-1008.266] -- 0:00:20

      Average standard deviation of split frequencies: 0.011290

      670500 -- [-1008.886] (-1011.180) (-1007.955) (-1010.587) * (-1007.605) (-1013.358) (-1007.893) [-1010.868] -- 0:00:20
      671000 -- (-1009.939) [-1009.978] (-1009.373) (-1008.626) * (-1007.539) [-1008.778] (-1007.579) (-1007.974) -- 0:00:20
      671500 -- (-1012.166) [-1008.782] (-1008.810) (-1008.158) * (-1009.527) (-1010.228) [-1007.893] (-1011.508) -- 0:00:20
      672000 -- [-1006.848] (-1008.644) (-1011.263) (-1007.395) * [-1009.108] (-1009.481) (-1010.687) (-1008.807) -- 0:00:20
      672500 -- (-1008.129) [-1008.757] (-1010.111) (-1007.368) * (-1010.441) (-1009.050) (-1010.225) [-1007.771] -- 0:00:20
      673000 -- [-1008.298] (-1007.230) (-1008.375) (-1009.745) * (-1010.650) (-1007.874) [-1008.125] (-1012.894) -- 0:00:20
      673500 -- [-1014.701] (-1009.157) (-1011.686) (-1011.428) * (-1008.932) (-1008.059) (-1008.138) [-1007.468] -- 0:00:20
      674000 -- [-1011.951] (-1007.859) (-1008.992) (-1010.449) * [-1007.738] (-1007.865) (-1012.997) (-1013.034) -- 0:00:20
      674500 -- (-1011.096) (-1010.719) (-1007.226) [-1007.558] * (-1006.739) (-1006.849) [-1014.172] (-1020.280) -- 0:00:20
      675000 -- (-1008.944) (-1008.577) [-1009.207] (-1009.977) * [-1009.500] (-1010.192) (-1009.205) (-1006.981) -- 0:00:20

      Average standard deviation of split frequencies: 0.011375

      675500 -- (-1008.387) (-1012.082) (-1009.099) [-1008.901] * [-1008.368] (-1009.081) (-1016.959) (-1012.579) -- 0:00:20
      676000 -- (-1011.892) [-1008.155] (-1008.309) (-1008.685) * (-1009.572) (-1010.533) [-1008.856] (-1008.606) -- 0:00:20
      676500 -- (-1011.149) (-1007.429) (-1008.766) [-1012.775] * (-1011.164) [-1008.285] (-1007.729) (-1011.660) -- 0:00:20
      677000 -- (-1009.923) [-1008.832] (-1008.672) (-1010.196) * [-1012.029] (-1008.320) (-1008.326) (-1011.922) -- 0:00:20
      677500 -- [-1008.100] (-1007.526) (-1008.350) (-1010.512) * (-1011.240) (-1009.464) (-1007.937) [-1006.875] -- 0:00:20
      678000 -- [-1009.451] (-1008.422) (-1009.819) (-1010.220) * (-1008.316) (-1006.963) [-1008.527] (-1010.353) -- 0:00:20
      678500 -- (-1017.416) [-1012.244] (-1009.572) (-1007.567) * [-1010.093] (-1007.204) (-1008.674) (-1007.912) -- 0:00:20
      679000 -- (-1010.806) [-1009.421] (-1010.619) (-1010.349) * (-1013.435) [-1014.454] (-1007.753) (-1009.648) -- 0:00:20
      679500 -- (-1011.416) (-1011.071) [-1011.259] (-1013.458) * (-1010.686) (-1014.843) (-1008.145) [-1011.870] -- 0:00:20
      680000 -- (-1011.194) [-1008.601] (-1012.307) (-1010.669) * (-1008.894) [-1009.416] (-1009.551) (-1010.747) -- 0:00:20

      Average standard deviation of split frequencies: 0.011644

      680500 -- (-1012.082) (-1009.339) [-1011.027] (-1011.079) * (-1008.316) (-1010.441) [-1007.763] (-1008.977) -- 0:00:20
      681000 -- (-1011.150) [-1008.746] (-1011.056) (-1010.783) * (-1008.185) (-1006.766) (-1007.594) [-1008.426] -- 0:00:20
      681500 -- (-1008.360) (-1009.110) [-1010.063] (-1008.767) * (-1006.962) (-1013.219) [-1010.474] (-1008.174) -- 0:00:20
      682000 -- [-1007.775] (-1014.027) (-1009.505) (-1007.704) * (-1006.690) (-1009.156) [-1012.400] (-1014.033) -- 0:00:20
      682500 -- [-1007.814] (-1010.264) (-1014.687) (-1008.390) * (-1007.349) (-1009.136) (-1008.205) [-1008.774] -- 0:00:20
      683000 -- (-1008.089) (-1010.201) (-1006.919) [-1006.847] * (-1009.950) (-1007.028) [-1007.800] (-1009.900) -- 0:00:19
      683500 -- (-1007.150) (-1008.496) [-1007.313] (-1007.302) * [-1007.647] (-1012.415) (-1007.135) (-1009.459) -- 0:00:19
      684000 -- [-1009.160] (-1009.109) (-1009.281) (-1009.704) * (-1009.290) (-1007.982) (-1007.219) [-1007.989] -- 0:00:19
      684500 -- (-1008.615) (-1008.393) [-1008.836] (-1008.776) * (-1010.356) (-1008.268) (-1007.881) [-1009.094] -- 0:00:19
      685000 -- (-1009.068) [-1010.586] (-1007.817) (-1009.884) * (-1008.059) (-1014.045) (-1009.567) [-1007.825] -- 0:00:19

      Average standard deviation of split frequencies: 0.011424

      685500 -- [-1007.365] (-1008.444) (-1008.602) (-1009.916) * (-1006.901) [-1014.253] (-1009.243) (-1008.716) -- 0:00:19
      686000 -- (-1007.463) (-1007.442) [-1010.229] (-1007.642) * (-1011.520) (-1013.465) [-1013.124] (-1008.759) -- 0:00:19
      686500 -- (-1008.255) (-1007.642) (-1010.465) [-1008.213] * [-1010.766] (-1008.305) (-1013.394) (-1007.882) -- 0:00:19
      687000 -- (-1012.858) (-1008.241) [-1006.654] (-1014.214) * (-1012.370) (-1010.873) (-1011.762) [-1008.455] -- 0:00:19
      687500 -- (-1007.697) (-1009.044) [-1007.330] (-1008.207) * [-1011.842] (-1008.002) (-1009.714) (-1009.667) -- 0:00:19
      688000 -- (-1008.282) (-1010.542) [-1007.567] (-1008.917) * (-1007.752) [-1007.704] (-1012.658) (-1012.020) -- 0:00:19
      688500 -- (-1007.770) (-1012.249) [-1007.692] (-1011.938) * [-1008.051] (-1015.095) (-1009.735) (-1007.417) -- 0:00:19
      689000 -- (-1008.924) (-1008.636) (-1009.934) [-1012.544] * (-1007.093) (-1012.077) [-1008.309] (-1007.506) -- 0:00:19
      689500 -- (-1008.048) (-1007.703) (-1011.272) [-1008.323] * [-1010.880] (-1010.868) (-1008.416) (-1007.607) -- 0:00:19
      690000 -- (-1008.259) (-1007.703) (-1014.246) [-1008.428] * (-1011.749) [-1012.478] (-1007.870) (-1010.925) -- 0:00:19

      Average standard deviation of split frequencies: 0.011688

      690500 -- (-1008.344) [-1008.414] (-1012.765) (-1012.009) * (-1014.613) [-1009.627] (-1007.567) (-1010.188) -- 0:00:19
      691000 -- (-1008.509) (-1007.235) (-1010.629) [-1007.731] * (-1009.674) (-1006.827) [-1012.332] (-1012.284) -- 0:00:19
      691500 -- (-1012.523) (-1007.868) (-1007.783) [-1007.373] * (-1012.608) (-1008.081) [-1007.503] (-1007.859) -- 0:00:19
      692000 -- (-1009.248) [-1007.669] (-1009.558) (-1007.629) * (-1007.469) [-1008.622] (-1010.572) (-1012.954) -- 0:00:19
      692500 -- [-1008.157] (-1011.241) (-1007.607) (-1007.715) * (-1008.333) (-1010.162) [-1007.106] (-1009.532) -- 0:00:19
      693000 -- (-1008.136) (-1006.621) (-1009.577) [-1007.676] * (-1006.894) (-1007.976) (-1009.393) [-1009.373] -- 0:00:19
      693500 -- [-1008.148] (-1009.251) (-1007.119) (-1007.360) * (-1006.856) [-1008.064] (-1009.015) (-1010.329) -- 0:00:19
      694000 -- [-1008.206] (-1008.033) (-1007.490) (-1010.715) * (-1007.664) [-1010.384] (-1008.337) (-1007.825) -- 0:00:19
      694500 -- (-1008.194) (-1014.375) (-1009.242) [-1007.526] * (-1007.478) (-1011.245) (-1010.153) [-1007.011] -- 0:00:19
      695000 -- (-1008.137) (-1015.454) [-1011.262] (-1006.757) * (-1011.197) (-1007.792) (-1008.957) [-1008.379] -- 0:00:19

      Average standard deviation of split frequencies: 0.011599

      695500 -- [-1009.850] (-1010.228) (-1009.042) (-1013.789) * [-1009.502] (-1008.545) (-1009.839) (-1009.074) -- 0:00:19
      696000 -- (-1012.913) [-1008.357] (-1006.931) (-1006.728) * (-1009.262) [-1008.479] (-1009.850) (-1008.531) -- 0:00:19
      696500 -- (-1009.458) (-1008.512) [-1007.706] (-1009.160) * (-1011.130) [-1010.135] (-1013.357) (-1011.336) -- 0:00:19
      697000 -- (-1013.712) (-1009.760) [-1008.679] (-1011.531) * (-1013.345) [-1008.922] (-1008.766) (-1011.807) -- 0:00:19
      697500 -- (-1011.266) (-1013.823) (-1009.824) [-1007.528] * [-1011.479] (-1008.609) (-1007.487) (-1011.344) -- 0:00:19
      698000 -- (-1009.182) (-1009.790) [-1008.134] (-1007.225) * (-1012.812) (-1008.190) [-1009.580] (-1009.964) -- 0:00:19
      698500 -- [-1007.194] (-1008.674) (-1007.358) (-1009.663) * (-1012.075) (-1008.850) [-1008.671] (-1011.273) -- 0:00:18
      699000 -- (-1006.923) (-1007.963) [-1007.947] (-1009.149) * (-1009.901) [-1008.544] (-1009.730) (-1007.474) -- 0:00:18
      699500 -- (-1007.261) [-1008.082] (-1010.030) (-1008.363) * (-1012.785) (-1011.363) [-1008.108] (-1007.914) -- 0:00:18
      700000 -- (-1011.358) (-1007.739) [-1009.129] (-1008.404) * (-1013.525) [-1007.925] (-1008.207) (-1008.768) -- 0:00:18

      Average standard deviation of split frequencies: 0.011395

      700500 -- (-1006.988) (-1010.253) [-1009.198] (-1008.627) * [-1011.422] (-1007.328) (-1008.476) (-1007.648) -- 0:00:18
      701000 -- (-1007.724) [-1009.284] (-1008.914) (-1007.905) * (-1012.964) [-1008.894] (-1009.340) (-1007.692) -- 0:00:18
      701500 -- (-1006.834) (-1009.331) [-1008.135] (-1008.305) * [-1009.783] (-1009.809) (-1009.441) (-1008.694) -- 0:00:18
      702000 -- (-1007.685) [-1011.403] (-1008.460) (-1010.339) * (-1007.626) [-1007.634] (-1008.451) (-1008.851) -- 0:00:18
      702500 -- [-1007.958] (-1008.737) (-1011.530) (-1007.107) * [-1008.685] (-1011.069) (-1006.642) (-1008.641) -- 0:00:18
      703000 -- (-1008.449) (-1013.208) (-1010.935) [-1008.802] * [-1008.012] (-1007.575) (-1007.177) (-1007.485) -- 0:00:18
      703500 -- [-1007.278] (-1008.551) (-1008.090) (-1010.587) * (-1009.639) [-1007.972] (-1007.560) (-1008.350) -- 0:00:18
      704000 -- (-1010.188) [-1008.441] (-1008.208) (-1008.630) * (-1009.672) (-1008.626) (-1007.336) [-1009.351] -- 0:00:18
      704500 -- (-1007.750) (-1007.842) [-1007.758] (-1010.400) * (-1012.000) (-1010.354) (-1008.056) [-1008.015] -- 0:00:18
      705000 -- (-1008.894) (-1008.301) [-1013.185] (-1006.985) * (-1007.451) [-1008.303] (-1009.921) (-1008.997) -- 0:00:18

      Average standard deviation of split frequencies: 0.010976

      705500 -- [-1007.350] (-1008.155) (-1010.026) (-1007.206) * (-1008.840) (-1009.246) (-1013.894) [-1011.405] -- 0:00:18
      706000 -- [-1007.664] (-1007.835) (-1013.878) (-1008.083) * (-1007.383) (-1011.710) [-1010.214] (-1007.560) -- 0:00:18
      706500 -- (-1007.787) (-1009.664) (-1009.554) [-1011.111] * [-1008.632] (-1012.138) (-1008.702) (-1008.158) -- 0:00:18
      707000 -- [-1006.455] (-1012.315) (-1011.165) (-1013.745) * (-1010.115) (-1009.982) [-1006.651] (-1007.257) -- 0:00:18
      707500 -- [-1006.439] (-1010.526) (-1010.419) (-1011.030) * [-1012.092] (-1013.383) (-1009.475) (-1011.406) -- 0:00:18
      708000 -- (-1008.414) [-1007.815] (-1009.804) (-1008.082) * (-1013.091) (-1010.342) [-1008.331] (-1007.529) -- 0:00:18
      708500 -- (-1006.501) [-1008.960] (-1007.097) (-1009.222) * (-1007.733) (-1009.748) [-1008.194] (-1009.187) -- 0:00:18
      709000 -- (-1008.082) [-1008.309] (-1008.700) (-1009.339) * (-1007.798) (-1008.394) (-1015.400) [-1009.917] -- 0:00:18
      709500 -- (-1008.089) [-1009.242] (-1008.414) (-1008.030) * [-1008.528] (-1010.264) (-1009.240) (-1007.670) -- 0:00:18
      710000 -- (-1008.221) [-1009.691] (-1009.173) (-1007.533) * (-1007.688) [-1008.820] (-1007.791) (-1009.377) -- 0:00:18

      Average standard deviation of split frequencies: 0.010530

      710500 -- [-1008.855] (-1008.928) (-1009.854) (-1006.950) * (-1007.593) [-1009.579] (-1007.635) (-1008.998) -- 0:00:18
      711000 -- (-1008.946) (-1008.156) [-1009.902] (-1008.527) * (-1008.304) (-1009.650) [-1008.430] (-1010.230) -- 0:00:18
      711500 -- (-1014.991) [-1007.918] (-1006.717) (-1010.519) * (-1008.274) [-1009.460] (-1011.088) (-1010.953) -- 0:00:18
      712000 -- (-1009.516) [-1008.360] (-1008.867) (-1006.888) * [-1010.940] (-1011.508) (-1008.217) (-1010.297) -- 0:00:18
      712500 -- [-1009.698] (-1010.316) (-1008.593) (-1008.914) * [-1007.390] (-1009.737) (-1009.642) (-1009.246) -- 0:00:18
      713000 -- (-1010.040) (-1010.435) [-1008.013] (-1007.869) * (-1013.005) (-1009.448) [-1008.312] (-1008.612) -- 0:00:18
      713500 -- (-1010.253) (-1009.038) (-1009.220) [-1008.042] * [-1013.813] (-1008.128) (-1007.884) (-1008.520) -- 0:00:18
      714000 -- (-1012.187) [-1007.626] (-1008.002) (-1008.096) * [-1009.295] (-1008.703) (-1009.123) (-1010.146) -- 0:00:18
      714500 -- [-1011.129] (-1006.812) (-1009.654) (-1008.741) * [-1008.519] (-1006.569) (-1008.787) (-1010.942) -- 0:00:17
      715000 -- (-1007.604) [-1006.923] (-1007.290) (-1009.274) * (-1009.744) (-1012.876) (-1007.599) [-1008.486] -- 0:00:17

      Average standard deviation of split frequencies: 0.010164

      715500 -- [-1011.331] (-1009.515) (-1007.999) (-1011.771) * [-1007.515] (-1009.705) (-1006.620) (-1007.581) -- 0:00:17
      716000 -- (-1011.394) (-1008.612) [-1010.000] (-1008.754) * [-1007.707] (-1012.041) (-1008.444) (-1008.304) -- 0:00:17
      716500 -- [-1007.781] (-1009.333) (-1008.059) (-1010.498) * [-1008.378] (-1011.416) (-1013.050) (-1011.435) -- 0:00:17
      717000 -- (-1006.652) [-1009.340] (-1008.744) (-1011.392) * (-1010.966) (-1010.913) [-1012.316] (-1009.555) -- 0:00:17
      717500 -- (-1010.249) [-1008.728] (-1008.648) (-1009.430) * [-1007.783] (-1011.098) (-1007.556) (-1008.271) -- 0:00:17
      718000 -- (-1008.196) [-1009.484] (-1008.722) (-1008.345) * [-1006.972] (-1014.178) (-1010.036) (-1007.853) -- 0:00:17
      718500 -- [-1007.421] (-1010.302) (-1010.324) (-1009.138) * [-1006.760] (-1010.212) (-1013.001) (-1011.518) -- 0:00:17
      719000 -- [-1010.295] (-1009.545) (-1010.455) (-1006.865) * (-1007.779) [-1007.088] (-1010.173) (-1008.449) -- 0:00:17
      719500 -- [-1009.337] (-1007.698) (-1007.191) (-1007.549) * [-1009.843] (-1008.279) (-1013.708) (-1011.154) -- 0:00:17
      720000 -- (-1007.700) (-1009.572) [-1007.318] (-1007.204) * (-1007.841) [-1010.208] (-1011.889) (-1010.338) -- 0:00:17

      Average standard deviation of split frequencies: 0.010507

      720500 -- [-1008.265] (-1013.608) (-1009.174) (-1007.134) * (-1007.576) (-1008.389) [-1010.618] (-1007.914) -- 0:00:17
      721000 -- (-1008.459) [-1009.660] (-1013.757) (-1009.317) * (-1008.167) [-1011.079] (-1008.085) (-1009.641) -- 0:00:17
      721500 -- (-1014.168) [-1007.164] (-1010.488) (-1007.746) * (-1007.593) [-1008.788] (-1007.287) (-1009.794) -- 0:00:17
      722000 -- (-1010.340) (-1006.748) [-1009.733] (-1007.805) * [-1007.398] (-1007.924) (-1007.444) (-1011.201) -- 0:00:17
      722500 -- [-1007.360] (-1010.986) (-1008.784) (-1007.599) * (-1008.801) (-1007.163) [-1008.704] (-1010.479) -- 0:00:17
      723000 -- (-1007.537) [-1008.192] (-1014.333) (-1011.257) * (-1012.982) (-1010.186) [-1007.591] (-1009.306) -- 0:00:17
      723500 -- [-1008.366] (-1007.196) (-1012.853) (-1012.369) * (-1008.968) (-1011.793) [-1007.185] (-1010.133) -- 0:00:17
      724000 -- (-1008.503) (-1007.988) (-1013.581) [-1010.092] * (-1008.110) [-1010.319] (-1008.345) (-1008.431) -- 0:00:17
      724500 -- (-1008.036) (-1008.036) [-1007.197] (-1011.454) * (-1012.828) (-1007.831) (-1009.831) [-1008.473] -- 0:00:17
      725000 -- (-1007.836) (-1007.970) [-1009.013] (-1009.420) * (-1010.035) [-1008.727] (-1012.254) (-1007.064) -- 0:00:17

      Average standard deviation of split frequencies: 0.010105

      725500 -- (-1009.432) (-1006.759) [-1008.893] (-1010.414) * (-1009.674) [-1011.534] (-1013.766) (-1009.899) -- 0:00:17
      726000 -- (-1007.241) (-1007.769) [-1007.740] (-1006.886) * (-1011.618) (-1010.973) [-1010.941] (-1008.409) -- 0:00:17
      726500 -- (-1007.996) [-1010.278] (-1006.966) (-1008.004) * (-1008.272) (-1011.075) [-1008.011] (-1007.952) -- 0:00:17
      727000 -- [-1012.356] (-1007.758) (-1007.761) (-1007.423) * [-1006.863] (-1008.115) (-1010.575) (-1010.392) -- 0:00:17
      727500 -- (-1008.740) (-1012.974) (-1008.700) [-1006.843] * (-1006.846) (-1012.219) (-1011.146) [-1007.093] -- 0:00:17
      728000 -- (-1007.576) (-1009.532) (-1009.167) [-1006.851] * [-1009.910] (-1010.667) (-1009.413) (-1009.477) -- 0:00:17
      728500 -- (-1006.682) (-1008.309) (-1009.300) [-1007.635] * [-1009.111] (-1008.866) (-1007.859) (-1008.476) -- 0:00:17
      729000 -- (-1006.779) (-1009.981) (-1009.284) [-1009.152] * (-1007.982) (-1010.819) (-1012.019) [-1011.269] -- 0:00:17
      729500 -- (-1008.648) (-1009.164) [-1009.657] (-1009.539) * (-1013.149) (-1009.391) (-1008.475) [-1009.685] -- 0:00:17
      730000 -- (-1013.249) (-1010.773) (-1008.132) [-1007.595] * (-1011.925) [-1008.280] (-1011.623) (-1009.528) -- 0:00:17

      Average standard deviation of split frequencies: 0.010282

      730500 -- [-1007.787] (-1007.418) (-1010.972) (-1008.979) * [-1009.037] (-1010.714) (-1007.688) (-1012.022) -- 0:00:16
      731000 -- (-1008.306) (-1006.846) (-1008.954) [-1008.487] * (-1008.129) [-1008.765] (-1009.489) (-1011.225) -- 0:00:16
      731500 -- (-1009.453) [-1008.231] (-1007.974) (-1008.396) * (-1008.588) (-1009.023) [-1010.908] (-1007.048) -- 0:00:16
      732000 -- [-1007.480] (-1007.340) (-1008.271) (-1007.393) * (-1009.574) (-1011.119) (-1009.482) [-1012.405] -- 0:00:16
      732500 -- (-1017.869) (-1010.288) [-1007.168] (-1008.548) * (-1010.545) [-1012.437] (-1011.804) (-1011.388) -- 0:00:16
      733000 -- [-1009.423] (-1011.759) (-1007.057) (-1008.398) * (-1009.456) (-1009.775) (-1009.064) [-1009.069] -- 0:00:16
      733500 -- (-1006.704) (-1007.124) (-1008.391) [-1008.598] * (-1013.126) (-1010.527) (-1011.427) [-1009.006] -- 0:00:16
      734000 -- (-1006.754) [-1008.002] (-1007.380) (-1008.591) * (-1007.110) (-1008.704) (-1011.463) [-1008.585] -- 0:00:16
      734500 -- (-1006.586) (-1008.488) (-1009.968) [-1007.446] * (-1007.422) (-1008.978) [-1008.149] (-1007.363) -- 0:00:16
      735000 -- (-1009.186) (-1008.580) [-1009.074] (-1008.347) * (-1009.705) [-1008.662] (-1009.098) (-1007.408) -- 0:00:16

      Average standard deviation of split frequencies: 0.009968

      735500 -- (-1008.801) [-1009.402] (-1008.903) (-1011.452) * [-1007.735] (-1011.417) (-1006.997) (-1007.625) -- 0:00:16
      736000 -- (-1007.519) [-1011.689] (-1008.167) (-1007.371) * [-1007.904] (-1011.554) (-1007.853) (-1010.259) -- 0:00:16
      736500 -- [-1007.649] (-1007.770) (-1010.699) (-1009.340) * (-1010.008) (-1009.000) [-1012.854] (-1009.370) -- 0:00:16
      737000 -- (-1008.788) (-1011.475) (-1011.653) [-1008.975] * [-1009.138] (-1010.072) (-1009.275) (-1008.987) -- 0:00:16
      737500 -- (-1008.478) [-1009.709] (-1011.572) (-1008.003) * (-1010.567) (-1008.616) (-1007.805) [-1007.191] -- 0:00:16
      738000 -- (-1009.448) [-1007.978] (-1009.204) (-1010.828) * [-1007.893] (-1006.745) (-1008.177) (-1007.610) -- 0:00:16
      738500 -- (-1007.847) (-1007.519) [-1007.675] (-1016.342) * [-1007.096] (-1009.599) (-1008.227) (-1007.410) -- 0:00:16
      739000 -- (-1008.714) (-1009.477) (-1007.655) [-1010.447] * (-1011.002) (-1013.415) [-1007.710] (-1008.232) -- 0:00:16
      739500 -- (-1009.306) (-1007.429) [-1011.539] (-1007.957) * (-1007.418) (-1010.960) (-1007.552) [-1009.406] -- 0:00:16
      740000 -- [-1007.902] (-1008.332) (-1008.816) (-1009.487) * [-1006.666] (-1007.977) (-1007.950) (-1009.147) -- 0:00:16

      Average standard deviation of split frequencies: 0.009428

      740500 -- (-1006.612) [-1007.746] (-1009.553) (-1007.896) * (-1007.540) (-1008.679) (-1009.171) [-1008.454] -- 0:00:16
      741000 -- (-1007.848) (-1008.869) [-1011.443] (-1007.189) * (-1011.250) (-1009.644) [-1011.108] (-1008.003) -- 0:00:16
      741500 -- [-1008.972] (-1011.103) (-1010.644) (-1010.792) * (-1010.065) (-1008.252) [-1008.388] (-1009.076) -- 0:00:16
      742000 -- (-1008.519) (-1010.344) [-1009.448] (-1010.482) * (-1012.381) (-1013.601) [-1008.788] (-1009.988) -- 0:00:16
      742500 -- (-1006.646) [-1010.145] (-1007.822) (-1010.060) * [-1009.094] (-1008.297) (-1008.679) (-1008.934) -- 0:00:16
      743000 -- (-1007.579) (-1011.792) [-1007.565] (-1008.484) * (-1008.499) (-1008.410) [-1007.442] (-1009.489) -- 0:00:16
      743500 -- [-1006.884] (-1014.391) (-1009.026) (-1007.542) * (-1011.338) [-1008.106] (-1010.608) (-1010.917) -- 0:00:16
      744000 -- (-1008.583) [-1006.937] (-1017.085) (-1009.252) * [-1009.209] (-1009.696) (-1008.116) (-1010.487) -- 0:00:16
      744500 -- (-1012.040) (-1009.014) (-1011.781) [-1009.252] * (-1013.903) [-1007.697] (-1008.747) (-1011.937) -- 0:00:16
      745000 -- (-1010.760) (-1010.028) [-1009.697] (-1007.852) * (-1008.251) (-1007.090) [-1009.289] (-1011.634) -- 0:00:16

      Average standard deviation of split frequencies: 0.009597

      745500 -- (-1010.288) (-1008.283) (-1008.148) [-1008.550] * [-1008.198] (-1009.157) (-1007.497) (-1012.803) -- 0:00:16
      746000 -- (-1012.866) (-1010.224) [-1010.155] (-1008.026) * [-1008.193] (-1009.764) (-1007.290) (-1012.058) -- 0:00:16
      746500 -- (-1007.157) (-1011.047) (-1010.046) [-1008.241] * (-1006.992) (-1008.685) (-1011.410) [-1010.360] -- 0:00:15
      747000 -- (-1010.064) (-1011.478) [-1011.275] (-1009.215) * (-1008.149) [-1008.271] (-1007.338) (-1013.342) -- 0:00:15
      747500 -- [-1009.964] (-1007.352) (-1010.644) (-1008.981) * (-1011.191) (-1008.368) [-1010.365] (-1008.490) -- 0:00:15
      748000 -- (-1012.508) [-1008.870] (-1009.597) (-1010.232) * (-1008.919) [-1007.304] (-1007.928) (-1008.296) -- 0:00:15
      748500 -- (-1009.678) [-1008.093] (-1008.758) (-1007.326) * (-1009.099) (-1008.160) (-1008.650) [-1006.783] -- 0:00:15
      749000 -- (-1009.087) (-1007.552) (-1006.786) [-1008.798] * [-1007.975] (-1014.917) (-1008.573) (-1007.949) -- 0:00:15
      749500 -- [-1013.518] (-1012.443) (-1007.087) (-1018.703) * [-1008.900] (-1014.992) (-1011.688) (-1008.455) -- 0:00:15
      750000 -- [-1010.943] (-1008.353) (-1008.465) (-1010.073) * (-1007.744) [-1007.054] (-1012.375) (-1007.089) -- 0:00:15

      Average standard deviation of split frequencies: 0.009773

      750500 -- (-1012.942) (-1009.952) (-1012.285) [-1011.388] * [-1008.599] (-1012.490) (-1009.748) (-1009.376) -- 0:00:15
      751000 -- [-1011.431] (-1007.065) (-1015.645) (-1010.132) * [-1007.694] (-1010.708) (-1009.541) (-1006.895) -- 0:00:15
      751500 -- [-1010.337] (-1007.699) (-1009.617) (-1007.460) * [-1008.218] (-1014.449) (-1008.510) (-1015.292) -- 0:00:15
      752000 -- (-1007.604) [-1008.041] (-1007.503) (-1008.414) * (-1010.063) (-1010.671) [-1008.149] (-1011.526) -- 0:00:15
      752500 -- [-1009.101] (-1011.470) (-1008.682) (-1011.294) * (-1012.587) (-1010.126) (-1013.039) [-1008.676] -- 0:00:15
      753000 -- (-1009.752) (-1009.606) (-1007.280) [-1008.956] * [-1012.219] (-1011.347) (-1007.790) (-1010.259) -- 0:00:15
      753500 -- [-1012.326] (-1008.440) (-1010.837) (-1007.344) * (-1008.197) (-1009.384) (-1011.864) [-1011.117] -- 0:00:15
      754000 -- [-1008.916] (-1014.437) (-1009.685) (-1009.183) * (-1009.540) (-1007.588) (-1007.338) [-1007.505] -- 0:00:15
      754500 -- (-1007.611) (-1007.726) [-1007.535] (-1010.586) * (-1008.050) (-1008.213) [-1009.982] (-1012.029) -- 0:00:15
      755000 -- (-1008.058) (-1007.775) (-1010.401) [-1009.435] * (-1008.115) (-1008.061) (-1007.596) [-1007.488] -- 0:00:15

      Average standard deviation of split frequencies: 0.009392

      755500 -- (-1008.006) (-1007.807) (-1012.084) [-1008.961] * (-1014.368) (-1012.020) [-1012.492] (-1007.019) -- 0:00:15
      756000 -- (-1008.463) (-1007.418) [-1009.006] (-1009.018) * (-1008.546) (-1008.130) [-1007.621] (-1006.709) -- 0:00:15
      756500 -- [-1008.492] (-1010.399) (-1007.718) (-1008.114) * (-1009.686) [-1009.126] (-1009.529) (-1012.370) -- 0:00:15
      757000 -- [-1008.393] (-1006.745) (-1010.423) (-1011.350) * (-1009.163) (-1010.588) (-1008.809) [-1009.105] -- 0:00:15
      757500 -- (-1006.950) (-1006.977) (-1009.461) [-1011.120] * (-1010.043) (-1010.272) (-1012.224) [-1008.198] -- 0:00:15
      758000 -- (-1009.359) [-1009.270] (-1010.344) (-1009.418) * (-1007.301) (-1014.107) [-1009.011] (-1010.025) -- 0:00:15
      758500 -- (-1012.232) (-1009.586) [-1013.288] (-1010.316) * [-1009.955] (-1010.772) (-1008.092) (-1008.480) -- 0:00:15
      759000 -- (-1008.862) [-1009.341] (-1011.418) (-1008.820) * (-1009.661) [-1008.255] (-1009.253) (-1007.980) -- 0:00:15
      759500 -- (-1012.710) (-1009.225) [-1008.331] (-1011.488) * (-1008.753) (-1007.329) [-1009.270] (-1006.969) -- 0:00:15
      760000 -- (-1008.505) (-1008.227) [-1008.680] (-1013.194) * (-1007.159) (-1010.724) (-1009.469) [-1008.975] -- 0:00:15

      Average standard deviation of split frequencies: 0.009379

      760500 -- (-1008.028) [-1008.324] (-1008.664) (-1009.703) * [-1007.234] (-1009.823) (-1010.838) (-1011.320) -- 0:00:15
      761000 -- (-1010.969) (-1009.394) (-1009.668) [-1012.456] * (-1009.331) (-1013.193) (-1010.340) [-1008.606] -- 0:00:15
      761500 -- [-1010.950] (-1009.050) (-1011.805) (-1012.519) * (-1007.039) [-1008.198] (-1010.258) (-1015.634) -- 0:00:15
      762000 -- (-1008.746) (-1008.856) (-1007.062) [-1007.375] * (-1008.246) (-1009.395) (-1008.693) [-1010.492] -- 0:00:14
      762500 -- (-1008.037) (-1008.388) (-1007.315) [-1011.285] * [-1007.029] (-1006.683) (-1007.227) (-1014.057) -- 0:00:14
      763000 -- (-1008.543) (-1009.116) [-1013.676] (-1012.730) * (-1007.051) (-1009.256) (-1010.568) [-1007.807] -- 0:00:14
      763500 -- (-1009.118) [-1009.945] (-1008.559) (-1006.699) * [-1006.970] (-1006.825) (-1007.321) (-1007.378) -- 0:00:14
      764000 -- (-1009.134) [-1007.614] (-1008.745) (-1006.787) * (-1013.488) (-1011.108) [-1011.752] (-1008.738) -- 0:00:14
      764500 -- [-1007.263] (-1009.020) (-1008.842) (-1007.190) * (-1011.871) [-1007.206] (-1008.090) (-1006.841) -- 0:00:14
      765000 -- [-1008.551] (-1009.092) (-1008.373) (-1007.942) * (-1011.984) [-1008.025] (-1014.036) (-1008.476) -- 0:00:14

      Average standard deviation of split frequencies: 0.009308

      765500 -- (-1009.207) (-1008.851) (-1007.197) [-1008.435] * (-1007.830) (-1008.439) [-1009.850] (-1006.906) -- 0:00:14
      766000 -- (-1007.030) [-1008.658] (-1007.197) (-1010.006) * [-1009.045] (-1008.641) (-1010.631) (-1007.063) -- 0:00:14
      766500 -- (-1010.890) (-1013.354) [-1007.720] (-1010.244) * [-1008.064] (-1012.635) (-1009.265) (-1009.192) -- 0:00:14
      767000 -- (-1011.955) (-1010.041) [-1008.551] (-1009.299) * (-1010.161) (-1008.246) [-1007.161] (-1011.356) -- 0:00:14
      767500 -- (-1009.887) (-1010.438) [-1011.929] (-1010.509) * (-1010.355) (-1007.169) [-1007.884] (-1009.744) -- 0:00:14
      768000 -- (-1008.837) [-1009.008] (-1018.572) (-1009.603) * (-1006.863) [-1007.910] (-1012.064) (-1012.425) -- 0:00:14
      768500 -- [-1012.180] (-1008.240) (-1015.879) (-1009.545) * (-1010.556) [-1008.139] (-1013.213) (-1014.234) -- 0:00:14
      769000 -- (-1009.959) (-1006.685) [-1008.872] (-1014.352) * (-1008.061) [-1009.044] (-1007.849) (-1010.903) -- 0:00:14
      769500 -- (-1007.937) (-1007.647) (-1007.430) [-1007.514] * [-1007.455] (-1010.472) (-1013.182) (-1010.178) -- 0:00:14
      770000 -- (-1011.115) (-1008.007) (-1007.205) [-1007.460] * [-1007.545] (-1015.580) (-1007.066) (-1008.629) -- 0:00:14

      Average standard deviation of split frequencies: 0.009298

      770500 -- (-1010.313) [-1008.869] (-1007.849) (-1008.935) * (-1009.776) (-1011.044) [-1006.976] (-1009.128) -- 0:00:14
      771000 -- (-1009.511) (-1008.930) (-1007.731) [-1007.155] * (-1009.573) (-1008.943) [-1006.528] (-1010.547) -- 0:00:14
      771500 -- [-1008.992] (-1008.442) (-1007.304) (-1008.032) * [-1009.097] (-1009.155) (-1008.899) (-1011.342) -- 0:00:14
      772000 -- (-1008.675) (-1009.577) (-1007.108) [-1007.368] * (-1008.035) (-1008.633) (-1009.642) [-1009.451] -- 0:00:14
      772500 -- (-1007.418) (-1009.826) (-1007.741) [-1007.334] * (-1007.371) (-1007.885) (-1010.318) [-1007.928] -- 0:00:14
      773000 -- [-1006.700] (-1007.095) (-1009.726) (-1008.420) * (-1007.599) (-1008.536) (-1007.450) [-1010.807] -- 0:00:14
      773500 -- (-1007.031) (-1007.215) (-1007.483) [-1007.657] * (-1010.064) [-1008.720] (-1007.329) (-1013.748) -- 0:00:14
      774000 -- (-1011.090) (-1008.733) (-1009.286) [-1007.616] * (-1009.074) (-1007.053) [-1007.971] (-1007.902) -- 0:00:14
      774500 -- (-1008.427) (-1007.669) [-1008.429] (-1008.613) * [-1006.961] (-1009.092) (-1008.568) (-1013.044) -- 0:00:14
      775000 -- (-1008.153) (-1009.105) [-1006.919] (-1010.490) * (-1008.886) [-1007.305] (-1007.428) (-1008.581) -- 0:00:14

      Average standard deviation of split frequencies: 0.009315

      775500 -- [-1007.661] (-1015.974) (-1008.221) (-1008.259) * (-1008.029) (-1007.239) (-1008.695) [-1006.815] -- 0:00:14
      776000 -- (-1007.709) (-1014.487) [-1007.507] (-1009.555) * (-1007.903) (-1007.745) [-1009.613] (-1015.742) -- 0:00:14
      776500 -- (-1007.585) (-1014.307) (-1010.824) [-1007.652] * (-1006.967) (-1009.325) (-1008.518) [-1010.335] -- 0:00:14
      777000 -- (-1007.706) (-1013.192) [-1008.707] (-1006.719) * [-1008.237] (-1011.348) (-1006.916) (-1007.361) -- 0:00:14
      777500 -- (-1008.391) (-1009.758) (-1012.054) [-1006.677] * (-1008.686) (-1015.904) [-1007.240] (-1008.906) -- 0:00:14
      778000 -- [-1008.176] (-1009.522) (-1011.673) (-1006.696) * [-1010.929] (-1011.917) (-1009.034) (-1008.291) -- 0:00:13
      778500 -- (-1007.955) (-1010.253) [-1007.353] (-1007.880) * [-1006.602] (-1008.883) (-1007.841) (-1008.918) -- 0:00:13
      779000 -- [-1007.596] (-1006.653) (-1008.477) (-1012.721) * (-1011.149) (-1013.560) (-1006.750) [-1008.195] -- 0:00:13
      779500 -- [-1008.248] (-1007.634) (-1011.180) (-1009.435) * [-1011.676] (-1009.507) (-1007.670) (-1008.412) -- 0:00:13
      780000 -- (-1008.532) (-1007.010) (-1010.195) [-1008.840] * [-1007.803] (-1014.269) (-1010.065) (-1008.293) -- 0:00:13

      Average standard deviation of split frequencies: 0.009380

      780500 -- (-1006.911) (-1007.602) [-1009.250] (-1008.668) * (-1009.985) (-1010.991) (-1010.315) [-1014.146] -- 0:00:13
      781000 -- (-1006.911) (-1009.683) (-1010.966) [-1008.325] * (-1009.264) [-1009.371] (-1009.036) (-1010.958) -- 0:00:13
      781500 -- (-1006.873) [-1008.073] (-1011.857) (-1009.911) * [-1007.992] (-1010.999) (-1010.767) (-1008.193) -- 0:00:13
      782000 -- [-1006.862] (-1008.381) (-1009.010) (-1009.775) * (-1007.553) (-1009.210) (-1008.933) [-1009.823] -- 0:00:13
      782500 -- (-1006.718) (-1009.180) [-1010.474] (-1012.556) * (-1007.837) [-1007.418] (-1008.284) (-1008.084) -- 0:00:13
      783000 -- (-1007.600) [-1008.032] (-1008.847) (-1012.547) * (-1009.510) (-1007.867) [-1011.885] (-1011.737) -- 0:00:13
      783500 -- (-1011.604) (-1008.280) (-1006.696) [-1007.686] * (-1010.295) (-1010.698) [-1011.329] (-1010.537) -- 0:00:13
      784000 -- (-1013.055) [-1008.236] (-1010.134) (-1007.042) * (-1010.532) [-1009.484] (-1009.281) (-1007.889) -- 0:00:13
      784500 -- (-1008.320) [-1008.036] (-1011.414) (-1008.764) * (-1013.242) [-1012.217] (-1008.163) (-1010.567) -- 0:00:13
      785000 -- (-1007.582) (-1013.466) (-1008.989) [-1011.651] * (-1008.993) (-1015.194) [-1011.805] (-1007.689) -- 0:00:13

      Average standard deviation of split frequencies: 0.009156

      785500 -- (-1007.832) [-1008.530] (-1007.840) (-1009.147) * [-1007.431] (-1009.316) (-1010.319) (-1010.469) -- 0:00:13
      786000 -- (-1008.163) (-1012.507) (-1009.457) [-1010.381] * (-1007.813) (-1012.453) [-1008.856] (-1006.912) -- 0:00:13
      786500 -- [-1007.414] (-1010.808) (-1010.481) (-1009.210) * [-1008.634] (-1009.808) (-1009.587) (-1007.957) -- 0:00:13
      787000 -- (-1007.686) (-1009.468) [-1009.485] (-1011.600) * (-1008.291) (-1008.395) (-1009.849) [-1008.254] -- 0:00:13
      787500 -- [-1011.201] (-1007.870) (-1009.249) (-1017.267) * [-1007.608] (-1007.618) (-1009.688) (-1008.781) -- 0:00:13
      788000 -- (-1012.956) (-1009.383) [-1009.423] (-1008.125) * [-1009.004] (-1007.107) (-1008.257) (-1007.502) -- 0:00:13
      788500 -- (-1018.266) (-1012.830) (-1015.940) [-1008.050] * [-1007.369] (-1008.644) (-1010.666) (-1008.253) -- 0:00:13
      789000 -- (-1007.828) (-1009.916) (-1007.286) [-1009.834] * (-1006.677) (-1010.289) [-1010.171] (-1009.862) -- 0:00:13
      789500 -- [-1008.591] (-1009.662) (-1008.915) (-1009.930) * (-1006.871) [-1007.558] (-1007.551) (-1008.658) -- 0:00:13
      790000 -- (-1008.050) [-1007.538] (-1008.986) (-1007.367) * (-1008.448) (-1009.959) (-1007.857) [-1009.437] -- 0:00:13

      Average standard deviation of split frequencies: 0.009062

      790500 -- (-1011.202) [-1010.869] (-1008.873) (-1007.270) * (-1008.516) [-1007.722] (-1009.013) (-1012.868) -- 0:00:12
      791000 -- (-1008.836) (-1009.317) (-1009.970) [-1008.609] * [-1008.793] (-1011.198) (-1011.732) (-1007.718) -- 0:00:13
      791500 -- [-1008.294] (-1008.200) (-1009.057) (-1008.508) * (-1009.292) (-1009.346) (-1014.569) [-1007.421] -- 0:00:13
      792000 -- (-1010.309) (-1008.553) [-1008.276] (-1011.941) * (-1010.620) [-1007.834] (-1012.689) (-1010.100) -- 0:00:13
      792500 -- (-1009.800) [-1008.646] (-1010.785) (-1009.659) * (-1007.915) [-1009.911] (-1010.903) (-1009.303) -- 0:00:13
      793000 -- (-1011.674) [-1007.051] (-1011.376) (-1012.250) * (-1010.082) (-1007.837) (-1009.480) [-1008.992] -- 0:00:13
      793500 -- (-1010.947) (-1008.420) (-1012.165) [-1008.044] * [-1014.534] (-1008.517) (-1010.746) (-1010.640) -- 0:00:13
      794000 -- (-1008.644) [-1008.091] (-1011.269) (-1008.056) * (-1010.961) (-1009.297) (-1011.981) [-1013.318] -- 0:00:12
      794500 -- (-1007.773) [-1008.042] (-1010.235) (-1007.704) * (-1009.734) [-1010.854] (-1007.894) (-1012.740) -- 0:00:12
      795000 -- (-1011.593) [-1009.173] (-1009.261) (-1006.933) * [-1010.874] (-1009.078) (-1009.669) (-1013.270) -- 0:00:12

      Average standard deviation of split frequencies: 0.009278

      795500 -- (-1008.901) [-1008.947] (-1011.391) (-1007.638) * (-1013.002) [-1007.384] (-1010.669) (-1011.345) -- 0:00:12
      796000 -- (-1009.320) (-1009.365) [-1008.116] (-1006.753) * (-1006.920) (-1013.093) [-1007.533] (-1011.959) -- 0:00:12
      796500 -- (-1009.299) (-1011.954) [-1009.331] (-1006.990) * [-1007.494] (-1013.303) (-1009.619) (-1010.617) -- 0:00:12
      797000 -- (-1015.841) (-1011.021) (-1007.112) [-1013.787] * (-1009.706) [-1007.361] (-1014.274) (-1010.278) -- 0:00:12
      797500 -- (-1008.665) (-1010.540) [-1007.308] (-1009.822) * (-1013.350) (-1006.823) (-1008.716) [-1006.809] -- 0:00:12
      798000 -- [-1008.445] (-1009.176) (-1013.820) (-1012.906) * (-1009.026) [-1007.257] (-1010.693) (-1006.716) -- 0:00:12
      798500 -- (-1012.279) (-1011.492) (-1014.079) [-1007.574] * (-1012.319) [-1008.784] (-1006.941) (-1008.518) -- 0:00:12
      799000 -- [-1008.051] (-1009.113) (-1010.800) (-1008.473) * [-1011.065] (-1011.326) (-1013.157) (-1007.867) -- 0:00:12
      799500 -- (-1008.873) (-1014.842) [-1008.642] (-1008.348) * [-1008.184] (-1007.931) (-1009.150) (-1007.614) -- 0:00:12
      800000 -- (-1010.584) (-1013.059) (-1008.456) [-1007.861] * (-1008.717) [-1007.638] (-1009.464) (-1007.818) -- 0:00:12

      Average standard deviation of split frequencies: 0.009145

      800500 -- (-1011.222) [-1008.858] (-1010.856) (-1009.022) * (-1007.536) (-1008.482) [-1009.382] (-1011.201) -- 0:00:12
      801000 -- [-1010.895] (-1010.284) (-1007.289) (-1014.420) * [-1007.900] (-1009.446) (-1009.629) (-1011.888) -- 0:00:12
      801500 -- (-1008.445) (-1009.512) [-1008.137] (-1008.909) * [-1009.111] (-1009.161) (-1012.142) (-1008.819) -- 0:00:12
      802000 -- (-1009.155) [-1011.704] (-1009.400) (-1008.844) * (-1007.078) [-1009.481] (-1007.015) (-1010.324) -- 0:00:12
      802500 -- (-1007.783) (-1006.791) [-1010.488] (-1014.377) * (-1009.028) (-1012.842) [-1007.130] (-1009.675) -- 0:00:12
      803000 -- (-1010.876) (-1009.257) [-1008.304] (-1008.625) * (-1011.871) (-1006.749) [-1009.437] (-1008.114) -- 0:00:12
      803500 -- (-1012.989) (-1010.546) [-1008.244] (-1010.213) * (-1008.801) (-1006.868) [-1016.767] (-1011.430) -- 0:00:12
      804000 -- (-1014.785) [-1007.579] (-1008.701) (-1010.653) * (-1008.932) (-1012.679) (-1008.196) [-1009.769] -- 0:00:12
      804500 -- (-1013.648) (-1011.938) [-1007.857] (-1013.054) * (-1010.966) [-1011.141] (-1008.272) (-1007.798) -- 0:00:12
      805000 -- [-1011.849] (-1010.611) (-1009.901) (-1011.413) * (-1009.121) (-1009.001) (-1013.350) [-1008.046] -- 0:00:12

      Average standard deviation of split frequencies: 0.009124

      805500 -- (-1012.973) (-1013.371) (-1006.717) [-1007.247] * (-1009.875) (-1007.538) [-1010.102] (-1007.971) -- 0:00:12
      806000 -- (-1009.017) (-1011.215) (-1011.610) [-1006.669] * (-1008.453) (-1009.510) [-1008.431] (-1007.707) -- 0:00:12
      806500 -- (-1010.411) (-1009.248) [-1010.209] (-1008.249) * (-1009.097) (-1007.799) (-1015.619) [-1007.871] -- 0:00:11
      807000 -- (-1009.765) [-1009.524] (-1008.746) (-1008.785) * (-1008.482) (-1009.739) [-1009.104] (-1014.633) -- 0:00:12
      807500 -- (-1011.719) (-1007.428) (-1010.527) [-1007.878] * (-1008.756) (-1010.341) (-1008.131) [-1009.358] -- 0:00:12
      808000 -- (-1010.484) (-1010.425) [-1007.906] (-1010.021) * (-1008.056) [-1009.935] (-1007.228) (-1014.391) -- 0:00:12
      808500 -- [-1006.705] (-1011.549) (-1007.967) (-1008.191) * [-1008.027] (-1010.269) (-1006.516) (-1010.807) -- 0:00:12
      809000 -- (-1006.705) [-1009.687] (-1009.810) (-1007.404) * [-1008.383] (-1011.450) (-1007.988) (-1009.583) -- 0:00:12
      809500 -- (-1007.680) (-1010.312) (-1009.144) [-1008.324] * [-1008.534] (-1007.987) (-1008.567) (-1009.759) -- 0:00:12
      810000 -- (-1007.452) [-1008.751] (-1009.162) (-1012.076) * (-1011.184) (-1008.329) [-1008.235] (-1010.341) -- 0:00:11

      Average standard deviation of split frequencies: 0.009343

      810500 -- [-1007.396] (-1010.422) (-1008.172) (-1009.930) * (-1011.127) (-1007.479) [-1009.029] (-1010.537) -- 0:00:11
      811000 -- (-1009.743) (-1009.165) [-1006.690] (-1008.621) * [-1007.886] (-1010.571) (-1009.020) (-1009.144) -- 0:00:11
      811500 -- [-1010.319] (-1011.052) (-1007.575) (-1007.534) * (-1008.078) (-1010.234) [-1009.877] (-1009.019) -- 0:00:11
      812000 -- (-1009.958) [-1007.690] (-1007.114) (-1007.224) * (-1007.782) (-1010.017) [-1007.306] (-1011.597) -- 0:00:11
      812500 -- (-1011.233) [-1008.173] (-1010.826) (-1009.935) * (-1008.583) (-1007.779) (-1007.271) [-1007.853] -- 0:00:11
      813000 -- (-1008.166) (-1008.793) (-1010.704) [-1006.964] * [-1009.202] (-1008.773) (-1007.646) (-1007.508) -- 0:00:11
      813500 -- (-1006.649) (-1007.558) (-1010.709) [-1010.513] * [-1007.012] (-1007.930) (-1009.259) (-1006.978) -- 0:00:11
      814000 -- (-1006.859) [-1011.196] (-1009.930) (-1009.228) * [-1007.003] (-1006.873) (-1010.013) (-1017.249) -- 0:00:11
      814500 -- (-1008.124) [-1007.707] (-1010.002) (-1007.744) * [-1007.069] (-1007.220) (-1012.307) (-1011.125) -- 0:00:11
      815000 -- (-1009.105) (-1008.070) [-1008.127] (-1007.616) * (-1008.622) (-1008.200) (-1008.819) [-1009.059] -- 0:00:11

      Average standard deviation of split frequencies: 0.009513

      815500 -- [-1009.176] (-1013.183) (-1009.899) (-1008.377) * (-1009.592) (-1007.522) (-1009.205) [-1008.454] -- 0:00:11
      816000 -- [-1008.515] (-1011.769) (-1011.705) (-1008.221) * (-1009.986) [-1008.034] (-1011.034) (-1010.257) -- 0:00:11
      816500 -- (-1007.629) [-1009.141] (-1011.519) (-1008.698) * (-1009.775) (-1008.875) [-1008.295] (-1008.872) -- 0:00:11
      817000 -- (-1006.905) [-1009.481] (-1008.209) (-1009.994) * [-1011.088] (-1010.476) (-1008.542) (-1009.506) -- 0:00:11
      817500 -- (-1007.883) (-1007.690) (-1010.178) [-1012.317] * (-1008.516) (-1008.379) (-1008.080) [-1009.081] -- 0:00:11
      818000 -- [-1008.166] (-1007.869) (-1010.719) (-1012.382) * [-1007.872] (-1007.680) (-1008.461) (-1009.553) -- 0:00:11
      818500 -- (-1011.547) (-1008.179) (-1012.019) [-1007.126] * [-1010.287] (-1007.881) (-1007.961) (-1012.993) -- 0:00:11
      819000 -- (-1010.801) (-1007.448) (-1008.402) [-1007.787] * (-1006.985) (-1010.273) [-1008.598] (-1009.844) -- 0:00:11
      819500 -- (-1014.419) [-1007.413] (-1009.646) (-1009.180) * (-1008.724) [-1015.932] (-1007.794) (-1010.373) -- 0:00:11
      820000 -- (-1010.487) (-1008.787) (-1007.408) [-1007.670] * (-1010.367) (-1009.038) [-1008.310] (-1009.238) -- 0:00:11

      Average standard deviation of split frequencies: 0.009344

      820500 -- (-1009.526) [-1008.653] (-1007.997) (-1010.571) * [-1009.097] (-1009.765) (-1007.835) (-1008.282) -- 0:00:11
      821000 -- (-1007.830) [-1008.037] (-1014.248) (-1009.443) * (-1008.715) (-1010.278) (-1010.222) [-1007.126] -- 0:00:11
      821500 -- (-1007.450) [-1010.284] (-1012.700) (-1011.037) * (-1010.705) (-1010.409) (-1011.567) [-1010.226] -- 0:00:11
      822000 -- (-1008.387) (-1010.236) [-1008.221] (-1010.184) * [-1010.096] (-1011.274) (-1008.860) (-1012.672) -- 0:00:11
      822500 -- [-1009.676] (-1010.725) (-1010.148) (-1011.361) * (-1010.520) (-1009.293) (-1011.386) [-1009.515] -- 0:00:11
      823000 -- (-1010.036) (-1008.867) (-1008.065) [-1009.039] * [-1007.684] (-1008.468) (-1009.207) (-1008.526) -- 0:00:10
      823500 -- (-1008.607) [-1013.508] (-1010.506) (-1010.154) * (-1009.572) (-1008.667) (-1009.888) [-1008.769] -- 0:00:11
      824000 -- (-1008.734) (-1011.578) [-1009.592] (-1009.434) * (-1007.602) [-1007.690] (-1009.888) (-1007.400) -- 0:00:11
      824500 -- (-1010.358) (-1009.839) (-1007.159) [-1008.567] * (-1008.940) [-1008.590] (-1012.973) (-1011.590) -- 0:00:11
      825000 -- (-1011.234) (-1011.769) (-1012.793) [-1008.871] * (-1009.599) (-1011.760) [-1010.451] (-1007.494) -- 0:00:11

      Average standard deviation of split frequencies: 0.009550

      825500 -- (-1010.202) (-1010.450) [-1009.188] (-1014.317) * (-1009.602) (-1012.216) [-1008.140] (-1008.159) -- 0:00:10
      826000 -- (-1010.305) (-1012.589) [-1007.277] (-1012.108) * [-1010.217] (-1008.463) (-1009.056) (-1007.100) -- 0:00:10
      826500 -- (-1008.245) [-1007.674] (-1007.163) (-1009.431) * (-1007.840) (-1009.107) (-1010.888) [-1007.169] -- 0:00:10
      827000 -- (-1007.404) [-1014.340] (-1009.221) (-1010.186) * (-1008.352) [-1008.636] (-1007.477) (-1006.704) -- 0:00:10
      827500 -- (-1009.763) (-1011.025) [-1014.652] (-1009.698) * (-1007.720) [-1009.024] (-1010.646) (-1006.687) -- 0:00:10
      828000 -- (-1013.946) (-1009.164) (-1010.618) [-1009.193] * (-1010.073) (-1007.933) [-1010.540] (-1010.575) -- 0:00:10
      828500 -- (-1010.186) (-1009.256) (-1007.037) [-1008.942] * [-1008.072] (-1009.532) (-1009.893) (-1008.728) -- 0:00:10
      829000 -- (-1008.951) (-1008.158) (-1010.823) [-1008.484] * [-1007.445] (-1008.171) (-1010.455) (-1007.873) -- 0:00:10
      829500 -- (-1010.382) [-1008.216] (-1007.594) (-1007.623) * (-1010.211) (-1010.561) (-1009.157) [-1008.041] -- 0:00:10
      830000 -- (-1011.018) (-1012.199) [-1007.374] (-1007.742) * (-1010.437) (-1007.413) (-1011.528) [-1007.065] -- 0:00:10

      Average standard deviation of split frequencies: 0.009648

      830500 -- (-1008.817) (-1011.296) (-1011.081) [-1008.313] * [-1007.944] (-1006.740) (-1007.936) (-1007.111) -- 0:00:10
      831000 -- (-1010.896) (-1007.338) [-1008.293] (-1006.991) * (-1007.946) [-1007.471] (-1006.956) (-1007.657) -- 0:00:10
      831500 -- (-1010.603) [-1009.312] (-1008.477) (-1009.889) * [-1008.349] (-1009.633) (-1008.156) (-1009.295) -- 0:00:10
      832000 -- (-1007.543) (-1010.541) [-1007.246] (-1010.753) * [-1008.692] (-1009.305) (-1006.940) (-1008.692) -- 0:00:10
      832500 -- [-1008.184] (-1007.945) (-1007.017) (-1011.627) * [-1010.245] (-1008.325) (-1009.387) (-1011.044) -- 0:00:10
      833000 -- (-1007.432) [-1007.632] (-1009.082) (-1010.122) * (-1012.427) (-1007.923) [-1008.950] (-1010.985) -- 0:00:10
      833500 -- (-1007.827) (-1006.613) [-1008.454] (-1008.106) * (-1008.449) [-1008.741] (-1009.626) (-1007.504) -- 0:00:10
      834000 -- [-1008.031] (-1008.266) (-1009.786) (-1008.393) * (-1011.486) (-1012.116) [-1015.135] (-1008.717) -- 0:00:10
      834500 -- [-1008.460] (-1007.913) (-1011.710) (-1009.330) * [-1007.961] (-1008.162) (-1012.063) (-1009.604) -- 0:00:10
      835000 -- [-1007.040] (-1007.568) (-1014.272) (-1012.555) * (-1011.908) (-1009.362) [-1012.899] (-1009.074) -- 0:00:10

      Average standard deviation of split frequencies: 0.009887

      835500 -- (-1008.630) (-1008.977) [-1008.010] (-1011.713) * (-1015.227) (-1007.825) [-1008.648] (-1008.128) -- 0:00:10
      836000 -- (-1009.514) (-1006.970) (-1010.034) [-1011.331] * (-1007.335) (-1007.819) (-1007.237) [-1008.773] -- 0:00:10
      836500 -- [-1008.899] (-1007.357) (-1010.877) (-1007.222) * (-1007.909) (-1009.219) (-1007.866) [-1007.765] -- 0:00:10
      837000 -- [-1008.289] (-1009.316) (-1011.860) (-1009.916) * (-1010.100) [-1006.675] (-1009.766) (-1007.932) -- 0:00:10
      837500 -- [-1010.185] (-1009.071) (-1008.426) (-1008.051) * (-1008.954) (-1007.084) (-1010.887) [-1007.252] -- 0:00:10
      838000 -- [-1009.025] (-1007.101) (-1009.993) (-1007.116) * [-1007.999] (-1008.028) (-1012.942) (-1007.134) -- 0:00:10
      838500 -- (-1010.107) [-1008.726] (-1008.450) (-1006.597) * [-1008.065] (-1010.294) (-1008.026) (-1007.134) -- 0:00:10
      839000 -- (-1009.702) [-1007.309] (-1007.091) (-1008.400) * (-1008.001) (-1009.565) (-1008.274) [-1009.931] -- 0:00:09
      839500 -- (-1007.463) (-1008.500) [-1007.279] (-1010.894) * (-1006.897) (-1009.238) [-1009.646] (-1008.206) -- 0:00:09
      840000 -- (-1006.946) (-1007.839) [-1007.312] (-1007.753) * (-1010.973) (-1008.820) [-1008.556] (-1007.793) -- 0:00:10

      Average standard deviation of split frequencies: 0.009421

      840500 -- (-1007.118) [-1008.322] (-1008.345) (-1008.715) * [-1009.405] (-1007.612) (-1008.456) (-1007.381) -- 0:00:10
      841000 -- (-1008.404) [-1007.881] (-1009.871) (-1013.263) * (-1007.360) [-1007.889] (-1011.430) (-1007.113) -- 0:00:10
      841500 -- (-1010.428) (-1010.169) (-1012.869) [-1008.756] * (-1007.187) (-1008.965) (-1009.404) [-1008.804] -- 0:00:09
      842000 -- (-1008.930) [-1011.191] (-1009.492) (-1009.721) * (-1012.482) (-1008.070) (-1009.951) [-1010.950] -- 0:00:09
      842500 -- [-1007.056] (-1008.854) (-1008.374) (-1008.880) * (-1010.078) (-1007.618) (-1011.067) [-1013.561] -- 0:00:09
      843000 -- (-1008.913) (-1011.451) (-1011.593) [-1008.938] * (-1011.715) [-1011.973] (-1014.290) (-1012.441) -- 0:00:09
      843500 -- (-1007.260) (-1012.376) (-1007.654) [-1008.184] * (-1012.587) (-1009.068) (-1009.629) [-1007.700] -- 0:00:09
      844000 -- (-1009.337) [-1009.349] (-1010.939) (-1010.805) * (-1009.436) (-1010.690) (-1008.666) [-1007.652] -- 0:00:09
      844500 -- (-1016.359) (-1007.791) (-1010.331) [-1012.733] * (-1009.089) (-1010.186) [-1008.459] (-1010.077) -- 0:00:09
      845000 -- [-1013.301] (-1007.389) (-1008.692) (-1010.611) * (-1015.103) (-1015.080) [-1007.722] (-1015.190) -- 0:00:09

      Average standard deviation of split frequencies: 0.010030

      845500 -- (-1008.585) (-1008.295) [-1009.609] (-1010.587) * (-1017.914) (-1011.920) [-1009.518] (-1009.462) -- 0:00:09
      846000 -- (-1009.400) (-1011.948) (-1009.225) [-1010.129] * (-1011.872) (-1008.549) (-1007.865) [-1009.344] -- 0:00:09
      846500 -- [-1009.703] (-1007.858) (-1010.243) (-1008.286) * (-1010.119) (-1008.449) [-1007.317] (-1009.740) -- 0:00:09
      847000 -- (-1007.847) (-1007.239) (-1009.677) [-1006.775] * (-1007.343) [-1008.270] (-1008.942) (-1007.803) -- 0:00:09
      847500 -- (-1012.344) (-1008.434) (-1013.952) [-1008.197] * (-1008.275) (-1008.054) (-1007.428) [-1012.421] -- 0:00:09
      848000 -- [-1007.998] (-1010.926) (-1007.358) (-1008.443) * [-1007.887] (-1009.562) (-1007.360) (-1007.719) -- 0:00:09
      848500 -- (-1010.832) (-1009.214) (-1010.010) [-1008.705] * (-1007.995) [-1007.005] (-1008.237) (-1006.558) -- 0:00:09
      849000 -- [-1007.693] (-1008.744) (-1009.954) (-1011.483) * [-1008.283] (-1006.998) (-1008.424) (-1007.780) -- 0:00:09
      849500 -- (-1009.029) (-1009.845) [-1009.364] (-1009.731) * (-1007.380) [-1007.650] (-1015.795) (-1009.121) -- 0:00:09
      850000 -- (-1008.416) (-1009.386) (-1009.260) [-1008.913] * (-1009.264) [-1008.996] (-1007.859) (-1009.126) -- 0:00:09

      Average standard deviation of split frequencies: 0.010233

      850500 -- (-1012.255) (-1011.063) [-1008.583] (-1008.684) * (-1009.736) (-1009.049) [-1007.453] (-1009.113) -- 0:00:09
      851000 -- (-1013.971) (-1010.995) [-1010.726] (-1013.497) * (-1009.350) [-1009.208] (-1007.908) (-1008.258) -- 0:00:09
      851500 -- [-1007.228] (-1009.021) (-1010.580) (-1008.883) * (-1008.213) (-1008.704) (-1007.116) [-1009.611] -- 0:00:09
      852000 -- [-1008.920] (-1008.495) (-1007.654) (-1007.703) * (-1006.994) [-1008.529] (-1009.902) (-1007.851) -- 0:00:09
      852500 -- (-1012.414) (-1007.490) (-1011.675) [-1011.765] * (-1009.192) [-1009.503] (-1008.332) (-1012.703) -- 0:00:09
      853000 -- (-1009.252) [-1007.021] (-1011.611) (-1008.455) * [-1011.706] (-1015.414) (-1010.298) (-1011.954) -- 0:00:09
      853500 -- (-1008.841) (-1008.019) [-1009.388] (-1008.543) * (-1010.087) (-1012.949) (-1008.747) [-1010.577] -- 0:00:09
      854000 -- [-1008.989] (-1009.277) (-1007.543) (-1011.863) * [-1008.701] (-1007.231) (-1008.099) (-1007.031) -- 0:00:09
      854500 -- (-1011.772) (-1010.960) (-1007.475) [-1006.993] * (-1013.456) (-1008.743) [-1008.644] (-1010.790) -- 0:00:09
      855000 -- (-1008.109) [-1007.379] (-1007.443) (-1009.986) * (-1007.989) (-1008.678) [-1008.947] (-1009.211) -- 0:00:08

      Average standard deviation of split frequencies: 0.010133

      855500 -- [-1007.259] (-1008.319) (-1007.352) (-1007.501) * (-1012.149) (-1008.212) [-1008.507] (-1009.804) -- 0:00:08
      856000 -- [-1007.954] (-1008.152) (-1007.183) (-1011.735) * (-1008.875) (-1008.117) [-1010.612] (-1009.231) -- 0:00:09
      856500 -- (-1007.310) (-1010.213) (-1010.783) [-1012.137] * (-1007.664) (-1007.958) [-1007.810] (-1013.254) -- 0:00:09
      857000 -- (-1008.567) (-1009.188) (-1007.258) [-1010.095] * (-1009.337) [-1007.498] (-1007.780) (-1012.124) -- 0:00:09
      857500 -- [-1010.167] (-1008.809) (-1007.211) (-1008.116) * (-1006.911) (-1008.619) (-1008.732) [-1010.019] -- 0:00:08
      858000 -- (-1008.325) [-1007.620] (-1009.601) (-1009.244) * [-1009.731] (-1011.778) (-1010.589) (-1007.331) -- 0:00:08
      858500 -- (-1008.439) (-1007.186) (-1007.822) [-1007.585] * (-1010.129) (-1008.914) (-1009.777) [-1010.329] -- 0:00:08
      859000 -- [-1008.504] (-1008.516) (-1010.015) (-1011.992) * (-1012.393) (-1012.902) (-1006.701) [-1015.378] -- 0:00:08
      859500 -- (-1010.827) (-1013.101) [-1009.286] (-1012.684) * (-1011.738) (-1019.206) [-1009.537] (-1012.634) -- 0:00:08
      860000 -- (-1007.346) [-1007.672] (-1010.854) (-1009.045) * (-1017.426) [-1007.975] (-1008.302) (-1008.165) -- 0:00:08

      Average standard deviation of split frequencies: 0.009603

      860500 -- (-1007.648) (-1007.116) [-1007.827] (-1008.685) * [-1015.898] (-1010.350) (-1007.989) (-1010.475) -- 0:00:08
      861000 -- (-1007.152) (-1007.214) (-1008.061) [-1007.174] * [-1011.768] (-1008.721) (-1007.765) (-1009.529) -- 0:00:08
      861500 -- (-1008.353) [-1006.648] (-1006.777) (-1007.157) * (-1012.359) (-1012.105) [-1007.698] (-1009.960) -- 0:00:08
      862000 -- (-1008.804) (-1007.052) [-1008.548] (-1007.851) * (-1008.133) (-1011.577) [-1009.504] (-1009.421) -- 0:00:08
      862500 -- [-1007.228] (-1010.386) (-1007.855) (-1009.550) * (-1010.382) (-1011.068) [-1010.653] (-1007.894) -- 0:00:08
      863000 -- [-1009.080] (-1011.131) (-1010.819) (-1008.357) * (-1007.214) [-1007.957] (-1007.697) (-1007.098) -- 0:00:08
      863500 -- [-1008.785] (-1013.439) (-1011.353) (-1009.967) * (-1011.718) (-1009.123) (-1017.156) [-1007.208] -- 0:00:08
      864000 -- (-1008.523) (-1009.257) [-1008.299] (-1008.355) * [-1010.429] (-1007.966) (-1007.322) (-1007.705) -- 0:00:08
      864500 -- (-1010.111) (-1008.041) (-1007.323) [-1008.699] * (-1010.960) (-1009.630) [-1007.521] (-1006.809) -- 0:00:08
      865000 -- (-1009.725) (-1008.176) [-1008.238] (-1007.312) * (-1009.175) [-1007.788] (-1011.492) (-1008.072) -- 0:00:08

      Average standard deviation of split frequencies: 0.009726

      865500 -- (-1010.309) [-1010.139] (-1009.564) (-1010.501) * (-1011.502) [-1007.316] (-1006.934) (-1007.939) -- 0:00:08
      866000 -- [-1007.177] (-1008.490) (-1007.849) (-1011.589) * (-1010.829) (-1008.944) (-1007.011) [-1008.788] -- 0:00:08
      866500 -- (-1007.996) [-1007.877] (-1008.901) (-1012.368) * [-1009.726] (-1008.374) (-1010.686) (-1009.996) -- 0:00:08
      867000 -- (-1006.724) (-1009.914) (-1013.023) [-1008.240] * (-1007.536) (-1011.620) [-1011.714] (-1011.417) -- 0:00:08
      867500 -- (-1011.025) [-1010.076] (-1010.149) (-1007.840) * (-1007.005) (-1010.419) [-1009.413] (-1007.786) -- 0:00:08
      868000 -- (-1010.246) (-1010.236) (-1008.176) [-1008.481] * (-1010.129) (-1010.369) (-1009.629) [-1007.115] -- 0:00:08
      868500 -- (-1011.403) (-1009.843) (-1008.406) [-1007.277] * [-1008.729] (-1009.132) (-1007.506) (-1008.834) -- 0:00:08
      869000 -- (-1014.373) [-1010.551] (-1013.080) (-1010.377) * (-1007.785) (-1007.648) [-1009.005] (-1006.802) -- 0:00:08
      869500 -- (-1010.450) (-1010.143) (-1009.773) [-1008.470] * (-1008.395) (-1007.252) [-1008.392] (-1008.570) -- 0:00:08
      870000 -- (-1008.978) [-1009.713] (-1008.601) (-1007.296) * [-1012.535] (-1009.560) (-1007.928) (-1010.609) -- 0:00:08

      Average standard deviation of split frequencies: 0.009890

      870500 -- [-1011.210] (-1009.540) (-1012.485) (-1007.580) * (-1007.420) (-1010.025) (-1009.143) [-1007.849] -- 0:00:08
      871000 -- [-1011.326] (-1009.095) (-1010.014) (-1011.498) * (-1008.350) [-1008.006] (-1011.103) (-1008.665) -- 0:00:07
      871500 -- (-1009.358) [-1009.757] (-1013.245) (-1012.023) * (-1009.345) (-1010.167) (-1009.218) [-1009.869] -- 0:00:07
      872000 -- [-1006.541] (-1008.907) (-1008.342) (-1011.734) * (-1007.363) [-1008.405] (-1011.079) (-1007.096) -- 0:00:07
      872500 -- (-1011.349) (-1011.443) [-1007.240] (-1009.859) * (-1007.454) [-1008.664] (-1009.230) (-1008.250) -- 0:00:08
      873000 -- (-1008.027) [-1009.021] (-1010.349) (-1008.278) * [-1007.630] (-1007.730) (-1009.219) (-1007.235) -- 0:00:08
      873500 -- (-1010.856) (-1013.234) (-1012.605) [-1008.199] * (-1008.429) (-1008.563) [-1014.572] (-1008.064) -- 0:00:07
      874000 -- (-1012.898) (-1009.748) (-1009.095) [-1009.639] * (-1009.844) (-1008.182) [-1013.364] (-1008.561) -- 0:00:07
      874500 -- [-1008.835] (-1007.279) (-1015.335) (-1008.848) * (-1008.066) (-1010.736) (-1018.955) [-1007.988] -- 0:00:07
      875000 -- (-1009.046) [-1009.043] (-1014.750) (-1009.838) * [-1008.854] (-1007.016) (-1009.735) (-1009.196) -- 0:00:07

      Average standard deviation of split frequencies: 0.009830

      875500 -- [-1009.007] (-1007.288) (-1010.577) (-1009.084) * (-1007.940) (-1007.889) (-1009.874) [-1008.184] -- 0:00:07
      876000 -- (-1011.470) [-1007.916] (-1009.343) (-1010.456) * (-1009.862) [-1009.523] (-1008.581) (-1015.463) -- 0:00:07
      876500 -- (-1009.071) [-1007.000] (-1009.780) (-1007.196) * (-1007.434) [-1009.741] (-1011.617) (-1010.628) -- 0:00:07
      877000 -- (-1008.051) (-1011.642) (-1009.358) [-1007.967] * (-1011.371) (-1009.507) [-1007.446] (-1010.371) -- 0:00:07
      877500 -- (-1007.537) (-1010.170) (-1008.584) [-1009.015] * (-1010.853) (-1007.604) (-1007.410) [-1007.049] -- 0:00:07
      878000 -- (-1006.810) (-1011.849) (-1008.396) [-1008.506] * [-1008.814] (-1011.341) (-1007.701) (-1008.554) -- 0:00:07
      878500 -- [-1008.007] (-1010.584) (-1009.527) (-1007.142) * (-1006.939) (-1008.145) (-1009.451) [-1008.709] -- 0:00:07
      879000 -- (-1011.888) (-1008.525) [-1010.091] (-1009.985) * [-1008.849] (-1012.080) (-1011.203) (-1009.221) -- 0:00:07
      879500 -- (-1008.321) (-1007.209) [-1008.019] (-1009.093) * [-1007.263] (-1008.522) (-1016.646) (-1008.803) -- 0:00:07
      880000 -- (-1012.763) [-1011.712] (-1011.042) (-1011.666) * [-1007.787] (-1008.833) (-1012.363) (-1010.204) -- 0:00:07

      Average standard deviation of split frequencies: 0.009457

      880500 -- (-1015.146) [-1011.854] (-1010.648) (-1009.015) * (-1008.641) (-1008.177) (-1007.269) [-1008.279] -- 0:00:07
      881000 -- (-1009.407) (-1006.559) (-1009.245) [-1008.799] * (-1009.485) [-1008.418] (-1007.598) (-1007.141) -- 0:00:07
      881500 -- (-1010.671) [-1008.614] (-1010.397) (-1010.431) * (-1009.238) (-1011.317) [-1007.558] (-1010.390) -- 0:00:07
      882000 -- (-1011.150) (-1009.327) (-1013.614) [-1008.179] * (-1010.582) (-1011.769) (-1011.473) [-1009.997] -- 0:00:07
      882500 -- [-1007.013] (-1007.647) (-1010.353) (-1008.388) * (-1010.128) (-1011.457) [-1009.101] (-1012.941) -- 0:00:07
      883000 -- (-1009.474) (-1009.800) (-1009.644) [-1009.159] * [-1009.622] (-1008.668) (-1011.897) (-1013.311) -- 0:00:07
      883500 -- (-1008.798) (-1009.040) [-1008.897] (-1012.595) * (-1010.616) (-1009.233) (-1010.356) [-1007.221] -- 0:00:07
      884000 -- [-1007.286] (-1007.391) (-1011.548) (-1011.312) * (-1012.265) (-1007.778) (-1008.952) [-1006.940] -- 0:00:07
      884500 -- (-1012.364) [-1007.116] (-1008.270) (-1009.078) * (-1016.218) [-1010.990] (-1007.548) (-1009.149) -- 0:00:07
      885000 -- (-1018.958) (-1007.438) [-1007.776] (-1011.243) * (-1007.570) (-1007.637) [-1007.691] (-1007.912) -- 0:00:07

      Average standard deviation of split frequencies: 0.009683

      885500 -- (-1018.004) (-1007.027) (-1008.226) [-1008.067] * (-1011.030) (-1007.091) [-1009.832] (-1009.342) -- 0:00:07
      886000 -- [-1010.076] (-1011.799) (-1012.570) (-1008.580) * [-1013.605] (-1007.990) (-1007.111) (-1011.148) -- 0:00:07
      886500 -- [-1008.220] (-1007.797) (-1010.158) (-1010.293) * (-1009.382) (-1008.348) (-1008.985) [-1010.579] -- 0:00:07
      887000 -- (-1011.489) [-1009.387] (-1009.673) (-1008.739) * [-1007.060] (-1008.199) (-1009.018) (-1012.255) -- 0:00:07
      887500 -- (-1007.702) (-1011.379) [-1009.522] (-1013.335) * [-1010.026] (-1008.757) (-1008.134) (-1010.112) -- 0:00:06
      888000 -- (-1010.248) [-1008.902] (-1007.627) (-1020.117) * (-1007.279) (-1010.319) [-1008.039] (-1013.664) -- 0:00:06
      888500 -- (-1008.650) (-1008.268) (-1008.079) [-1008.867] * (-1009.021) (-1010.844) [-1007.004] (-1007.997) -- 0:00:06
      889000 -- (-1010.271) [-1009.320] (-1009.444) (-1009.849) * [-1009.900] (-1008.523) (-1011.475) (-1010.996) -- 0:00:06
      889500 -- (-1010.948) (-1007.075) (-1006.935) [-1007.253] * (-1009.228) [-1007.619] (-1008.347) (-1009.294) -- 0:00:06
      890000 -- (-1008.315) (-1007.055) [-1009.560] (-1007.374) * (-1008.810) (-1009.554) (-1007.587) [-1007.290] -- 0:00:06

      Average standard deviation of split frequencies: 0.009668

      890500 -- (-1007.118) (-1007.907) [-1010.384] (-1006.668) * (-1007.688) (-1010.929) (-1010.458) [-1007.038] -- 0:00:06
      891000 -- [-1007.057] (-1008.226) (-1012.936) (-1009.230) * (-1007.601) (-1007.463) (-1010.007) [-1008.842] -- 0:00:06
      891500 -- (-1008.066) (-1012.516) [-1007.092] (-1012.695) * (-1012.341) (-1008.676) [-1008.157] (-1008.174) -- 0:00:06
      892000 -- (-1009.083) (-1009.620) [-1007.136] (-1013.765) * [-1008.117] (-1008.450) (-1010.261) (-1011.848) -- 0:00:06
      892500 -- (-1007.511) (-1008.607) [-1010.177] (-1007.886) * (-1010.103) [-1008.378] (-1013.006) (-1007.985) -- 0:00:06
      893000 -- (-1007.996) [-1008.786] (-1008.315) (-1008.992) * (-1009.697) (-1011.751) [-1010.487] (-1009.559) -- 0:00:06
      893500 -- (-1006.703) [-1008.668] (-1009.250) (-1008.206) * (-1008.570) [-1008.095] (-1007.428) (-1009.853) -- 0:00:06
      894000 -- (-1007.569) (-1009.627) (-1015.797) [-1006.475] * [-1007.277] (-1006.921) (-1008.754) (-1008.385) -- 0:00:06
      894500 -- (-1010.659) (-1009.405) (-1012.547) [-1008.881] * (-1010.763) (-1008.524) [-1008.557] (-1011.945) -- 0:00:06
      895000 -- [-1009.988] (-1008.644) (-1007.681) (-1009.158) * [-1009.183] (-1008.932) (-1008.775) (-1008.947) -- 0:00:06

      Average standard deviation of split frequencies: 0.009435

      895500 -- [-1009.065] (-1009.377) (-1010.594) (-1008.979) * [-1008.387] (-1007.646) (-1007.314) (-1010.123) -- 0:00:06
      896000 -- [-1009.189] (-1009.256) (-1008.281) (-1008.444) * (-1013.118) (-1010.170) [-1009.916] (-1014.344) -- 0:00:06
      896500 -- (-1006.817) (-1008.913) (-1009.051) [-1008.686] * (-1010.137) (-1011.015) [-1007.025] (-1009.040) -- 0:00:06
      897000 -- (-1009.153) (-1008.546) (-1010.314) [-1007.509] * (-1009.708) (-1012.249) [-1008.717] (-1011.164) -- 0:00:06
      897500 -- (-1011.659) (-1009.607) [-1010.433] (-1007.969) * [-1007.008] (-1009.266) (-1009.048) (-1009.198) -- 0:00:06
      898000 -- (-1008.832) (-1010.918) [-1009.517] (-1011.245) * (-1009.323) (-1009.893) (-1007.999) [-1007.421] -- 0:00:06
      898500 -- [-1009.037] (-1008.090) (-1011.457) (-1013.655) * (-1010.327) (-1010.027) (-1008.953) [-1007.601] -- 0:00:06
      899000 -- [-1010.490] (-1007.981) (-1007.680) (-1009.405) * (-1012.458) (-1007.778) (-1008.552) [-1007.138] -- 0:00:06
      899500 -- (-1010.046) [-1008.454] (-1007.649) (-1009.467) * [-1008.615] (-1009.012) (-1007.371) (-1007.321) -- 0:00:06
      900000 -- (-1011.170) [-1011.654] (-1007.987) (-1008.041) * (-1009.087) (-1007.270) [-1011.813] (-1007.796) -- 0:00:06

      Average standard deviation of split frequencies: 0.009247

      900500 -- (-1007.250) (-1007.269) [-1009.413] (-1007.907) * (-1011.885) (-1007.210) [-1010.914] (-1007.023) -- 0:00:06
      901000 -- [-1006.953] (-1008.336) (-1009.261) (-1008.550) * (-1012.201) (-1008.805) [-1010.862] (-1008.847) -- 0:00:06
      901500 -- (-1008.822) (-1007.738) (-1009.987) [-1009.432] * [-1006.971] (-1011.343) (-1010.491) (-1010.014) -- 0:00:06
      902000 -- (-1009.265) (-1006.978) [-1008.660] (-1010.171) * [-1010.040] (-1010.538) (-1011.132) (-1008.816) -- 0:00:06
      902500 -- (-1009.992) [-1006.763] (-1007.787) (-1010.508) * [-1009.609] (-1008.532) (-1009.738) (-1007.556) -- 0:00:06
      903000 -- (-1007.599) (-1007.926) [-1008.482] (-1007.513) * (-1011.421) (-1009.526) (-1008.081) [-1007.438] -- 0:00:06
      903500 -- (-1008.085) (-1007.131) (-1007.222) [-1009.285] * (-1011.273) (-1008.053) (-1007.663) [-1009.760] -- 0:00:05
      904000 -- (-1007.601) (-1007.212) (-1007.368) [-1008.338] * (-1007.754) [-1008.864] (-1008.473) (-1008.106) -- 0:00:05
      904500 -- (-1008.057) [-1007.481] (-1007.920) (-1009.045) * (-1010.787) (-1007.858) (-1007.880) [-1008.004] -- 0:00:05
      905000 -- (-1007.379) (-1007.137) [-1007.856] (-1008.010) * (-1011.978) (-1009.646) [-1010.181] (-1009.708) -- 0:00:05

      Average standard deviation of split frequencies: 0.009262

      905500 -- (-1006.792) (-1010.167) (-1009.920) [-1008.123] * (-1008.494) (-1008.534) (-1010.446) [-1016.927] -- 0:00:05
      906000 -- (-1006.947) [-1011.023] (-1007.372) (-1012.085) * (-1007.967) (-1008.345) [-1007.962] (-1013.383) -- 0:00:05
      906500 -- (-1012.700) (-1010.663) (-1006.983) [-1009.901] * (-1007.949) (-1011.515) [-1010.913] (-1010.347) -- 0:00:05
      907000 -- [-1009.057] (-1010.150) (-1007.256) (-1007.994) * (-1007.454) (-1006.800) (-1007.246) [-1007.283] -- 0:00:05
      907500 -- (-1012.081) (-1008.797) (-1010.205) [-1010.814] * (-1007.729) [-1008.390] (-1007.154) (-1008.996) -- 0:00:05
      908000 -- (-1009.522) (-1008.381) (-1014.819) [-1008.909] * (-1007.360) (-1009.451) (-1009.002) [-1009.526] -- 0:00:05
      908500 -- (-1006.980) (-1007.927) (-1006.966) [-1007.889] * (-1007.319) [-1007.469] (-1009.025) (-1009.575) -- 0:00:05
      909000 -- (-1015.892) (-1016.749) [-1008.197] (-1009.485) * (-1007.434) [-1011.518] (-1015.030) (-1008.565) -- 0:00:05
      909500 -- (-1009.297) (-1008.439) (-1007.947) [-1007.974] * [-1009.801] (-1007.045) (-1010.084) (-1007.359) -- 0:00:05
      910000 -- (-1007.604) (-1010.533) (-1007.612) [-1010.021] * (-1008.075) (-1006.818) [-1006.935] (-1007.424) -- 0:00:05

      Average standard deviation of split frequencies: 0.009559

      910500 -- (-1007.333) (-1007.700) [-1008.583] (-1009.162) * (-1009.160) [-1007.050] (-1008.555) (-1010.885) -- 0:00:05
      911000 -- (-1007.191) (-1009.666) [-1012.466] (-1008.402) * (-1013.346) [-1006.695] (-1007.892) (-1010.835) -- 0:00:05
      911500 -- (-1011.462) [-1009.524] (-1008.692) (-1008.469) * (-1012.129) (-1010.988) [-1007.177] (-1008.443) -- 0:00:05
      912000 -- (-1008.277) [-1011.111] (-1008.430) (-1008.025) * (-1011.015) (-1010.349) (-1007.591) [-1008.011] -- 0:00:05
      912500 -- (-1010.177) [-1010.689] (-1011.841) (-1012.646) * (-1013.602) (-1007.211) (-1007.303) [-1008.503] -- 0:00:05
      913000 -- [-1009.585] (-1007.379) (-1010.100) (-1009.832) * [-1012.842] (-1007.937) (-1012.935) (-1009.253) -- 0:00:05
      913500 -- [-1008.953] (-1008.183) (-1008.246) (-1011.229) * (-1014.093) [-1006.995] (-1009.276) (-1007.621) -- 0:00:05
      914000 -- (-1007.462) [-1010.137] (-1011.853) (-1009.217) * (-1008.158) [-1008.243] (-1007.402) (-1008.297) -- 0:00:05
      914500 -- [-1007.575] (-1009.740) (-1007.432) (-1010.910) * [-1007.801] (-1007.813) (-1007.531) (-1007.261) -- 0:00:05
      915000 -- (-1007.509) [-1007.946] (-1012.310) (-1008.315) * (-1011.689) (-1011.924) [-1009.808] (-1007.584) -- 0:00:05

      Average standard deviation of split frequencies: 0.009847

      915500 -- [-1007.578] (-1008.787) (-1007.791) (-1009.999) * [-1009.480] (-1008.980) (-1008.819) (-1012.991) -- 0:00:05
      916000 -- [-1008.219] (-1009.453) (-1009.207) (-1007.482) * (-1007.615) [-1009.140] (-1013.636) (-1008.362) -- 0:00:05
      916500 -- (-1008.515) [-1010.461] (-1012.055) (-1007.604) * [-1007.525] (-1008.350) (-1009.281) (-1008.945) -- 0:00:05
      917000 -- (-1009.530) (-1010.692) [-1009.956] (-1008.795) * [-1010.987] (-1008.772) (-1007.842) (-1011.487) -- 0:00:05
      917500 -- (-1008.307) [-1007.257] (-1010.212) (-1012.404) * (-1010.575) (-1010.825) (-1012.983) [-1012.872] -- 0:00:05
      918000 -- (-1007.298) [-1010.419] (-1009.769) (-1016.293) * (-1009.604) (-1006.944) (-1011.389) [-1008.344] -- 0:00:05
      918500 -- [-1009.996] (-1008.547) (-1009.332) (-1015.017) * (-1009.042) (-1007.078) (-1008.143) [-1008.056] -- 0:00:05
      919000 -- (-1013.264) (-1009.807) [-1008.045] (-1014.599) * (-1008.781) (-1007.578) (-1008.931) [-1008.603] -- 0:00:05
      919500 -- [-1007.642] (-1009.394) (-1008.160) (-1010.974) * [-1015.649] (-1010.478) (-1007.416) (-1010.456) -- 0:00:04
      920000 -- [-1008.831] (-1007.817) (-1009.201) (-1008.564) * (-1008.422) (-1006.816) (-1009.755) [-1008.402] -- 0:00:04

      Average standard deviation of split frequencies: 0.009490

      920500 -- (-1008.136) (-1008.728) (-1008.344) [-1009.885] * (-1009.528) (-1008.418) (-1008.218) [-1009.046] -- 0:00:04
      921000 -- (-1011.847) (-1011.989) [-1008.696] (-1013.089) * (-1008.372) [-1010.471] (-1007.341) (-1010.130) -- 0:00:04
      921500 -- (-1010.108) (-1009.843) [-1006.879] (-1009.557) * (-1008.986) (-1009.652) (-1007.981) [-1010.451] -- 0:00:04
      922000 -- [-1008.914] (-1009.114) (-1012.458) (-1015.145) * (-1007.037) (-1010.270) (-1008.336) [-1007.051] -- 0:00:04
      922500 -- (-1007.846) [-1008.366] (-1009.374) (-1009.606) * [-1008.388] (-1009.074) (-1008.748) (-1010.013) -- 0:00:04
      923000 -- [-1007.794] (-1007.412) (-1009.824) (-1013.513) * [-1007.043] (-1011.198) (-1007.258) (-1011.456) -- 0:00:04
      923500 -- (-1008.753) (-1008.439) (-1011.643) [-1007.802] * [-1007.881] (-1010.846) (-1006.835) (-1013.400) -- 0:00:04
      924000 -- (-1006.821) (-1012.489) [-1008.336] (-1009.630) * (-1010.927) (-1012.880) [-1008.657] (-1010.577) -- 0:00:04
      924500 -- [-1007.008] (-1013.387) (-1008.518) (-1009.893) * (-1010.749) [-1007.004] (-1018.464) (-1010.101) -- 0:00:04
      925000 -- (-1010.228) [-1008.405] (-1007.812) (-1009.478) * (-1007.801) (-1008.011) [-1008.130] (-1010.315) -- 0:00:04

      Average standard deviation of split frequencies: 0.009163

      925500 -- (-1008.465) [-1007.917] (-1007.952) (-1008.968) * (-1008.323) (-1008.080) (-1008.617) [-1007.135] -- 0:00:04
      926000 -- (-1009.501) (-1009.317) [-1011.445] (-1009.074) * (-1008.510) [-1008.266] (-1007.954) (-1011.459) -- 0:00:04
      926500 -- (-1009.295) [-1011.761] (-1008.159) (-1008.730) * (-1008.878) [-1009.034] (-1010.369) (-1008.399) -- 0:00:04
      927000 -- (-1009.363) (-1008.771) [-1008.150] (-1008.937) * [-1009.164] (-1010.005) (-1009.355) (-1007.138) -- 0:00:04
      927500 -- (-1008.188) (-1008.855) [-1009.069] (-1008.945) * (-1007.330) [-1011.492] (-1007.224) (-1007.738) -- 0:00:04
      928000 -- (-1008.500) (-1008.017) [-1010.150] (-1015.257) * (-1008.550) (-1010.754) [-1009.492] (-1007.754) -- 0:00:04
      928500 -- (-1008.047) (-1009.538) [-1008.017] (-1015.531) * [-1009.362] (-1011.399) (-1009.537) (-1007.508) -- 0:00:04
      929000 -- (-1007.226) (-1008.687) [-1007.564] (-1008.690) * (-1009.566) (-1007.836) [-1010.004] (-1007.856) -- 0:00:04
      929500 -- (-1007.590) [-1008.578] (-1010.235) (-1010.601) * (-1007.944) (-1010.600) [-1008.223] (-1008.594) -- 0:00:04
      930000 -- (-1013.309) [-1008.839] (-1009.063) (-1008.350) * (-1009.176) (-1010.038) [-1008.812] (-1008.953) -- 0:00:04

      Average standard deviation of split frequencies: 0.009421

      930500 -- (-1008.276) (-1009.421) (-1009.165) [-1008.623] * (-1010.046) (-1007.327) [-1008.163] (-1007.818) -- 0:00:04
      931000 -- [-1007.183] (-1007.600) (-1009.184) (-1008.987) * (-1008.389) (-1009.271) (-1008.081) [-1007.625] -- 0:00:04
      931500 -- (-1011.962) [-1009.248] (-1008.535) (-1008.239) * (-1007.276) (-1009.663) [-1006.533] (-1011.551) -- 0:00:04
      932000 -- (-1009.020) [-1009.076] (-1011.585) (-1009.175) * (-1010.277) [-1008.968] (-1012.523) (-1010.737) -- 0:00:04
      932500 -- (-1011.492) [-1007.935] (-1008.285) (-1008.266) * (-1010.695) (-1010.079) [-1008.101] (-1008.070) -- 0:00:04
      933000 -- (-1008.356) [-1007.189] (-1008.011) (-1008.834) * (-1007.393) (-1010.463) [-1007.534] (-1008.057) -- 0:00:04
      933500 -- (-1008.725) [-1008.439] (-1011.023) (-1008.249) * [-1008.428] (-1007.773) (-1008.657) (-1013.741) -- 0:00:04
      934000 -- (-1008.690) (-1010.316) [-1008.584] (-1007.773) * [-1011.714] (-1011.141) (-1007.924) (-1009.596) -- 0:00:04
      934500 -- (-1014.080) (-1008.110) (-1006.766) [-1007.992] * (-1011.471) (-1009.074) (-1009.366) [-1008.532] -- 0:00:04
      935000 -- (-1010.802) [-1006.819] (-1012.728) (-1007.911) * (-1009.215) (-1007.713) (-1012.168) [-1010.101] -- 0:00:04

      Average standard deviation of split frequencies: 0.009233

      935500 -- (-1009.605) [-1006.676] (-1011.041) (-1010.461) * (-1011.063) [-1008.265] (-1012.251) (-1009.523) -- 0:00:03
      936000 -- (-1007.482) (-1011.316) [-1009.705] (-1008.068) * [-1007.649] (-1010.370) (-1007.915) (-1008.641) -- 0:00:03
      936500 -- (-1007.673) [-1013.604] (-1009.626) (-1009.201) * (-1010.686) (-1007.562) [-1007.030] (-1010.237) -- 0:00:03
      937000 -- [-1008.398] (-1008.446) (-1008.451) (-1007.340) * (-1012.855) (-1011.721) (-1008.555) [-1009.269] -- 0:00:03
      937500 -- (-1007.063) (-1008.214) [-1007.807] (-1008.654) * [-1008.204] (-1009.132) (-1007.805) (-1009.810) -- 0:00:03
      938000 -- (-1008.521) (-1007.948) [-1008.391] (-1008.714) * (-1007.724) [-1009.031] (-1009.772) (-1008.115) -- 0:00:03
      938500 -- [-1008.870] (-1007.664) (-1008.749) (-1007.625) * (-1007.922) [-1009.041] (-1011.815) (-1008.250) -- 0:00:03
      939000 -- (-1007.887) (-1007.562) (-1006.961) [-1009.434] * [-1008.735] (-1007.274) (-1007.785) (-1006.606) -- 0:00:03
      939500 -- (-1011.132) [-1007.521] (-1010.882) (-1008.156) * (-1010.104) (-1007.543) (-1006.882) [-1007.806] -- 0:00:03
      940000 -- (-1007.573) (-1011.212) [-1011.481] (-1008.350) * (-1011.114) (-1007.480) (-1010.470) [-1008.389] -- 0:00:03

      Average standard deviation of split frequencies: 0.009321

      940500 -- (-1008.210) (-1007.585) (-1009.579) [-1007.357] * (-1011.937) [-1007.141] (-1011.960) (-1007.654) -- 0:00:03
      941000 -- (-1009.876) [-1007.428] (-1009.146) (-1009.585) * (-1007.687) [-1006.522] (-1008.466) (-1007.883) -- 0:00:03
      941500 -- [-1008.480] (-1010.234) (-1009.205) (-1008.124) * (-1009.340) [-1007.017] (-1007.407) (-1007.805) -- 0:00:03
      942000 -- (-1008.801) (-1011.910) (-1010.517) [-1008.258] * (-1010.234) (-1009.949) [-1008.357] (-1007.968) -- 0:00:03
      942500 -- (-1009.807) [-1009.780] (-1011.462) (-1007.883) * (-1015.689) (-1008.037) (-1011.645) [-1011.389] -- 0:00:03
      943000 -- [-1008.078] (-1007.626) (-1010.989) (-1008.103) * [-1008.684] (-1009.082) (-1010.014) (-1008.736) -- 0:00:03
      943500 -- (-1008.930) [-1008.447] (-1012.939) (-1007.492) * [-1008.300] (-1008.750) (-1009.356) (-1007.773) -- 0:00:03
      944000 -- (-1007.025) (-1008.824) (-1007.335) [-1008.203] * [-1009.219] (-1008.337) (-1013.009) (-1010.778) -- 0:00:03
      944500 -- (-1009.995) [-1009.864] (-1007.307) (-1010.422) * (-1010.083) [-1010.491] (-1007.350) (-1011.456) -- 0:00:03
      945000 -- [-1009.124] (-1009.006) (-1008.138) (-1009.576) * [-1007.294] (-1008.330) (-1007.338) (-1011.113) -- 0:00:03

      Average standard deviation of split frequencies: 0.009103

      945500 -- [-1008.013] (-1008.040) (-1009.766) (-1007.654) * [-1008.109] (-1009.310) (-1008.199) (-1008.079) -- 0:00:03
      946000 -- (-1007.792) [-1008.563] (-1008.698) (-1008.284) * (-1010.509) (-1011.362) [-1008.813] (-1009.719) -- 0:00:03
      946500 -- (-1007.512) [-1007.738] (-1009.893) (-1008.053) * (-1012.418) (-1008.137) [-1010.401] (-1008.453) -- 0:00:03
      947000 -- (-1012.738) (-1009.792) (-1012.632) [-1008.513] * (-1009.247) [-1008.803] (-1007.440) (-1008.926) -- 0:00:03
      947500 -- (-1010.127) (-1008.340) (-1008.583) [-1008.054] * (-1009.206) (-1008.679) (-1008.608) [-1008.061] -- 0:00:03
      948000 -- (-1007.424) (-1011.354) [-1012.498] (-1008.571) * (-1008.203) (-1011.691) [-1008.167] (-1007.631) -- 0:00:03
      948500 -- (-1010.794) (-1006.731) [-1010.337] (-1010.962) * (-1008.028) (-1009.519) [-1008.443] (-1008.343) -- 0:00:03
      949000 -- (-1010.833) [-1007.307] (-1007.887) (-1009.237) * (-1008.971) (-1011.107) [-1007.782] (-1006.622) -- 0:00:03
      949500 -- (-1009.276) (-1011.525) [-1009.359] (-1011.747) * (-1011.058) (-1008.659) (-1007.012) [-1007.444] -- 0:00:03
      950000 -- [-1008.216] (-1009.444) (-1013.434) (-1010.060) * (-1008.171) [-1008.612] (-1007.001) (-1007.262) -- 0:00:03

      Average standard deviation of split frequencies: 0.008992

      950500 -- (-1008.014) (-1010.746) (-1009.659) [-1009.045] * (-1011.594) (-1011.490) [-1007.082] (-1011.400) -- 0:00:03
      951000 -- (-1009.024) [-1009.199] (-1009.256) (-1016.942) * (-1010.167) (-1011.536) (-1009.739) [-1009.691] -- 0:00:03
      951500 -- (-1009.428) (-1008.826) [-1008.876] (-1010.860) * [-1009.659] (-1008.665) (-1010.160) (-1008.093) -- 0:00:03
      952000 -- (-1011.520) (-1011.421) [-1010.581] (-1007.949) * [-1009.764] (-1010.401) (-1008.118) (-1010.429) -- 0:00:02
      952500 -- (-1011.228) (-1009.345) [-1010.249] (-1007.912) * [-1007.632] (-1008.562) (-1009.007) (-1007.740) -- 0:00:02
      953000 -- [-1011.342] (-1008.005) (-1008.170) (-1012.661) * (-1008.401) (-1007.958) (-1009.532) [-1007.689] -- 0:00:02
      953500 -- (-1010.201) (-1007.105) (-1008.816) [-1007.456] * [-1011.746] (-1012.106) (-1010.358) (-1008.557) -- 0:00:02
      954000 -- (-1010.820) (-1008.205) (-1008.027) [-1008.932] * (-1011.800) (-1012.459) (-1011.170) [-1008.074] -- 0:00:02
      954500 -- (-1009.762) (-1008.696) [-1008.470] (-1007.271) * [-1008.833] (-1007.952) (-1009.731) (-1008.177) -- 0:00:02
      955000 -- (-1009.864) [-1009.709] (-1010.534) (-1007.229) * [-1009.885] (-1011.262) (-1009.006) (-1011.248) -- 0:00:02

      Average standard deviation of split frequencies: 0.008974

      955500 -- (-1007.705) [-1007.630] (-1011.317) (-1012.317) * (-1009.657) (-1010.037) (-1007.808) [-1008.731] -- 0:00:02
      956000 -- (-1008.931) (-1008.420) (-1009.418) [-1008.862] * [-1010.195] (-1009.833) (-1013.053) (-1007.963) -- 0:00:02
      956500 -- [-1011.504] (-1008.056) (-1008.449) (-1009.506) * (-1011.160) [-1008.943] (-1012.606) (-1006.887) -- 0:00:02
      957000 -- (-1007.758) [-1006.657] (-1006.998) (-1009.389) * [-1007.860] (-1007.925) (-1011.320) (-1007.218) -- 0:00:02
      957500 -- [-1008.286] (-1007.500) (-1007.797) (-1013.116) * [-1010.876] (-1008.080) (-1012.574) (-1007.216) -- 0:00:02
      958000 -- [-1007.609] (-1009.705) (-1009.785) (-1009.140) * (-1008.463) (-1007.452) [-1007.230] (-1009.503) -- 0:00:02
      958500 -- [-1007.609] (-1010.266) (-1007.941) (-1007.304) * (-1007.595) (-1011.576) (-1008.297) [-1011.063] -- 0:00:02
      959000 -- [-1011.096] (-1007.970) (-1006.953) (-1008.369) * (-1007.606) [-1010.990] (-1007.835) (-1010.716) -- 0:00:02
      959500 -- (-1009.251) (-1008.238) (-1007.239) [-1013.739] * (-1009.362) (-1008.825) [-1007.627] (-1009.575) -- 0:00:02
      960000 -- (-1008.548) [-1009.359] (-1006.814) (-1008.103) * (-1009.939) (-1011.772) (-1012.815) [-1008.172] -- 0:00:02

      Average standard deviation of split frequencies: 0.008767

      960500 -- [-1007.040] (-1009.714) (-1009.872) (-1009.567) * (-1008.124) (-1007.968) [-1007.871] (-1007.729) -- 0:00:02
      961000 -- (-1007.996) (-1007.799) (-1013.689) [-1008.977] * [-1008.280] (-1007.263) (-1011.853) (-1009.709) -- 0:00:02
      961500 -- (-1010.453) (-1008.191) [-1008.654] (-1009.609) * (-1011.270) (-1007.263) (-1014.146) [-1007.217] -- 0:00:02
      962000 -- [-1008.656] (-1007.910) (-1010.386) (-1007.471) * (-1011.863) (-1008.672) (-1009.335) [-1007.106] -- 0:00:02
      962500 -- [-1009.609] (-1008.716) (-1012.602) (-1006.802) * (-1014.341) [-1008.700] (-1009.701) (-1008.022) -- 0:00:02
      963000 -- (-1007.252) [-1009.797] (-1011.739) (-1008.090) * [-1008.694] (-1008.872) (-1007.890) (-1008.220) -- 0:00:02
      963500 -- [-1008.980] (-1009.305) (-1008.908) (-1007.410) * (-1009.229) [-1010.331] (-1008.659) (-1009.342) -- 0:00:02
      964000 -- (-1008.985) (-1008.275) [-1009.214] (-1007.124) * [-1009.902] (-1007.322) (-1009.697) (-1008.915) -- 0:00:02
      964500 -- (-1007.223) [-1007.057] (-1010.152) (-1007.342) * [-1008.383] (-1007.550) (-1009.273) (-1008.414) -- 0:00:02
      965000 -- (-1014.923) (-1014.454) [-1008.083] (-1007.214) * (-1008.403) [-1007.191] (-1007.695) (-1007.304) -- 0:00:02

      Average standard deviation of split frequencies: 0.008589

      965500 -- [-1010.768] (-1007.325) (-1009.310) (-1009.959) * (-1008.034) (-1007.649) (-1009.304) [-1007.623] -- 0:00:02
      966000 -- (-1008.638) (-1007.127) (-1012.058) [-1012.434] * (-1009.096) (-1008.313) (-1008.765) [-1008.649] -- 0:00:02
      966500 -- (-1011.936) [-1007.074] (-1007.236) (-1015.908) * [-1008.486] (-1010.385) (-1008.639) (-1008.651) -- 0:00:02
      967000 -- (-1008.392) [-1007.863] (-1007.623) (-1009.333) * [-1009.925] (-1009.629) (-1008.065) (-1010.973) -- 0:00:02
      967500 -- (-1012.421) [-1006.773] (-1008.233) (-1009.267) * [-1008.150] (-1008.234) (-1007.365) (-1011.683) -- 0:00:02
      968000 -- (-1011.814) [-1007.113] (-1008.808) (-1010.378) * [-1009.554] (-1007.760) (-1013.284) (-1008.482) -- 0:00:01
      968500 -- (-1012.256) (-1008.352) [-1006.812] (-1007.778) * (-1006.820) (-1009.076) (-1010.059) [-1008.326] -- 0:00:01
      969000 -- (-1007.765) (-1009.876) (-1011.844) [-1008.038] * [-1008.258] (-1009.851) (-1011.121) (-1008.034) -- 0:00:01
      969500 -- (-1010.390) (-1010.903) (-1010.642) [-1008.571] * (-1007.963) (-1010.299) (-1013.790) [-1010.752] -- 0:00:01
      970000 -- [-1012.835] (-1011.847) (-1009.408) (-1011.537) * [-1007.088] (-1008.934) (-1011.619) (-1007.673) -- 0:00:01

      Average standard deviation of split frequencies: 0.008677

      970500 -- (-1007.143) (-1007.727) [-1007.293] (-1009.989) * (-1007.606) (-1010.150) (-1007.765) [-1007.600] -- 0:00:01
      971000 -- (-1008.896) (-1008.116) [-1007.087] (-1011.713) * [-1008.335] (-1010.088) (-1016.543) (-1011.972) -- 0:00:01
      971500 -- [-1009.034] (-1010.852) (-1009.756) (-1007.763) * [-1009.496] (-1013.250) (-1013.065) (-1012.099) -- 0:00:01
      972000 -- (-1007.117) (-1010.394) (-1012.004) [-1014.262] * (-1009.829) [-1009.534] (-1011.119) (-1008.653) -- 0:00:01
      972500 -- [-1012.264] (-1009.826) (-1010.039) (-1010.043) * (-1009.621) (-1008.883) [-1010.836] (-1007.409) -- 0:00:01
      973000 -- [-1008.056] (-1008.481) (-1010.883) (-1007.335) * (-1009.794) [-1010.159] (-1007.397) (-1007.901) -- 0:00:01
      973500 -- (-1008.599) [-1007.067] (-1009.155) (-1008.608) * (-1010.475) (-1015.472) (-1008.113) [-1010.336] -- 0:00:01
      974000 -- (-1009.522) (-1010.407) (-1011.049) [-1012.598] * (-1009.245) [-1010.008] (-1012.893) (-1007.376) -- 0:00:01
      974500 -- (-1007.487) (-1007.931) (-1012.685) [-1011.208] * (-1008.489) (-1009.391) (-1009.712) [-1009.067] -- 0:00:01
      975000 -- (-1006.580) [-1007.447] (-1006.899) (-1009.233) * (-1008.281) [-1008.012] (-1013.816) (-1007.887) -- 0:00:01

      Average standard deviation of split frequencies: 0.008726

      975500 -- (-1008.316) (-1010.268) (-1009.179) [-1010.421] * (-1007.960) [-1009.484] (-1017.445) (-1009.347) -- 0:00:01
      976000 -- (-1011.777) (-1016.606) (-1006.988) [-1010.053] * (-1008.265) [-1007.138] (-1017.720) (-1009.073) -- 0:00:01
      976500 -- (-1007.277) (-1009.263) [-1008.450] (-1014.570) * (-1007.765) [-1009.295] (-1011.142) (-1008.238) -- 0:00:01
      977000 -- [-1007.413] (-1007.898) (-1008.822) (-1009.035) * (-1007.159) [-1007.602] (-1011.723) (-1009.084) -- 0:00:01
      977500 -- (-1008.637) (-1008.827) [-1006.854] (-1008.512) * (-1008.528) (-1007.418) [-1008.647] (-1008.160) -- 0:00:01
      978000 -- (-1012.289) (-1012.895) [-1007.191] (-1007.730) * (-1006.873) (-1009.134) [-1007.700] (-1007.907) -- 0:00:01
      978500 -- (-1007.532) (-1010.276) [-1009.671] (-1008.078) * (-1009.289) [-1008.149] (-1011.846) (-1009.554) -- 0:00:01
      979000 -- [-1010.909] (-1007.732) (-1009.543) (-1010.278) * (-1010.966) (-1009.030) (-1007.638) [-1008.895] -- 0:00:01
      979500 -- (-1008.844) (-1009.596) (-1008.346) [-1006.533] * [-1008.764] (-1009.514) (-1007.485) (-1008.913) -- 0:00:01
      980000 -- (-1014.612) [-1007.513] (-1010.754) (-1010.695) * (-1009.151) [-1010.099] (-1009.299) (-1009.231) -- 0:00:01

      Average standard deviation of split frequencies: 0.008588

      980500 -- (-1009.247) [-1007.229] (-1007.875) (-1007.510) * (-1006.682) [-1009.330] (-1010.414) (-1009.262) -- 0:00:01
      981000 -- (-1010.337) [-1007.250] (-1007.493) (-1014.853) * (-1007.310) (-1007.675) (-1007.391) [-1008.469] -- 0:00:01
      981500 -- (-1012.573) (-1008.301) [-1009.746] (-1010.859) * [-1009.731] (-1008.049) (-1012.581) (-1009.030) -- 0:00:01
      982000 -- (-1012.242) (-1009.256) [-1012.485] (-1009.531) * (-1010.468) (-1007.709) (-1014.481) [-1007.339] -- 0:00:01
      982500 -- [-1007.170] (-1008.808) (-1012.490) (-1015.463) * (-1011.040) (-1013.853) (-1010.539) [-1007.341] -- 0:00:01
      983000 -- [-1007.852] (-1009.029) (-1010.596) (-1008.903) * (-1008.547) (-1012.251) (-1016.661) [-1006.528] -- 0:00:01
      983500 -- [-1006.930] (-1007.924) (-1008.768) (-1007.903) * (-1007.595) [-1009.608] (-1015.664) (-1007.888) -- 0:00:01
      984000 -- [-1006.869] (-1009.267) (-1007.250) (-1009.666) * (-1009.299) (-1009.546) [-1009.836] (-1008.075) -- 0:00:01
      984500 -- (-1008.175) (-1007.928) [-1007.330] (-1008.892) * (-1009.084) (-1010.555) (-1009.960) [-1009.030] -- 0:00:00
      985000 -- [-1009.492] (-1008.444) (-1009.460) (-1008.499) * (-1007.913) (-1009.273) (-1007.948) [-1008.355] -- 0:00:00

      Average standard deviation of split frequencies: 0.008829

      985500 -- (-1009.311) [-1008.415] (-1007.604) (-1010.283) * (-1009.232) [-1007.154] (-1007.952) (-1008.314) -- 0:00:00
      986000 -- (-1009.843) [-1008.444] (-1010.265) (-1007.733) * (-1009.196) (-1007.424) [-1008.214] (-1008.272) -- 0:00:00
      986500 -- (-1011.950) (-1009.797) (-1011.616) [-1008.077] * (-1008.215) (-1010.167) [-1007.122] (-1007.472) -- 0:00:00
      987000 -- (-1008.575) (-1008.940) (-1011.759) [-1007.443] * (-1007.796) (-1009.376) [-1008.809] (-1008.182) -- 0:00:00
      987500 -- [-1009.765] (-1008.980) (-1007.096) (-1006.929) * (-1009.675) [-1007.118] (-1011.126) (-1008.618) -- 0:00:00
      988000 -- (-1009.683) (-1012.022) (-1007.097) [-1007.139] * [-1007.535] (-1008.405) (-1008.851) (-1010.750) -- 0:00:00
      988500 -- [-1006.577] (-1008.482) (-1009.436) (-1010.695) * [-1007.669] (-1010.459) (-1008.646) (-1010.286) -- 0:00:00
      989000 -- (-1008.515) (-1008.679) [-1008.187] (-1010.390) * [-1008.892] (-1008.094) (-1008.589) (-1009.564) -- 0:00:00
      989500 -- (-1007.296) (-1008.206) (-1007.552) [-1012.756] * [-1008.519] (-1009.755) (-1009.168) (-1010.878) -- 0:00:00
      990000 -- (-1007.749) (-1010.328) (-1009.901) [-1007.146] * [-1009.623] (-1009.912) (-1006.935) (-1013.196) -- 0:00:00

      Average standard deviation of split frequencies: 0.009073

      990500 -- (-1009.029) (-1012.542) [-1007.068] (-1007.653) * [-1007.630] (-1009.039) (-1007.696) (-1011.978) -- 0:00:00
      991000 -- [-1007.618] (-1008.973) (-1007.529) (-1008.505) * [-1007.350] (-1011.306) (-1009.809) (-1012.195) -- 0:00:00
      991500 -- (-1006.853) (-1007.155) (-1008.854) [-1006.969] * (-1008.749) (-1011.229) (-1009.153) [-1007.783] -- 0:00:00
      992000 -- (-1013.662) [-1007.249] (-1012.443) (-1008.097) * (-1008.253) (-1007.965) [-1008.288] (-1011.391) -- 0:00:00
      992500 -- [-1011.344] (-1008.407) (-1011.830) (-1006.823) * (-1013.564) (-1007.895) (-1008.131) [-1007.818] -- 0:00:00
      993000 -- [-1011.748] (-1011.745) (-1010.049) (-1007.138) * (-1007.864) (-1010.067) [-1007.482] (-1008.061) -- 0:00:00
      993500 -- (-1008.547) [-1008.843] (-1009.493) (-1008.959) * (-1010.676) (-1007.205) [-1008.488] (-1007.857) -- 0:00:00
      994000 -- (-1008.122) (-1009.845) [-1008.808] (-1015.416) * (-1010.485) [-1009.668] (-1009.464) (-1007.342) -- 0:00:00
      994500 -- (-1008.494) (-1009.521) [-1010.586] (-1009.931) * (-1007.173) (-1012.891) [-1010.226] (-1007.944) -- 0:00:00
      995000 -- [-1007.286] (-1009.566) (-1007.474) (-1010.126) * [-1007.913] (-1012.134) (-1009.256) (-1008.325) -- 0:00:00

      Average standard deviation of split frequencies: 0.008803

      995500 -- (-1007.339) [-1011.649] (-1007.556) (-1008.981) * (-1010.288) [-1009.834] (-1008.455) (-1012.449) -- 0:00:00
      996000 -- (-1008.869) (-1010.695) [-1007.652] (-1009.027) * (-1013.037) [-1015.068] (-1009.605) (-1008.846) -- 0:00:00
      996500 -- (-1007.667) [-1008.960] (-1008.061) (-1009.137) * (-1009.350) [-1007.857] (-1009.044) (-1011.800) -- 0:00:00
      997000 -- (-1008.909) (-1007.496) (-1007.980) [-1007.833] * (-1009.723) (-1007.105) (-1007.185) [-1007.774] -- 0:00:00
      997500 -- (-1011.679) (-1008.357) [-1010.164] (-1011.152) * (-1009.001) [-1008.432] (-1007.605) (-1007.094) -- 0:00:00
      998000 -- (-1011.759) (-1011.766) (-1012.149) [-1009.082] * [-1009.247] (-1007.356) (-1006.885) (-1008.583) -- 0:00:00
      998500 -- (-1012.460) (-1006.856) [-1008.581] (-1008.708) * (-1009.561) (-1009.300) (-1006.746) [-1008.338] -- 0:00:00
      999000 -- (-1011.708) (-1006.815) [-1009.132] (-1008.877) * (-1013.525) (-1009.753) [-1007.360] (-1009.849) -- 0:00:00
      999500 -- (-1013.699) (-1009.268) [-1008.334] (-1007.802) * [-1010.516] (-1008.456) (-1007.256) (-1011.158) -- 0:00:00
      1000000 -- (-1011.446) (-1007.582) (-1008.878) [-1010.045] * [-1009.978] (-1008.159) (-1008.059) (-1008.747) -- 0:00:00

      Average standard deviation of split frequencies: 0.009359

      Analysis completed in 1 mins 3 seconds
      Analysis used 61.58 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1006.44
      Likelihood of best state for "cold" chain of run 2 was -1006.44

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            75.6 %     ( 62 %)     Dirichlet(Revmat{all})
            99.9 %     ( 99 %)     Slider(Revmat{all})
            27.1 %     ( 21 %)     Dirichlet(Pi{all})
            29.4 %     ( 24 %)     Slider(Pi{all})
            78.6 %     ( 46 %)     Multiplier(Alpha{1,2})
            78.2 %     ( 59 %)     Multiplier(Alpha{3})
            20.7 %     ( 19 %)     Slider(Pinvar{all})
            98.7 %     ( 96 %)     ExtSPR(Tau{all},V{all})
            70.2 %     ( 72 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.5 %     ( 91 %)     ParsSPR(Tau{all},V{all})
            28.2 %     ( 23 %)     Multiplier(V{all})
            97.4 %     ( 97 %)     Nodeslider(V{all})
            30.4 %     ( 33 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            75.2 %     ( 66 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            27.5 %     ( 29 %)     Dirichlet(Pi{all})
            30.1 %     ( 22 %)     Slider(Pi{all})
            78.8 %     ( 60 %)     Multiplier(Alpha{1,2})
            77.9 %     ( 52 %)     Multiplier(Alpha{3})
            20.4 %     ( 32 %)     Slider(Pinvar{all})
            98.6 %     ( 96 %)     ExtSPR(Tau{all},V{all})
            70.4 %     ( 69 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.5 %     ( 87 %)     ParsSPR(Tau{all},V{all})
            28.1 %     ( 28 %)     Multiplier(V{all})
            97.4 %     ( 96 %)     Nodeslider(V{all})
            30.7 %     ( 18 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166806            0.82    0.67 
         3 |  166635  166607            0.84 
         4 |  166470  166610  166872         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166081            0.82    0.67 
         3 |  166679  166884            0.84 
         4 |  166432  166679  167245         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -1008.21
      |                              2    1     21        2      1 |
      |                       1               2                  2 |
      |                2  111                                 2    |
      |  112 1  1 1     1      22            1         1           |
      |      2               1   2  2 1    11   1  1     1  121   2|
      |     2  1  22 2  2   2     * 1 2     2     1     121  1 2  1|
      |2 2                 2           12      2  2 2**            |
      |    1  1  *    2  1    21       2            1           2  |
      |              11  2              11 2       2       12  11  |
      |     1  2   1   1         1 * 1    2   1         2  2       |
      |12       2   *                            2                 |
      |   2               2  2  1            2                     |
      |                                                            |
      | 1                                2     1                   |
      |       2                                        2           |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1009.86
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1008.14         -1011.08
        2      -1008.15         -1011.64
      --------------------------------------
      TOTAL    -1008.15         -1011.40
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.892381    0.087024    0.371087    1.471015    0.860947   1501.00   1501.00    1.000
      r(A<->C){all}   0.163758    0.020486    0.000031    0.465426    0.126773     96.55    173.30    1.003
      r(A<->G){all}   0.178784    0.021452    0.000076    0.464542    0.138304    112.74    156.09    1.000
      r(A<->T){all}   0.162939    0.020033    0.000145    0.454404    0.121681    101.46    134.51    1.008
      r(C<->G){all}   0.167028    0.021859    0.000027    0.475773    0.123339    165.38    230.79    1.000
      r(C<->T){all}   0.162384    0.020731    0.000032    0.458304    0.120614    168.66    183.90    1.010
      r(G<->T){all}   0.165106    0.019836    0.000354    0.448175    0.125252    205.47    288.83    1.002
      pi(A){all}      0.215222    0.000228    0.188876    0.246685    0.214923   1330.99   1404.25    1.001
      pi(C){all}      0.276730    0.000257    0.244619    0.308080    0.276846   1266.75   1271.80    1.001
      pi(G){all}      0.331115    0.000284    0.298472    0.365147    0.330630   1314.64   1368.83    1.000
      pi(T){all}      0.176934    0.000205    0.150090    0.205454    0.176736   1225.67   1293.22    1.000
      alpha{1,2}      0.428076    0.237010    0.000141    1.428335    0.265852   1169.45   1307.66    1.000
      alpha{3}        0.448949    0.222485    0.000130    1.402621    0.297875   1362.39   1374.85    1.000
      pinvar{all}     0.997929    0.000006    0.993294    0.999999    0.998719   1246.19   1331.24    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6

   Key to taxon bipartitions (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------
    1 -- .*****
    2 -- .*....
    3 -- ..*...
    4 -- ...*..
    5 -- ....*.
    6 -- .....*
    7 -- .****.
    8 -- ...*.*
    9 -- ..*.*.
   10 -- .*..*.
   11 -- ..*..*
   12 -- .*...*
   13 -- .**.**
   14 -- ....**
   15 -- .*.*..
   16 -- ...**.
   17 -- .***.*
   18 -- ..**..
   19 -- .*.***
   20 -- .**...
   21 -- ..****
   ------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    7   468    0.155896    0.010364    0.148568    0.163225    2
    8   464    0.154564    0.000000    0.154564    0.154564    2
    9   462    0.153897    0.014133    0.143904    0.163891    2
   10   448    0.149234    0.021670    0.133911    0.164557    2
   11   436    0.145237    0.015075    0.134577    0.155896    2
   12   432    0.143904    0.015075    0.133245    0.154564    2
   13   431    0.143571    0.002355    0.141905    0.145237    2
   14   427    0.142239    0.006124    0.137908    0.146569    2
   15   423    0.140906    0.004240    0.137908    0.143904    2
   16   423    0.140906    0.002355    0.139241    0.142572    2
   17   415    0.138241    0.008951    0.131912    0.144570    2
   18   413    0.137575    0.010835    0.129913    0.145237    2
   19   410    0.136576    0.005653    0.132578    0.140573    2
   20   410    0.136576    0.016959    0.124584    0.148568    2
   21   386    0.128581    0.006595    0.123917    0.133245    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.097549    0.009487    0.000045    0.300630    0.068225    1.000    2
   length{all}[2]     0.098930    0.010254    0.000004    0.305026    0.067871    1.000    2
   length{all}[3]     0.098104    0.010017    0.000032    0.294744    0.066033    1.000    2
   length{all}[4]     0.100910    0.010623    0.000086    0.306993    0.068170    1.000    2
   length{all}[5]     0.100304    0.009838    0.000036    0.309264    0.068138    1.000    2
   length{all}[6]     0.101686    0.010543    0.000071    0.308534    0.070414    1.000    2
   length{all}[7]     0.097394    0.008597    0.000286    0.281807    0.070656    1.002    2
   length{all}[8]     0.103212    0.011865    0.000144    0.320664    0.063165    1.000    2
   length{all}[9]     0.088549    0.008695    0.000059    0.283778    0.061761    1.003    2
   length{all}[10]    0.103926    0.010937    0.000721    0.344535    0.069789    0.998    2
   length{all}[11]    0.100597    0.011735    0.000600    0.292328    0.070720    1.005    2
   length{all}[12]    0.107074    0.012664    0.000269    0.322183    0.074984    0.998    2
   length{all}[13]    0.100873    0.011262    0.000080    0.313296    0.068023    0.999    2
   length{all}[14]    0.100156    0.011401    0.000360    0.309129    0.070983    1.001    2
   length{all}[15]    0.104215    0.010384    0.001497    0.306389    0.073102    0.998    2
   length{all}[16]    0.091368    0.008774    0.000338    0.282669    0.057493    0.998    2
   length{all}[17]    0.096033    0.009393    0.000200    0.265243    0.068987    0.999    2
   length{all}[18]    0.097267    0.009693    0.000311    0.301371    0.067064    1.005    2
   length{all}[19]    0.090093    0.009613    0.000927    0.289612    0.057334    0.998    2
   length{all}[20]    0.099672    0.009728    0.000002    0.297403    0.067012    0.998    2
   length{all}[21]    0.102579    0.010989    0.000370    0.312010    0.071625    0.998    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.009359
       Maximum standard deviation of split frequencies = 0.021670
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.005


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   |                                                                               
   |------------------------------------------------------------------------ C3 (3)
   +                                                                               
   |------------------------------------------------------------------------ C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------------ C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |--------------------------------------------------------------------- C2 (2)
   |                                                                               
   |-------------------------------------------------------------------- C3 (3)
   +                                                                               
   |---------------------------------------------------------------------- C4 (4)
   |                                                                               
   |---------------------------------------------------------------------- C5 (5)
   |                                                                               
   \------------------------------------------------------------------------ C6 (6)
                                                                                   
   |---------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (105 trees sampled):
      50 % credible set contains 46 trees
      90 % credible set contains 91 trees
      95 % credible set contains 97 trees
      99 % credible set contains 104 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 6  	ls = 741
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Reading seq # 5: C5       
Reading seq # 6: C6       
Sequences read..
Counting site patterns..  0:00

Compressing,     51 patterns at    247 /    247 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     51 patterns at    247 /    247 sites (100.0%),  0:00
Counting codons..

      120 bytes for distance
    49776 bytes for conP
     4488 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.089666    0.080017    0.101542    0.100546    0.026829    0.068319    0.300000    1.300000

ntime & nrate & np:     6     2     8

Bounds (np=8):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     8
lnL0 = -1071.308972

Iterating by ming2
Initial: fx=  1071.308972
x=  0.08967  0.08002  0.10154  0.10055  0.02683  0.06832  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 591.3795 ++     1032.749861  m 0.0001    13 | 1/8
  2 h-m-p  0.0007 0.0045  79.6168 ++     1030.518502  m 0.0045    24 | 2/8
  3 h-m-p  0.0018 0.0092  28.7183 ------------..  | 2/8
  4 h-m-p  0.0000 0.0001 538.7676 ++      987.651514  m 0.0001    56 | 3/8
  5 h-m-p  0.0012 0.0182  60.3637 -----------..  | 3/8
  6 h-m-p  0.0000 0.0001 485.4299 ++      973.506411  m 0.0001    87 | 4/8
  7 h-m-p  0.0005 0.0222  49.6612 -----------..  | 4/8
  8 h-m-p  0.0000 0.0000 421.3535 ++      964.718243  m 0.0000   118 | 5/8
  9 h-m-p  0.0005 0.0292  37.6989 -----------..  | 5/8
 10 h-m-p  0.0000 0.0001 344.6558 ++      958.084704  m 0.0001   149 | 6/8
 11 h-m-p  0.0005 0.0433  25.4467 -----------..  | 6/8
 12 h-m-p  0.0000 0.0000 244.4910 ++      957.779970  m 0.0000   180 | 7/8
 13 h-m-p  1.6000 8.0000   0.0000 C       957.779970  0 1.6000   191 | 7/8
 14 h-m-p  0.0160 8.0000   0.0000 +Y      957.779970  0 0.0640   204
Out..
lnL  =  -957.779970
205 lfun, 205 eigenQcodon, 1230 P(t)

Time used:  0:00


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.014816    0.048499    0.107652    0.026552    0.014078    0.090203    0.000100    0.551063    0.214986

ntime & nrate & np:     6     2     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 12.329429

np =     9
lnL0 = -1026.615281

Iterating by ming2
Initial: fx=  1026.615281
x=  0.01482  0.04850  0.10765  0.02655  0.01408  0.09020  0.00011  0.55106  0.21499

  1 h-m-p  0.0000 0.0000 531.9234 ++     1026.143236  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0002 332.8226 +++    1006.991847  m 0.0002    27 | 2/9
  3 h-m-p  0.0000 0.0000 173.1982 ++     1006.366967  m 0.0000    39 | 3/9
  4 h-m-p  0.0000 0.0003 133.9985 +++     999.301887  m 0.0003    52 | 4/9
  5 h-m-p  0.0000 0.0002 209.9735 ++      989.168629  m 0.0002    64 | 5/9
  6 h-m-p  0.0000 0.0001 1580.1884 ++      969.464140  m 0.0001    76 | 6/9
  7 h-m-p  0.0000 0.0002 494.9600 ++      957.779769  m 0.0002    88 | 7/9
  8 h-m-p  1.6000 8.0000   0.0002 ++      957.779768  m 8.0000   100 | 7/9
  9 h-m-p  0.0001 0.0221  10.6060 ++++    957.779669  m 0.0221   116 | 8/9
 10 h-m-p  0.1264 0.6322   0.1817 ++      957.779453  m 0.6322   128 | 9/9
 11 h-m-p  0.0160 8.0000   0.0000 C       957.779453  0 0.0160   141
Out..
lnL  =  -957.779453
142 lfun, 426 eigenQcodon, 1704 P(t)

Time used:  0:01


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.102703    0.015812    0.067286    0.083532    0.025924    0.078525    0.000100    1.008683    0.371649    0.125248    1.224430

ntime & nrate & np:     6     3    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 12.114352

np =    11
lnL0 = -1039.601247

Iterating by ming2
Initial: fx=  1039.601247
x=  0.10270  0.01581  0.06729  0.08353  0.02592  0.07852  0.00011  1.00868  0.37165  0.12525  1.22443

  1 h-m-p  0.0000 0.0000 487.8335 ++     1039.343392  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0002 358.5258 +++    1018.737144  m 0.0002    31 | 2/11
  3 h-m-p  0.0000 0.0001 159.1225 ++     1010.299060  m 0.0001    45 | 3/11
  4 h-m-p  0.0002 0.0008  87.9311 ++      999.210173  m 0.0008    59 | 4/11
  5 h-m-p  0.0002 0.0011 141.2818 ++      985.462510  m 0.0011    73 | 5/11
  6 h-m-p  0.0001 0.0003 570.1439 ++      981.223563  m 0.0003    87 | 6/11
  7 h-m-p  0.0000 0.0002 376.0659 ++      972.601059  m 0.0002   101 | 7/11
  8 h-m-p  0.0001 0.0011 909.4326 ++      957.779792  m 0.0011   115 | 8/11
  9 h-m-p  1.6000 8.0000   0.0001 ++      957.779792  m 8.0000   129 | 8/11
 10 h-m-p  0.0160 8.0000   0.7295 +++++   957.779457  m 8.0000   149 | 8/11
 11 h-m-p  1.6000 8.0000   0.1577 ++      957.779454  m 8.0000   166 | 8/11
 12 h-m-p  1.6000 8.0000   0.5881 ++      957.779453  m 8.0000   183 | 8/11
 13 h-m-p  1.6000 8.0000   0.0661 ++      957.779453  m 8.0000   200 | 8/11
 14 h-m-p  0.5775 8.0000   0.9151 ++      957.779453  m 8.0000   217 | 8/11
 15 h-m-p  1.6000 8.0000   0.0000 C       957.779453  0 1.6000   234 | 8/11
 16 h-m-p  0.0160 8.0000   0.0000 Y       957.779453  0 0.0160   251
Out..
lnL  =  -957.779453
252 lfun, 1008 eigenQcodon, 4536 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -957.848389  S =  -957.780854    -0.026205
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  51 patterns   0:02
	did  20 /  51 patterns   0:02
	did  30 /  51 patterns   0:02
	did  40 /  51 patterns   0:02
	did  50 /  51 patterns   0:02
	did  51 /  51 patterns   0:02
Time used:  0:02


Model 7: beta

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.040406    0.090083    0.047355    0.107557    0.085044    0.093697    0.000100    0.223387    1.335580

ntime & nrate & np:     6     1     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 27.252902

np =     9
lnL0 = -1054.517061

Iterating by ming2
Initial: fx=  1054.517061
x=  0.04041  0.09008  0.04736  0.10756  0.08504  0.09370  0.00011  0.22339  1.33558

  1 h-m-p  0.0000 0.0000 462.9890 ++     1054.440580  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0050  54.5210 +++++  1045.276816  m 0.0050    29 | 2/9
  3 h-m-p  0.0001 0.0006 910.2748 ++     1008.605699  m 0.0006    41 | 3/9
  4 h-m-p  0.0008 0.0038 193.0642 ++      980.138645  m 0.0038    53 | 4/9
  5 h-m-p  0.0000 0.0001 233.5969 ++      979.700350  m 0.0001    65 | 5/9
  6 h-m-p  0.0000 0.0001 743.7401 ++      977.363966  m 0.0001    77 | 6/9
  7 h-m-p  0.0004 0.0019  74.6797 ++      975.010833  m 0.0019    89 | 7/9
  8 h-m-p  0.0570 8.0000   2.2853 --------------..  | 7/9
  9 h-m-p  0.0000 0.0004 200.1196 +++     957.779453  m 0.0004   126 | 8/9
 10 h-m-p  1.6000 8.0000   0.0000 Y       957.779453  0 1.6000   138 | 8/9
 11 h-m-p  0.0160 8.0000   0.0000 Y       957.779453  0 0.0160   151
Out..
lnL  =  -957.779453
152 lfun, 1672 eigenQcodon, 9120 P(t)

Time used:  0:04


Model 8: beta&w>1

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.028212    0.028386    0.020697    0.050443    0.086356    0.018100    0.000100    0.900000    0.890410    1.898365    1.101388

ntime & nrate & np:     6     2    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 15.803406

np =    11
lnL0 = -1010.807554

Iterating by ming2
Initial: fx=  1010.807554
x=  0.02821  0.02839  0.02070  0.05044  0.08636  0.01810  0.00011  0.90000  0.89041  1.89837  1.10139

  1 h-m-p  0.0000 0.0000 536.2466 ++     1010.277886  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0048  83.1419 +++++   980.907721  m 0.0048    33 | 2/11
  3 h-m-p  0.0000 0.0000 7816.9360 ++      978.004486  m 0.0000    47 | 3/11
  4 h-m-p  0.0002 0.0011  81.7986 ++      975.788286  m 0.0011    61 | 4/11
  5 h-m-p  0.0000 0.0000 70901.4968 ++      975.760047  m 0.0000    75 | 5/11
  6 h-m-p  0.0000 0.0001 1337.9059 ++      972.419266  m 0.0001    89 | 6/11
  7 h-m-p  0.0000 0.0000 44082.9014 ++      966.259169  m 0.0000   103 | 7/11
  8 h-m-p  0.0018 0.0091  51.2802 ++      961.645660  m 0.0091   117 | 8/11
  9 h-m-p  0.0073 0.0365  38.5506 -------------..  | 8/11
 10 h-m-p  0.0000 0.0001 238.4151 ++      957.779867  m 0.0001   156 | 9/11
 11 h-m-p  1.0109 8.0000   0.0000 ++      957.779867  m 8.0000   170 | 9/11
 12 h-m-p  0.1167 8.0000   0.0003 ++++    957.779867  m 8.0000   188 | 9/11
 13 h-m-p  0.0160 8.0000   0.8771 +++++   957.779861  m 8.0000   207 | 9/11
 14 h-m-p  1.6000 8.0000   0.4202 ++      957.779861  m 8.0000   223 | 9/11
 15 h-m-p  0.8536 8.0000   3.9379 ++      957.779860  m 8.0000   239 | 9/11
 16 h-m-p  0.3099 1.5495  49.6482 ++      957.779860  m 1.5495   253 | 10/11
 17 h-m-p  0.2240 1.1198  26.2708 ------------Y   957.779860  0 0.0000   279 | 10/11
 18 h-m-p  0.0160 8.0000   0.0000 ------------N   957.779860  0 0.0000   305
Out..
lnL  =  -957.779860
306 lfun, 3672 eigenQcodon, 20196 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -957.806690  S =  -957.776399    -0.013357
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  51 patterns   0:10
	did  20 /  51 patterns   0:10
	did  30 /  51 patterns   0:10
	did  40 /  51 patterns   0:10
	did  50 /  51 patterns   0:10
	did  51 /  51 patterns   0:10
Time used:  0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247 

NC_011896_1_WP_010908463_1_1764_MLBR_RS08360          MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NC_002677_1_NP_302142_1_1014_ML1661                   MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965   MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680   MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125       MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350       MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
                                                      **************************************************

NC_011896_1_WP_010908463_1_1764_MLBR_RS08360          LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NC_002677_1_NP_302142_1_1014_ML1661                   LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965   LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680   LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125       LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350       LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
                                                      **************************************************

NC_011896_1_WP_010908463_1_1764_MLBR_RS08360          AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NC_002677_1_NP_302142_1_1014_ML1661                   AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965   AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680   AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125       AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350       AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
                                                      **************************************************

NC_011896_1_WP_010908463_1_1764_MLBR_RS08360          RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NC_002677_1_NP_302142_1_1014_ML1661                   RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965   RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680   RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125       RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350       RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
                                                      **************************************************

NC_011896_1_WP_010908463_1_1764_MLBR_RS08360          RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NC_002677_1_NP_302142_1_1014_ML1661                   RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965   RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680   RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125       RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350       RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
                                                      ***********************************************



>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NC_002677_1_NP_302142_1_1014_ML1661
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
ATGGCTGTGTACCGAGTCTTTGAGGCGCTGGACGAATTGGGTGCCATTGT
CGAAGAAGCCCGGGGCGTGCCGATGACCGCTGGCTGTGTGGTACCTCGCG
GCGATGTGCTGGAGCTGATCGACGATATCAAAGATGCGATCCCGGGTGAG
TTGGATGATGCCCAGGATGTGCTCGACGCGCGTGATGCGATGCTCAACGA
CGCCAAAGCGCATGCCGATTCCATGGTGTCCTCAGCGACCACTGAGTCGG
AGTCATTGTTGAGTCACGCGCGCGCGGAGGCTGATCGGATCCTGTCTGAC
GCGAAATCGCAGGTTGATCGGATGGCAAGCGAGGCGCGTCAACACAGTGA
GCGGATGCTCGGGGATGCGCGTGAGGAGTCGATTCGCATCGCTACAGTAG
CGAAGCGAGAGTACGAGGCCAGCCTCAACCGTGCCCAATCCGAATGCGAC
CGGTTGATCGAAAACGGCAACATCTCCTACGAAAAGGCTATCCAAGAGGG
CATCAAGGAACAGCAGCGCTTGGTGTCGCAAAACGAGGTGGTACAGGCGG
CCAACGCCGAATCCACCCGGCTGATCGACACGGCGCACGCCGAGGCGGAC
CGGCTGCGCGGCGAGTGCGATATCTATGTCGACAACAAGCTCGCCGAGTT
CGAAGAGTTTCTCAACGGTACGCTTCGTTCGGTTGGCCGCGGCCGCCACC
AGCTCCGCACGGCGGCCGGTACGCACGATTACGTGACACGC
>NC_011896_1_WP_010908463_1_1764_MLBR_RS08360
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>NC_002677_1_NP_302142_1_1014_ML1661
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
>NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
MAVYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGE
LDDAQDVLDARDAMLNDAKAHADSMVSSATTESESLLSHARAEADRILSD
AKSQVDRMASEARQHSERMLGDAREESIRIATVAKREYEASLNRAQSECD
RLIENGNISYEKAIQEGIKEQQRLVSQNEVVQAANAESTRLIDTAHAEAD
RLRGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYVTR
#NEXUS

[ID: 5597914545]
begin taxa;
	dimensions ntax=6;
	taxlabels
		NC_011896_1_WP_010908463_1_1764_MLBR_RS08360
		NC_002677_1_NP_302142_1_1014_ML1661
		NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965
		NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680
		NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125
		NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
		;
end;
begin trees;
	translate
		1	NC_011896_1_WP_010908463_1_1764_MLBR_RS08360,
		2	NC_002677_1_NP_302142_1_1014_ML1661,
		3	NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965,
		4	NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680,
		5	NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125,
		6	NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.06822517,2:0.06787123,3:0.0660333,4:0.06817048,5:0.06813755,6:0.07041382);
end;
      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1008.14         -1011.08
2      -1008.15         -1011.64
--------------------------------------
TOTAL    -1008.15         -1011.40
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892381    0.087024    0.371087    1.471015    0.860947   1501.00   1501.00    1.000
r(A<->C){all}   0.163758    0.020486    0.000031    0.465426    0.126773     96.55    173.30    1.003
r(A<->G){all}   0.178784    0.021452    0.000076    0.464542    0.138304    112.74    156.09    1.000
r(A<->T){all}   0.162939    0.020033    0.000145    0.454404    0.121681    101.46    134.51    1.008
r(C<->G){all}   0.167028    0.021859    0.000027    0.475773    0.123339    165.38    230.79    1.000
r(C<->T){all}   0.162384    0.020731    0.000032    0.458304    0.120614    168.66    183.90    1.010
r(G<->T){all}   0.165106    0.019836    0.000354    0.448175    0.125252    205.47    288.83    1.002
pi(A){all}      0.215222    0.000228    0.188876    0.246685    0.214923   1330.99   1404.25    1.001
pi(C){all}      0.276730    0.000257    0.244619    0.308080    0.276846   1266.75   1271.80    1.001
pi(G){all}      0.331115    0.000284    0.298472    0.365147    0.330630   1314.64   1368.83    1.000
pi(T){all}      0.176934    0.000205    0.150090    0.205454    0.176736   1225.67   1293.22    1.000
alpha{1,2}      0.428076    0.237010    0.000141    1.428335    0.265852   1169.45   1307.66    1.000
alpha{3}        0.448949    0.222485    0.000130    1.402621    0.297875   1362.39   1374.85    1.000
pinvar{all}     0.997929    0.000006    0.993294    0.999999    0.998719   1246.19   1331.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018)  /data/7res/ML1661/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio, 
Codon frequency model: F3x4
Site-class models: 
ns =   6  ls = 247

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   2   2   2   2   2 | Ser TCT   1   1   1   1   1   1 | Tyr TAT   1   1   1   1   1   1 | Cys TGT   1   1   1   1   1   1
    TTC   1   1   1   1   1   1 |     TCC   5   5   5   5   5   5 |     TAC   4   4   4   4   4   4 |     TGC   2   2   2   2   2   2
Leu TTA   0   0   0   0   0   0 |     TCA   2   2   2   2   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   6   6   6   6   6   6 |     TCG   5   5   5   5   5   5 |     TAG   0   0   0   0   0   0 | Trp TGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   1   1   1   1   1 | Pro CCT   1   1   1   1   1   1 | His CAT   1   1   1   1   1   1 | Arg CGT   5   5   5   5   5   5
    CTC   7   7   7   7   7   7 |     CCC   0   0   0   0   0   0 |     CAC   5   5   5   5   5   5 |     CGC   9   9   9   9   9   9
    CTA   0   0   0   0   0   0 |     CCA   0   0   0   0   0   0 | Gln CAA   4   4   4   4   4   4 |     CGA   2   2   2   2   2   2
    CTG   6   6   6   6   6   6 |     CCG   2   2   2   2   2   2 |     CAG   6   6   6   6   6   6 |     CGG   7   7   7   7   7   7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   2   2   2   2   2 | Thr ACT   1   1   1   1   1   1 | Asn AAT   0   0   0   0   0   0 | Ser AGT   2   2   2   2   2   2
    ATC  11  11  11  11  11  11 |     ACC   3   3   3   3   3   3 |     AAC   8   8   8   8   8   8 |     AGC   2   2   2   2   2   2
    ATA   0   0   0   0   0   0 |     ACA   2   2   2   2   2   2 | Lys AAA   3   3   3   3   3   3 | Arg AGA   0   0   0   0   0   0
Met ATG   6   6   6   6   6   6 |     ACG   4   4   4   4   4   4 |     AAG   4   4   4   4   4   4 |     AGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   2   2   2   2   2   2 | Ala GCT   5   5   5   5   5   5 | Asp GAT  13  13  13  13  13  13 | Gly GGT   4   4   4   4   4   4
    GTC   3   3   3   3   3   3 |     GCC  12  12  12  12  12  12 |     GAC   9   9   9   9   9   9 |     GGC   8   8   8   8   8   8
    GTA   3   3   3   3   3   3 |     GCA   1   1   1   1   1   1 | Glu GAA   9   9   9   9   9   9 |     GGA   0   0   0   0   0   0
    GTG   9   9   9   9   9   9 |     GCG  16  16  16  16  16  16 |     GAG  18  18  18  18  18  18 |     GGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

#2: NC_002677_1_NP_302142_1_1014_ML1661             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

#3: NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

#4: NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

#5: NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

#6: NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350             
position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      12 | Ser S TCT       6 | Tyr Y TAT       6 | Cys C TGT       6
      TTC       6 |       TCC      30 |       TAC      24 |       TGC      12
Leu L TTA       0 |       TCA      12 | *** * TAA       0 | *** * TGA       0
      TTG      36 |       TCG      30 |       TAG       0 | Trp W TGG       0
------------------------------------------------------------------------------
Leu L CTT       6 | Pro P CCT       6 | His H CAT       6 | Arg R CGT      30
      CTC      42 |       CCC       0 |       CAC      30 |       CGC      54
      CTA       0 |       CCA       0 | Gln Q CAA      24 |       CGA      12
      CTG      36 |       CCG      12 |       CAG      36 |       CGG      42
------------------------------------------------------------------------------
Ile I ATT      12 | Thr T ACT       6 | Asn N AAT       0 | Ser S AGT      12
      ATC      66 |       ACC      18 |       AAC      48 |       AGC      12
      ATA       0 |       ACA      12 | Lys K AAA      18 | Arg R AGA       0
Met M ATG      36 |       ACG      24 |       AAG      24 |       AGG       0
------------------------------------------------------------------------------
Val V GTT      12 | Ala A GCT      30 | Asp D GAT      78 | Gly G GGT      24
      GTC      18 |       GCC      72 |       GAC      54 |       GGC      48
      GTA      18 |       GCA       6 | Glu E GAA      54 |       GGA       0
      GTG      54 |       GCG      96 |       GAG     108 |       GGG       6
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.12146    C:0.22672    A:0.19433    G:0.45749
position  2:    T:0.23887    C:0.24291    A:0.34413    G:0.17409
position  3:    T:0.17004    C:0.36032    A:0.10526    G:0.36437
Average         T:0.17679    C:0.27665    A:0.21457    G:0.33198

Model 0: one-ratio


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  8):   -957.779970      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.101388

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

omega (dN/dS) =  1.10139

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0
   7..2      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0
   7..3      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0
   7..4      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0
   7..5      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0
   7..6      0.000   610.9   130.1  1.1014  0.0000  0.0000   0.0   0.0

tree length for dN:       0.0000
tree length for dS:       0.0000


Time used:  0:00


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -957.779453      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=2)

p:   0.99999  0.00001
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0


Time used:  0:01


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -957.779453      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 2.931380

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=3)

p:   1.00000  0.00000  0.00000
w:   0.00000  1.00000  2.93138
(note that p[2] is zero)


dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
w2:   0.104  0.103  0.102  0.101  0.100  0.099  0.099  0.098  0.097  0.096

Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)

 0.010
 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011

sum of density on p0-p1 =   1.000000

Time used:  0:02


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -957.779453      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.513254

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M7 (beta):
 p =   0.00500  q =   1.51325


MLEs of dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00002

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    610.9    130.1   0.0000   0.0000   0.0000    0.0    0.0


Time used:  0:04


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -957.779860      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 69.581196 99.000000 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908463_1_1764_MLBR_RS08360: 0.000004, NC_002677_1_NP_302142_1_1014_ML1661: 0.000004, NZ_LVXE01000091_1_WP_010908463_1_2902_A3216_RS13965: 0.000004, NZ_LYPH01000094_1_WP_010908463_1_2838_A8144_RS13680: 0.000004, NZ_CP029543_1_WP_010908463_1_1793_DIJ64_RS09125: 0.000004, NZ_AP014567_1_WP_010908463_1_1838_JK2ML_RS09350: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =  69.58120 q =  99.00000
 (p1 =   0.00001) w =   1.00000


MLEs of dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.35113  0.37348  0.38697  0.39782  0.40763  0.41718  0.42708  0.43815  0.45206  0.47554  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0
   7..2       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0
   7..3       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0
   7..4       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0
   7..5       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0
   7..6       0.000    610.9    130.1   0.4127   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908463_1_1764_MLBR_RS08360)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.098  0.098  0.099  0.099  0.100  0.100  0.101  0.101  0.102  0.102
p :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
q :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
ws:   0.102  0.102  0.101  0.101  0.100  0.100  0.099  0.099  0.098  0.098

Time used:  0:10
Model 1: NearlyNeutral	-957.779453
Model 2: PositiveSelection	-957.779453
Model 0: one-ratio	-957.77997
Model 7: beta	-957.779453
Model 8: beta&w>1	-957.77986


Model 0 vs 1	0.001034000000117885

Model 2 vs 1	0.0

Model 8 vs 7	8.139999999912106E-4