--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:17:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1677/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -771.26          -774.57
2       -771.24          -774.49
--------------------------------------
TOTAL     -771.25          -774.53
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890083    0.086225    0.365869    1.483477    0.861010   1501.00   1501.00    1.000
r(A<->C){all}   0.163753    0.018611    0.000015    0.431572    0.127768    139.96    155.84    1.008
r(A<->G){all}   0.166838    0.020197    0.000143    0.448462    0.125792    240.74    252.51    1.005
r(A<->T){all}   0.174781    0.021402    0.000110    0.472429    0.136649    183.24    196.39    1.000
r(C<->G){all}   0.159894    0.018443    0.000134    0.427793    0.121892    170.58    229.88    1.000
r(C<->T){all}   0.155123    0.018107    0.000077    0.415961    0.120349    251.04    311.70    1.000
r(G<->T){all}   0.179611    0.021697    0.000125    0.477631    0.140397    173.93    217.83    1.000
pi(A){all}      0.204286    0.000273    0.170463    0.234631    0.204034   1070.29   1101.63    1.000
pi(C){all}      0.358696    0.000392    0.319227    0.396658    0.358595   1045.96   1132.84    1.000
pi(G){all}      0.272190    0.000328    0.237122    0.305993    0.271941    997.24   1143.90    1.000
pi(T){all}      0.164829    0.000233    0.136801    0.194738    0.164560   1233.05   1286.00    1.001
alpha{1,2}      0.439401    0.259233    0.000190    1.461941    0.255873   1115.27   1185.70    1.000
alpha{3}        0.438784    0.216229    0.000314    1.397965    0.289855   1294.38   1306.40    1.000
pinvar{all}     0.997208    0.000011    0.990790    0.999998    0.998314   1234.94   1342.91    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-741.450683
Model 2: PositiveSelection	-741.450653
Model 0: one-ratio	-741.45072
Model 7: beta	-741.45064
Model 8: beta&w>1	-741.450579


Model 0 vs 1	7.400000004054164E-5

Model 2 vs 1	6.000000007588824E-5

Model 8 vs 7	1.2200000014672696E-4
>C1
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C2
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C3
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C4
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C5
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C6
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=191 

C1              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C2              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C3              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C4              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C5              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C6              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
                **************************************************

C1              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C2              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C3              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C4              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C5              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C6              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
                **************************************************

C1              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C2              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C3              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C4              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C5              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C6              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
                **************************************************

C1              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C2              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C3              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C4              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C5              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C6              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
                *****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  191 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  191 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5730]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5730]--->[5730]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.732 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C2              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C3              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C4              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C5              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C6              VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
                **************************************************

C1              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C2              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C3              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C4              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C5              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C6              ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
                **************************************************

C1              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C2              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C3              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C4              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C5              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C6              EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
                **************************************************

C1              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C2              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C3              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C4              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C5              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C6              DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
                *****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C2              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C3              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C4              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C5              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C6              GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
                **************************************************

C1              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C2              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C3              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C4              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C5              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C6              ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
                **************************************************

C1              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C2              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C3              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C4              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C5              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C6              CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
                **************************************************

C1              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C2              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C3              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C4              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C5              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C6              ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
                **************************************************

C1              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C2              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C3              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C4              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C5              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C6              GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
                **************************************************

C1              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C2              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C3              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C4              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C5              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C6              CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
                **************************************************

C1              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C2              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C3              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C4              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C5              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C6              GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
                **************************************************

C1              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C2              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C3              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C4              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C5              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C6              GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
                **************************************************

C1              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C2              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C3              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C4              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C5              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C6              CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
                **************************************************

C1              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C2              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C3              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C4              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C5              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C6              GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
                **************************************************

C1              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C2              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C3              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C4              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C5              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C6              ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
                **************************************************

C1              CGATCAGCCCGGCTCAGTCTCAC
C2              CGATCAGCCCGGCTCAGTCTCAC
C3              CGATCAGCCCGGCTCAGTCTCAC
C4              CGATCAGCCCGGCTCAGTCTCAC
C5              CGATCAGCCCGGCTCAGTCTCAC
C6              CGATCAGCCCGGCTCAGTCTCAC
                ***********************



>C1
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C2
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C3
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C4
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C5
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C6
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C1
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C2
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C3
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C4
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C5
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C6
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 573 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857352
      Setting output file names to "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1642522672
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5649937995
      Seed = 851221243
      Swapseed = 1579857352
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1282.401476 -- -24.965149
         Chain 2 -- -1282.401476 -- -24.965149
         Chain 3 -- -1282.401476 -- -24.965149
         Chain 4 -- -1282.401280 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1282.401280 -- -24.965149
         Chain 2 -- -1282.401476 -- -24.965149
         Chain 3 -- -1282.401403 -- -24.965149
         Chain 4 -- -1282.401403 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1282.401] (-1282.401) (-1282.401) (-1282.401) * [-1282.401] (-1282.401) (-1282.401) (-1282.401) 
        500 -- (-788.673) (-788.593) (-789.058) [-776.300] * (-791.505) (-789.119) (-784.725) [-780.220] -- 0:00:00
       1000 -- [-779.785] (-793.291) (-784.258) (-781.717) * (-787.159) (-779.662) [-780.370] (-780.932) -- 0:00:00
       1500 -- [-781.242] (-780.013) (-787.853) (-794.381) * (-779.223) [-778.930] (-780.891) (-781.038) -- 0:00:00
       2000 -- (-787.737) (-789.051) (-778.702) [-777.471] * (-780.993) [-781.309] (-779.937) (-783.502) -- 0:00:00
       2500 -- (-778.185) [-779.578] (-783.793) (-783.631) * (-791.706) [-776.066] (-784.164) (-779.948) -- 0:00:00
       3000 -- (-789.646) [-783.937] (-777.238) (-784.624) * [-782.608] (-787.260) (-778.435) (-779.733) -- 0:00:00
       3500 -- [-778.673] (-783.529) (-777.953) (-778.281) * (-785.810) (-786.646) (-785.325) [-777.133] -- 0:00:00
       4000 -- (-778.957) (-781.828) (-782.527) [-784.382] * (-781.619) [-778.723] (-792.888) (-782.471) -- 0:00:00
       4500 -- [-781.697] (-777.769) (-782.393) (-783.442) * [-780.509] (-779.587) (-776.567) (-780.728) -- 0:00:00
       5000 -- (-781.589) [-775.562] (-782.160) (-778.576) * (-781.612) (-778.660) [-781.800] (-781.054) -- 0:00:00

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-778.736) (-777.927) (-776.014) [-787.562] * (-779.976) (-791.061) [-785.023] (-777.667) -- 0:00:00
       6000 -- (-788.239) [-784.757] (-783.996) (-789.861) * (-783.936) (-783.051) (-783.293) [-776.445] -- 0:00:00
       6500 -- (-784.712) (-783.515) (-783.871) [-777.603] * [-780.055] (-783.055) (-786.135) (-777.487) -- 0:00:00
       7000 -- (-783.831) [-782.703] (-783.376) (-781.031) * (-794.697) (-781.678) (-781.527) [-781.122] -- 0:02:21
       7500 -- (-786.365) [-778.616] (-785.509) (-787.020) * (-783.744) (-784.898) (-777.387) [-780.426] -- 0:02:12
       8000 -- [-780.514] (-782.241) (-785.147) (-782.586) * (-779.683) (-779.660) (-779.831) [-779.248] -- 0:02:04
       8500 -- (-782.272) (-779.617) (-788.695) [-780.723] * (-784.157) (-784.681) (-781.711) [-785.124] -- 0:01:56
       9000 -- [-780.142] (-782.313) (-785.498) (-780.160) * (-780.507) [-781.169] (-792.715) (-777.244) -- 0:01:50
       9500 -- (-783.170) [-778.854] (-782.547) (-781.404) * (-782.356) (-786.144) (-782.528) [-779.158] -- 0:01:44
      10000 -- (-780.105) (-775.828) [-783.832] (-780.908) * (-800.475) (-788.713) (-784.167) [-782.990] -- 0:01:39

      Average standard deviation of split frequencies: 0.072790

      10500 -- (-786.515) (-780.646) [-787.303] (-775.652) * (-787.843) (-780.713) (-780.049) [-781.773] -- 0:01:34
      11000 -- (-780.519) (-779.385) [-783.766] (-780.239) * (-772.806) (-784.088) [-786.218] (-785.153) -- 0:01:29
      11500 -- (-780.859) (-783.034) [-783.292] (-782.978) * (-773.951) (-780.020) (-775.904) [-782.604] -- 0:01:25
      12000 -- (-776.745) [-777.380] (-782.023) (-786.081) * (-771.441) (-785.172) [-781.668] (-788.866) -- 0:01:22
      12500 -- (-776.967) (-777.442) [-779.364] (-789.067) * (-774.919) (-779.887) (-778.323) [-777.770] -- 0:01:19
      13000 -- (-788.809) [-776.861] (-784.198) (-780.545) * [-770.692] (-793.083) (-778.020) (-785.132) -- 0:01:15
      13500 -- (-779.273) [-780.364] (-776.490) (-786.478) * (-769.875) (-785.142) [-781.904] (-782.351) -- 0:01:13
      14000 -- (-775.583) [-784.532] (-781.104) (-786.973) * [-770.051] (-777.504) (-786.643) (-780.117) -- 0:01:10
      14500 -- (-775.890) [-781.934] (-782.151) (-777.945) * (-772.891) (-779.698) [-780.359] (-779.079) -- 0:01:07
      15000 -- (-785.032) [-782.210] (-791.291) (-770.597) * [-772.412] (-787.215) (-784.042) (-776.647) -- 0:01:05

      Average standard deviation of split frequencies: 0.069780

      15500 -- (-776.609) (-780.905) (-779.089) [-770.986] * (-771.268) [-776.347] (-785.448) (-781.058) -- 0:01:03
      16000 -- (-783.100) [-777.153] (-781.941) (-770.753) * (-773.513) (-786.241) [-776.171] (-781.521) -- 0:01:01
      16500 -- (-781.532) [-781.717] (-775.665) (-772.521) * (-773.197) (-778.501) [-780.947] (-787.775) -- 0:00:59
      17000 -- [-778.820] (-784.661) (-778.866) (-770.899) * [-772.277] (-776.838) (-783.289) (-789.038) -- 0:00:57
      17500 -- [-782.477] (-779.422) (-779.610) (-772.276) * [-773.822] (-782.190) (-781.762) (-778.509) -- 0:00:56
      18000 -- [-782.237] (-781.373) (-781.885) (-777.900) * (-778.042) (-774.273) (-790.523) [-781.305] -- 0:00:54
      18500 -- [-781.906] (-782.081) (-783.368) (-771.745) * (-774.513) (-780.191) [-783.105] (-779.864) -- 0:00:53
      19000 -- (-781.165) (-782.512) (-787.118) [-770.686] * (-774.343) (-781.514) [-782.388] (-783.301) -- 0:00:51
      19500 -- [-777.210] (-780.226) (-797.395) (-771.582) * [-775.474] (-774.497) (-782.924) (-783.357) -- 0:00:50
      20000 -- (-784.590) (-780.394) [-771.920] (-774.181) * (-772.296) (-771.955) (-792.893) [-781.327] -- 0:00:49

      Average standard deviation of split frequencies: 0.038016

      20500 -- (-780.706) (-780.071) (-770.073) [-770.188] * [-771.169] (-772.218) (-795.980) (-777.254) -- 0:00:47
      21000 -- (-783.329) [-782.141] (-776.586) (-771.533) * (-771.288) (-771.509) (-772.347) [-776.659] -- 0:00:46
      21500 -- (-779.809) [-784.568] (-771.396) (-772.924) * (-776.734) (-770.838) (-772.316) [-777.502] -- 0:01:31
      22000 -- [-776.558] (-787.720) (-771.545) (-769.997) * [-773.285] (-773.612) (-770.746) (-784.210) -- 0:01:28
      22500 -- (-787.786) (-778.696) [-771.864] (-773.433) * (-773.079) (-774.211) (-770.849) [-785.078] -- 0:01:26
      23000 -- (-778.121) [-777.004] (-773.326) (-774.441) * (-773.441) (-770.288) [-772.059] (-777.262) -- 0:01:24
      23500 -- (-780.238) [-779.877] (-770.837) (-771.963) * [-771.712] (-772.007) (-770.917) (-785.295) -- 0:01:23
      24000 -- (-781.149) (-786.697) [-771.484] (-773.677) * (-771.443) (-772.837) (-770.440) [-780.438] -- 0:01:21
      24500 -- (-781.501) (-784.060) [-772.645] (-772.465) * (-772.256) (-771.126) (-771.728) [-778.503] -- 0:01:19
      25000 -- (-779.630) [-785.391] (-771.706) (-771.285) * (-772.682) (-773.689) [-772.597] (-785.991) -- 0:01:18

      Average standard deviation of split frequencies: 0.039125

      25500 -- [-779.858] (-781.923) (-774.085) (-770.435) * (-772.441) [-771.164] (-771.891) (-783.281) -- 0:01:16
      26000 -- (-781.602) (-777.523) [-771.203] (-772.589) * [-772.659] (-772.889) (-771.979) (-774.372) -- 0:01:14
      26500 -- (-780.553) (-778.460) [-770.736] (-770.614) * (-773.113) (-774.764) [-771.865] (-774.866) -- 0:01:13
      27000 -- (-785.563) (-782.424) (-770.762) [-770.798] * [-770.341] (-771.799) (-772.174) (-776.719) -- 0:01:12
      27500 -- (-784.852) (-778.720) (-771.806) [-773.299] * (-770.238) [-771.877] (-772.043) (-772.785) -- 0:01:10
      28000 -- (-783.959) (-779.722) [-770.974] (-772.706) * [-769.943] (-774.249) (-771.358) (-772.990) -- 0:01:09
      28500 -- (-779.875) [-776.977] (-770.991) (-770.537) * (-769.895) (-770.608) (-770.842) [-771.598] -- 0:01:08
      29000 -- (-779.479) [-776.702] (-772.124) (-771.344) * (-772.158) [-770.922] (-771.041) (-771.458) -- 0:01:06
      29500 -- [-779.235] (-782.681) (-770.999) (-771.089) * (-770.222) (-771.523) [-772.376] (-774.370) -- 0:01:05
      30000 -- (-780.961) (-783.043) (-770.650) [-770.043] * [-770.561] (-773.221) (-775.412) (-774.044) -- 0:01:04

      Average standard deviation of split frequencies: 0.041504

      30500 -- (-781.519) (-776.994) (-770.331) [-769.740] * (-770.537) (-776.015) (-771.582) [-771.920] -- 0:01:03
      31000 -- (-787.631) [-776.767] (-776.320) (-772.100) * (-773.638) (-772.278) (-771.209) [-772.993] -- 0:01:02
      31500 -- (-774.441) (-794.473) [-770.696] (-771.258) * (-771.228) [-770.528] (-771.589) (-773.636) -- 0:01:01
      32000 -- (-771.434) (-782.950) (-771.227) [-772.814] * (-772.506) (-772.683) (-772.641) [-773.677] -- 0:01:00
      32500 -- (-770.159) (-781.841) (-774.052) [-774.494] * (-772.249) [-772.477] (-771.788) (-773.476) -- 0:00:59
      33000 -- (-770.558) [-781.792] (-774.446) (-770.403) * (-770.427) (-774.433) (-771.481) [-771.095] -- 0:00:58
      33500 -- [-771.153] (-777.774) (-772.216) (-772.813) * (-770.808) (-776.590) (-774.235) [-771.988] -- 0:00:57
      34000 -- (-772.565) (-782.426) [-772.929] (-771.538) * (-771.377) [-770.978] (-772.248) (-770.393) -- 0:00:56
      34500 -- [-771.194] (-783.737) (-773.911) (-770.588) * (-771.384) (-774.981) [-773.499] (-772.094) -- 0:00:55
      35000 -- (-775.273) [-780.563] (-772.113) (-772.013) * [-771.868] (-773.715) (-772.780) (-770.619) -- 0:00:55

      Average standard deviation of split frequencies: 0.039938

      35500 -- [-773.905] (-783.921) (-772.609) (-773.263) * (-772.622) (-774.458) (-773.631) [-770.067] -- 0:00:54
      36000 -- (-772.628) [-779.236] (-771.409) (-772.525) * (-771.627) [-772.694] (-771.347) (-770.283) -- 0:00:53
      36500 -- (-771.519) (-780.477) (-770.355) [-772.193] * (-774.974) (-775.980) [-771.476] (-771.853) -- 0:00:52
      37000 -- [-773.179] (-782.237) (-770.383) (-773.628) * (-775.300) (-772.740) [-770.570] (-771.521) -- 0:01:18
      37500 -- (-774.150) [-776.243] (-771.388) (-777.631) * [-773.550] (-770.631) (-775.007) (-771.793) -- 0:01:17
      38000 -- [-769.863] (-792.691) (-770.204) (-771.152) * [-774.448] (-772.074) (-774.344) (-773.339) -- 0:01:15
      38500 -- (-770.267) [-780.382] (-771.570) (-771.086) * (-773.871) (-771.312) [-771.869] (-776.184) -- 0:01:14
      39000 -- [-770.645] (-783.127) (-777.165) (-770.402) * (-773.443) (-773.716) [-771.195] (-770.046) -- 0:01:13
      39500 -- [-769.801] (-783.114) (-774.125) (-770.459) * (-771.540) (-770.678) [-772.933] (-771.461) -- 0:01:12
      40000 -- (-774.086) [-783.415] (-771.127) (-774.442) * (-773.643) [-769.918] (-772.366) (-771.405) -- 0:01:12

      Average standard deviation of split frequencies: 0.038833

      40500 -- [-772.660] (-781.079) (-772.688) (-773.165) * [-772.698] (-775.541) (-771.092) (-770.905) -- 0:01:11
      41000 -- [-770.279] (-779.101) (-776.455) (-771.142) * [-772.421] (-770.590) (-774.320) (-770.193) -- 0:01:10
      41500 -- (-770.384) [-783.587] (-770.021) (-771.140) * (-772.748) [-770.940] (-772.489) (-770.750) -- 0:01:09
      42000 -- [-771.887] (-789.847) (-770.828) (-772.912) * (-772.655) (-778.013) (-771.067) [-771.274] -- 0:01:08
      42500 -- (-772.608) (-784.419) [-770.652] (-772.740) * (-770.042) [-776.239] (-773.265) (-772.378) -- 0:01:07
      43000 -- (-772.124) [-776.757] (-770.334) (-772.666) * (-772.378) (-771.322) [-771.981] (-771.570) -- 0:01:06
      43500 -- [-773.007] (-785.684) (-772.680) (-773.177) * [-772.729] (-770.777) (-772.438) (-774.903) -- 0:01:05
      44000 -- (-771.889) [-781.627] (-769.916) (-771.364) * (-771.054) [-773.443] (-772.992) (-770.566) -- 0:01:05
      44500 -- [-771.127] (-788.057) (-771.611) (-771.322) * (-774.484) (-772.194) [-774.843] (-771.527) -- 0:01:04
      45000 -- (-770.714) (-782.342) [-772.698] (-770.513) * [-771.124] (-774.394) (-775.699) (-772.351) -- 0:01:03

      Average standard deviation of split frequencies: 0.035868

      45500 -- [-771.581] (-788.338) (-771.892) (-772.006) * (-771.747) [-773.224] (-772.776) (-772.162) -- 0:01:02
      46000 -- [-770.052] (-783.558) (-773.371) (-774.129) * (-770.630) (-771.856) [-772.552] (-774.268) -- 0:01:02
      46500 -- [-772.320] (-780.841) (-774.206) (-771.983) * [-771.145] (-771.165) (-770.514) (-773.517) -- 0:01:01
      47000 -- (-772.409) (-784.551) [-774.939] (-770.284) * (-771.154) (-771.204) (-771.259) [-771.510] -- 0:01:00
      47500 -- (-775.812) (-783.468) (-771.352) [-771.537] * (-771.090) (-771.121) (-775.368) [-770.478] -- 0:01:00
      48000 -- (-772.015) [-779.350] (-773.486) (-775.234) * [-772.560] (-772.725) (-770.416) (-770.937) -- 0:00:59
      48500 -- (-773.828) [-778.016] (-771.085) (-775.218) * (-773.311) [-774.809] (-771.881) (-772.740) -- 0:00:58
      49000 -- (-773.217) (-782.187) (-771.102) [-771.822] * (-771.771) [-772.121] (-773.401) (-770.901) -- 0:00:58
      49500 -- (-775.057) [-776.291] (-770.025) (-773.045) * (-776.233) [-770.577] (-771.575) (-772.204) -- 0:00:57
      50000 -- (-776.167) [-779.364] (-771.794) (-770.728) * (-773.432) [-770.761] (-770.203) (-771.128) -- 0:00:57

      Average standard deviation of split frequencies: 0.039077

      50500 -- (-772.677) (-779.102) (-770.756) [-770.921] * [-770.795] (-771.235) (-770.235) (-770.989) -- 0:00:56
      51000 -- (-771.141) (-775.551) (-774.916) [-772.469] * (-770.553) (-771.362) (-771.780) [-770.232] -- 0:00:55
      51500 -- (-771.788) (-781.006) [-771.648] (-770.689) * (-769.955) (-772.949) (-778.755) [-770.649] -- 0:00:55
      52000 -- (-772.107) [-780.946] (-774.312) (-771.621) * (-770.508) (-772.103) [-773.362] (-771.497) -- 0:00:54
      52500 -- (-773.791) (-778.006) (-771.165) [-771.345] * [-773.038] (-771.383) (-774.378) (-772.163) -- 0:00:54
      53000 -- (-772.732) (-783.057) (-770.640) [-773.260] * [-774.052] (-771.498) (-772.872) (-772.086) -- 0:01:11
      53500 -- (-776.510) (-774.587) (-772.051) [-771.130] * [-775.027] (-770.950) (-771.859) (-769.718) -- 0:01:10
      54000 -- (-771.353) (-776.594) (-770.883) [-770.720] * (-771.196) (-775.761) [-772.444] (-770.678) -- 0:01:10
      54500 -- (-771.074) (-784.535) (-771.549) [-773.323] * (-771.657) [-774.155] (-772.669) (-772.038) -- 0:01:09
      55000 -- (-776.650) (-780.494) [-772.490] (-772.737) * (-770.804) [-772.599] (-773.123) (-770.947) -- 0:01:08

      Average standard deviation of split frequencies: 0.028355

      55500 -- (-771.291) [-783.191] (-772.527) (-771.668) * (-771.110) (-770.231) (-773.833) [-771.028] -- 0:01:08
      56000 -- (-770.212) (-787.771) (-771.358) [-771.602] * [-771.321] (-769.666) (-776.140) (-771.619) -- 0:01:07
      56500 -- (-772.730) (-779.918) [-772.454] (-773.714) * [-772.206] (-772.093) (-773.181) (-770.963) -- 0:01:06
      57000 -- [-773.013] (-776.618) (-771.402) (-774.771) * (-773.186) (-772.049) (-771.601) [-770.851] -- 0:01:06
      57500 -- (-771.200) [-776.473] (-772.970) (-769.846) * (-772.666) [-772.734] (-774.452) (-770.482) -- 0:01:05
      58000 -- (-771.024) [-785.673] (-774.398) (-773.750) * (-772.743) (-770.413) (-771.597) [-772.209] -- 0:01:04
      58500 -- [-770.790] (-783.229) (-774.347) (-772.010) * (-774.239) (-774.771) (-770.668) [-772.017] -- 0:01:04
      59000 -- (-772.738) (-785.013) (-771.032) [-776.121] * [-770.683] (-774.305) (-770.184) (-774.195) -- 0:01:03
      59500 -- (-771.476) (-782.428) [-771.544] (-771.380) * (-774.009) [-771.206] (-770.534) (-771.351) -- 0:01:03
      60000 -- (-770.660) (-784.648) [-771.024] (-771.499) * [-772.905] (-770.885) (-776.077) (-771.161) -- 0:01:02

      Average standard deviation of split frequencies: 0.026765

      60500 -- (-773.190) (-789.957) (-770.792) [-771.276] * (-773.039) (-777.001) [-773.755] (-772.361) -- 0:01:02
      61000 -- (-771.821) [-771.759] (-770.809) (-770.425) * (-772.941) [-770.832] (-773.518) (-770.823) -- 0:01:01
      61500 -- [-770.838] (-774.366) (-770.908) (-770.114) * (-774.192) (-771.400) (-770.942) [-772.389] -- 0:01:01
      62000 -- [-770.872] (-779.922) (-771.786) (-771.802) * [-774.307] (-771.323) (-772.313) (-775.004) -- 0:01:00
      62500 -- (-771.372) (-771.887) (-771.177) [-771.410] * (-775.235) (-772.175) [-772.306] (-772.160) -- 0:01:00
      63000 -- [-771.443] (-771.739) (-770.752) (-769.822) * (-772.681) (-770.703) [-775.254] (-771.437) -- 0:00:59
      63500 -- (-775.948) (-771.077) [-770.012] (-778.395) * [-772.378] (-770.207) (-770.963) (-769.837) -- 0:00:58
      64000 -- (-774.787) (-774.458) [-772.114] (-771.051) * (-773.845) (-771.822) (-773.212) [-772.999] -- 0:00:58
      64500 -- [-774.213] (-772.448) (-773.009) (-771.107) * (-772.025) [-773.000] (-773.486) (-771.355) -- 0:00:58
      65000 -- (-777.491) (-774.725) [-776.014] (-772.991) * (-771.163) (-771.311) [-771.463] (-771.736) -- 0:00:57

      Average standard deviation of split frequencies: 0.020356

      65500 -- (-773.830) (-771.740) (-771.394) [-771.847] * (-775.906) (-774.814) (-774.329) [-772.760] -- 0:00:57
      66000 -- (-775.073) [-772.747] (-771.101) (-772.085) * (-770.492) (-773.899) (-774.592) [-771.982] -- 0:00:56
      66500 -- (-772.448) (-775.789) (-776.430) [-771.540] * [-771.860] (-772.683) (-770.595) (-771.884) -- 0:00:56
      67000 -- (-773.132) [-770.721] (-774.079) (-771.010) * (-771.818) (-773.948) (-771.001) [-773.163] -- 0:00:55
      67500 -- (-775.766) (-774.100) (-772.178) [-770.993] * (-772.077) (-773.688) (-769.632) [-771.434] -- 0:00:55
      68000 -- (-774.210) [-773.109] (-771.753) (-774.217) * [-776.067] (-772.615) (-770.662) (-771.162) -- 0:00:54
      68500 -- (-773.567) (-773.978) (-772.373) [-772.205] * (-777.440) (-770.976) [-772.877] (-773.533) -- 0:00:54
      69000 -- [-773.226] (-772.206) (-772.889) (-774.021) * (-775.877) (-772.590) (-770.247) [-773.594] -- 0:00:53
      69500 -- (-772.211) [-770.631] (-770.760) (-771.970) * (-770.050) (-771.223) (-773.304) [-770.011] -- 0:01:06
      70000 -- [-771.365] (-770.554) (-771.119) (-773.509) * (-771.726) (-769.940) (-773.231) [-772.297] -- 0:01:06

      Average standard deviation of split frequencies: 0.020680

      70500 -- [-771.333] (-771.307) (-772.827) (-771.005) * (-771.728) [-771.632] (-776.214) (-773.289) -- 0:01:05
      71000 -- (-770.771) (-771.541) (-770.691) [-770.372] * (-771.309) (-772.270) [-774.025] (-772.877) -- 0:01:05
      71500 -- [-772.056] (-771.800) (-771.364) (-772.079) * (-774.984) (-770.141) [-773.469] (-774.397) -- 0:01:04
      72000 -- (-770.987) (-774.707) [-770.862] (-771.812) * [-770.402] (-770.372) (-770.447) (-774.329) -- 0:01:04
      72500 -- [-771.553] (-774.331) (-770.755) (-771.502) * (-772.489) (-772.727) [-771.126] (-772.408) -- 0:01:03
      73000 -- (-770.696) (-776.457) [-772.260] (-774.968) * (-772.678) [-771.626] (-771.267) (-772.130) -- 0:01:03
      73500 -- (-771.039) (-775.175) (-771.227) [-770.775] * (-770.660) (-771.979) [-770.169] (-774.209) -- 0:01:03
      74000 -- (-771.010) (-770.543) [-771.253] (-773.140) * (-773.997) [-770.210] (-770.168) (-771.701) -- 0:01:02
      74500 -- [-772.273] (-773.328) (-772.988) (-775.213) * (-778.154) [-773.698] (-773.575) (-775.137) -- 0:01:02
      75000 -- (-773.764) [-770.417] (-771.262) (-772.265) * (-776.473) (-774.395) (-773.223) [-772.357] -- 0:01:01

      Average standard deviation of split frequencies: 0.022640

      75500 -- (-774.980) [-773.035] (-770.710) (-774.001) * (-770.689) (-773.776) (-773.105) [-771.110] -- 0:01:01
      76000 -- (-776.084) (-775.580) [-771.387] (-775.083) * (-771.161) [-774.790] (-772.706) (-769.605) -- 0:01:00
      76500 -- (-771.804) (-772.668) [-772.512] (-770.634) * (-771.192) (-777.979) [-772.965] (-770.887) -- 0:01:00
      77000 -- (-771.819) (-773.416) (-780.609) [-772.141] * (-772.269) (-774.449) (-770.036) [-770.545] -- 0:00:59
      77500 -- (-773.191) (-774.835) (-774.457) [-771.773] * (-774.517) (-772.039) (-774.790) [-769.979] -- 0:00:59
      78000 -- (-770.826) (-770.798) (-776.351) [-772.038] * (-771.867) [-770.719] (-771.532) (-769.888) -- 0:00:59
      78500 -- [-771.713] (-771.305) (-775.108) (-771.255) * (-771.837) (-771.563) (-771.613) [-770.002] -- 0:00:58
      79000 -- (-774.372) [-771.867] (-773.288) (-771.257) * [-771.575] (-771.390) (-774.989) (-770.211) -- 0:00:58
      79500 -- (-770.214) (-771.390) (-773.987) [-771.107] * (-773.749) [-771.824] (-770.500) (-772.062) -- 0:00:57
      80000 -- [-771.449] (-773.949) (-772.548) (-771.555) * [-773.293] (-772.101) (-773.351) (-771.862) -- 0:00:57

      Average standard deviation of split frequencies: 0.019250

      80500 -- [-772.458] (-771.714) (-773.464) (-771.510) * (-771.376) (-771.462) (-771.924) [-772.671] -- 0:00:57
      81000 -- (-772.428) (-771.980) [-772.998] (-770.020) * (-773.095) (-770.040) (-770.816) [-773.345] -- 0:00:56
      81500 -- [-772.414] (-771.365) (-772.956) (-771.280) * (-772.092) (-769.964) [-770.565] (-771.245) -- 0:00:56
      82000 -- (-772.856) (-775.853) [-770.420] (-771.452) * [-777.574] (-777.137) (-772.325) (-773.341) -- 0:00:55
      82500 -- (-776.889) (-775.187) [-770.479] (-772.433) * (-774.136) (-773.276) [-771.036] (-771.741) -- 0:00:55
      83000 -- (-780.758) (-773.880) (-772.286) [-771.923] * [-773.991] (-770.695) (-772.101) (-770.461) -- 0:00:55
      83500 -- (-770.967) [-772.855] (-770.052) (-770.430) * (-771.051) (-772.378) (-771.497) [-770.739] -- 0:00:54
      84000 -- (-771.917) (-772.481) (-770.226) [-772.042] * [-771.423] (-770.703) (-770.761) (-771.333) -- 0:00:54
      84500 -- (-773.743) [-773.742] (-775.712) (-774.959) * [-770.380] (-770.986) (-771.833) (-772.681) -- 0:00:54
      85000 -- (-773.221) (-774.056) [-770.910] (-774.678) * [-770.841] (-771.952) (-770.583) (-774.564) -- 0:01:04

      Average standard deviation of split frequencies: 0.019490

      85500 -- (-772.194) (-774.096) (-770.863) [-771.909] * (-770.107) (-771.061) [-770.383] (-771.949) -- 0:01:04
      86000 -- (-770.283) (-771.340) (-770.842) [-771.989] * (-770.630) (-773.326) [-772.133] (-770.795) -- 0:01:03
      86500 -- (-773.576) (-771.848) [-773.677] (-774.552) * (-770.453) (-773.094) (-772.480) [-771.007] -- 0:01:03
      87000 -- (-771.130) [-771.965] (-773.619) (-774.414) * (-772.234) (-773.107) [-771.193] (-772.317) -- 0:01:02
      87500 -- [-771.317] (-771.251) (-771.373) (-775.412) * (-771.030) (-772.386) (-774.248) [-771.751] -- 0:01:02
      88000 -- (-770.778) (-772.162) (-773.383) [-770.076] * (-771.141) [-771.255] (-776.227) (-771.774) -- 0:01:02
      88500 -- [-771.079] (-771.252) (-772.444) (-770.980) * (-771.169) [-771.146] (-776.980) (-773.582) -- 0:01:01
      89000 -- (-771.161) [-774.487] (-772.266) (-772.041) * (-771.752) (-772.234) (-772.323) [-773.990] -- 0:01:01
      89500 -- [-770.896] (-771.340) (-771.330) (-772.340) * (-772.317) (-773.606) [-774.077] (-772.838) -- 0:01:01
      90000 -- (-771.152) (-775.795) (-778.063) [-771.286] * [-769.907] (-771.314) (-774.397) (-772.156) -- 0:01:00

      Average standard deviation of split frequencies: 0.021618

      90500 -- (-771.593) [-772.351] (-775.784) (-769.920) * [-772.318] (-770.649) (-771.148) (-771.917) -- 0:01:00
      91000 -- (-773.049) (-772.592) [-772.601] (-772.764) * (-772.527) (-777.432) [-771.063] (-773.437) -- 0:00:59
      91500 -- (-776.741) (-774.793) (-773.414) [-770.433] * (-769.969) (-775.950) (-771.107) [-771.347] -- 0:00:59
      92000 -- (-773.912) [-772.478] (-772.927) (-770.628) * (-770.256) (-771.747) (-769.857) [-770.670] -- 0:00:59
      92500 -- [-773.761] (-771.775) (-771.368) (-772.292) * (-773.576) (-774.660) (-778.587) [-774.541] -- 0:00:58
      93000 -- (-771.540) (-772.355) (-770.562) [-778.346] * [-770.879] (-770.883) (-774.900) (-776.603) -- 0:00:58
      93500 -- (-772.429) (-773.830) [-770.393] (-772.881) * (-770.648) [-772.396] (-772.413) (-772.813) -- 0:00:58
      94000 -- (-773.821) (-774.688) [-772.686] (-769.948) * [-773.604] (-771.362) (-772.643) (-771.117) -- 0:00:57
      94500 -- (-774.508) (-771.731) (-771.814) [-769.896] * [-774.147] (-773.291) (-773.682) (-771.979) -- 0:00:57
      95000 -- (-776.810) [-770.832] (-774.143) (-774.125) * [-774.037] (-771.957) (-771.225) (-774.037) -- 0:00:57

      Average standard deviation of split frequencies: 0.020624

      95500 -- (-773.855) (-769.803) (-777.280) [-774.484] * (-771.841) (-771.142) (-772.136) [-771.962] -- 0:00:56
      96000 -- (-770.008) [-770.952] (-774.241) (-774.704) * [-772.322] (-773.289) (-771.662) (-770.062) -- 0:00:56
      96500 -- (-772.392) (-771.702) [-772.564] (-772.366) * [-769.955] (-774.990) (-776.043) (-771.065) -- 0:00:56
      97000 -- (-773.926) (-773.804) (-771.699) [-771.669] * [-770.846] (-772.017) (-774.835) (-769.966) -- 0:00:55
      97500 -- (-772.704) (-774.657) (-771.390) [-771.993] * (-770.211) (-772.786) [-773.825] (-771.332) -- 0:00:55
      98000 -- [-772.731] (-771.418) (-771.587) (-770.571) * (-771.150) [-769.889] (-772.972) (-771.732) -- 0:00:55
      98500 -- [-772.618] (-771.554) (-769.979) (-770.868) * (-773.280) (-770.409) [-771.660] (-770.312) -- 0:00:54
      99000 -- [-772.228] (-771.863) (-773.440) (-770.403) * (-771.620) (-770.447) (-770.000) [-772.644] -- 0:00:54
      99500 -- (-772.645) (-772.405) [-774.462] (-770.292) * [-771.504] (-771.565) (-771.973) (-773.290) -- 0:00:54
      100000 -- (-771.036) [-771.601] (-772.645) (-774.406) * (-773.937) (-775.478) [-771.710] (-774.130) -- 0:00:54

      Average standard deviation of split frequencies: 0.017691

      100500 -- (-771.420) (-772.555) [-770.916] (-776.702) * (-772.211) (-772.397) [-770.887] (-773.162) -- 0:01:02
      101000 -- (-771.562) (-774.090) [-770.389] (-773.529) * [-773.490] (-772.498) (-771.550) (-774.090) -- 0:01:02
      101500 -- (-770.882) [-774.368] (-773.500) (-771.841) * (-773.846) [-771.646] (-771.510) (-773.221) -- 0:01:01
      102000 -- (-771.103) [-770.742] (-771.814) (-771.401) * [-777.220] (-776.296) (-770.450) (-770.555) -- 0:01:01
      102500 -- [-771.286] (-770.448) (-771.255) (-770.653) * (-771.261) (-778.203) [-769.882] (-772.500) -- 0:01:01
      103000 -- (-771.539) [-775.395] (-772.714) (-770.653) * (-771.196) (-777.844) [-770.302] (-772.396) -- 0:01:00
      103500 -- (-778.194) (-772.443) [-769.677] (-770.155) * (-777.022) (-773.796) (-770.918) [-771.287] -- 0:01:00
      104000 -- (-779.424) (-770.643) [-772.135] (-769.721) * [-774.053] (-777.714) (-773.996) (-774.763) -- 0:01:00
      104500 -- (-772.826) [-770.999] (-774.751) (-770.467) * (-775.843) (-773.350) [-775.713] (-775.665) -- 0:00:59
      105000 -- (-775.648) (-770.783) (-771.872) [-773.324] * (-775.635) (-773.924) (-774.406) [-770.214] -- 0:00:59

      Average standard deviation of split frequencies: 0.016619

      105500 -- (-778.662) (-771.743) (-771.904) [-771.953] * (-770.990) [-770.463] (-773.752) (-773.699) -- 0:00:59
      106000 -- (-773.210) (-772.580) (-775.534) [-770.289] * [-771.166] (-771.186) (-775.322) (-775.035) -- 0:00:59
      106500 -- [-775.904] (-774.028) (-770.193) (-771.944) * [-770.030] (-772.580) (-773.824) (-772.876) -- 0:00:58
      107000 -- (-771.677) (-772.165) [-770.850] (-772.921) * (-770.375) (-772.348) (-771.348) [-771.243] -- 0:00:58
      107500 -- (-777.434) (-776.785) (-773.948) [-772.995] * [-770.591] (-774.839) (-772.782) (-770.937) -- 0:00:58
      108000 -- (-770.688) (-775.067) [-771.633] (-773.280) * [-771.476] (-772.699) (-771.027) (-769.863) -- 0:00:57
      108500 -- (-770.126) [-772.476] (-773.801) (-778.689) * (-772.042) (-773.241) [-773.945] (-772.448) -- 0:00:57
      109000 -- (-772.434) [-772.016] (-771.056) (-777.221) * (-777.326) (-771.320) (-773.362) [-771.733] -- 0:00:57
      109500 -- [-772.632] (-771.834) (-776.203) (-772.720) * (-773.136) (-777.694) [-770.876] (-776.759) -- 0:00:56
      110000 -- (-772.728) (-772.171) (-770.723) [-771.279] * (-773.794) (-771.572) (-771.106) [-771.248] -- 0:00:56

      Average standard deviation of split frequencies: 0.019281

      110500 -- (-770.416) (-776.701) [-771.556] (-770.869) * (-773.421) [-773.003] (-774.217) (-772.345) -- 0:00:56
      111000 -- (-772.273) (-771.316) (-772.143) [-770.721] * (-778.039) [-773.590] (-777.960) (-772.003) -- 0:00:56
      111500 -- (-773.683) (-774.294) (-771.257) [-771.751] * [-771.352] (-771.349) (-772.830) (-771.931) -- 0:00:55
      112000 -- (-771.045) [-770.725] (-773.129) (-771.002) * [-774.834] (-770.311) (-771.632) (-769.815) -- 0:00:55
      112500 -- [-771.736] (-769.706) (-771.403) (-772.688) * [-770.349] (-770.250) (-771.954) (-771.019) -- 0:00:55
      113000 -- (-770.948) (-771.451) (-772.245) [-770.028] * (-772.166) (-772.390) [-771.413] (-772.792) -- 0:00:54
      113500 -- (-773.534) [-774.432] (-773.833) (-774.782) * (-771.384) (-770.806) [-774.580] (-774.386) -- 0:00:54
      114000 -- (-770.892) (-775.096) (-772.169) [-772.343] * (-773.494) (-771.111) [-772.681] (-774.457) -- 0:00:54
      114500 -- (-771.710) (-773.628) (-774.312) [-770.317] * (-772.487) [-771.505] (-776.387) (-774.292) -- 0:00:54
      115000 -- (-770.187) (-775.202) (-771.322) [-770.083] * [-770.633] (-771.505) (-773.514) (-771.313) -- 0:00:53

      Average standard deviation of split frequencies: 0.019250

      115500 -- [-769.674] (-771.038) (-771.872) (-769.913) * (-771.038) (-770.257) (-772.392) [-771.046] -- 0:00:53
      116000 -- [-770.756] (-774.989) (-774.561) (-769.922) * (-777.814) (-770.978) (-770.697) [-770.707] -- 0:00:53
      116500 -- (-773.942) (-773.022) (-778.409) [-770.590] * (-772.653) (-770.192) (-773.714) [-771.247] -- 0:01:00
      117000 -- (-775.197) (-771.546) (-772.225) [-775.656] * [-770.800] (-774.230) (-773.022) (-771.783) -- 0:01:00
      117500 -- (-777.660) (-773.777) [-771.481] (-773.717) * (-774.708) [-771.868] (-770.761) (-770.485) -- 0:01:00
      118000 -- [-772.403] (-771.308) (-772.135) (-774.017) * (-773.328) (-772.034) [-772.093] (-769.803) -- 0:00:59
      118500 -- (-770.468) [-771.923] (-771.724) (-770.178) * [-775.388] (-770.253) (-771.953) (-772.113) -- 0:00:59
      119000 -- (-769.579) (-773.450) (-773.516) [-770.109] * (-770.817) [-772.393] (-771.243) (-772.329) -- 0:00:59
      119500 -- (-769.584) [-772.350] (-774.127) (-771.285) * (-772.053) (-771.116) [-770.596] (-772.751) -- 0:00:58
      120000 -- (-771.311) (-774.644) [-771.691] (-770.802) * (-773.649) (-770.929) [-770.665] (-772.236) -- 0:00:58

      Average standard deviation of split frequencies: 0.018711

      120500 -- (-770.268) (-774.142) (-772.744) [-771.347] * (-772.397) [-771.677] (-771.031) (-775.112) -- 0:00:58
      121000 -- [-770.234] (-771.398) (-771.666) (-770.822) * (-772.429) [-774.153] (-771.003) (-773.018) -- 0:00:58
      121500 -- (-773.585) (-771.854) (-774.775) [-773.642] * (-770.470) (-773.119) (-773.124) [-771.757] -- 0:00:57
      122000 -- (-773.440) (-772.001) [-773.450] (-775.601) * [-770.570] (-773.432) (-773.258) (-774.300) -- 0:00:57
      122500 -- (-772.793) [-772.920] (-777.561) (-773.716) * [-770.802] (-774.711) (-772.060) (-770.643) -- 0:00:57
      123000 -- [-770.649] (-771.691) (-775.161) (-774.253) * (-771.392) (-770.851) [-770.051] (-771.000) -- 0:00:57
      123500 -- (-774.842) [-771.392] (-770.327) (-773.461) * (-770.804) (-773.366) (-770.224) [-771.861] -- 0:00:56
      124000 -- (-777.002) [-770.641] (-770.439) (-771.205) * [-773.011] (-771.776) (-771.765) (-773.447) -- 0:00:56
      124500 -- (-772.746) [-772.009] (-770.780) (-770.795) * [-773.258] (-770.508) (-776.155) (-774.426) -- 0:00:56
      125000 -- (-770.771) [-771.859] (-770.847) (-770.263) * (-773.368) (-772.023) [-771.014] (-771.069) -- 0:00:56

      Average standard deviation of split frequencies: 0.019100

      125500 -- (-773.043) (-771.965) (-770.729) [-769.548] * [-771.101] (-773.458) (-770.854) (-771.867) -- 0:00:55
      126000 -- [-777.022] (-770.831) (-772.265) (-771.418) * (-772.191) (-775.306) (-774.619) [-771.718] -- 0:00:55
      126500 -- (-776.806) (-770.586) [-771.062] (-770.615) * (-773.206) (-772.487) (-775.051) [-771.141] -- 0:00:55
      127000 -- (-773.705) [-771.053] (-770.127) (-770.686) * (-774.034) [-771.781] (-771.864) (-774.810) -- 0:00:54
      127500 -- (-776.091) (-772.221) (-770.039) [-770.177] * (-771.306) (-773.284) (-772.433) [-773.540] -- 0:00:54
      128000 -- (-775.106) (-771.466) (-772.026) [-770.895] * (-771.527) [-771.883] (-773.312) (-771.227) -- 0:00:54
      128500 -- (-771.985) [-770.992] (-771.044) (-770.208) * (-772.306) [-772.653] (-770.861) (-772.828) -- 0:00:54
      129000 -- (-771.988) [-773.695] (-770.706) (-777.094) * [-773.485] (-770.752) (-771.053) (-778.051) -- 0:00:54
      129500 -- (-772.074) (-774.611) [-771.158] (-773.229) * (-772.018) (-771.860) [-772.036] (-773.286) -- 0:00:53
      130000 -- (-772.313) (-770.879) [-769.747] (-776.075) * (-770.390) [-772.469] (-770.215) (-770.518) -- 0:00:53

      Average standard deviation of split frequencies: 0.019642

      130500 -- [-773.404] (-774.961) (-770.512) (-772.410) * (-770.075) (-775.334) [-770.892] (-769.845) -- 0:00:53
      131000 -- [-771.689] (-770.724) (-771.186) (-771.248) * (-769.704) [-771.791] (-773.656) (-769.844) -- 0:00:53
      131500 -- (-772.361) [-770.640] (-772.742) (-770.943) * (-777.669) (-773.912) (-778.039) [-769.991] -- 0:00:52
      132000 -- (-774.422) [-771.124] (-772.513) (-771.000) * [-772.310] (-771.794) (-772.343) (-771.513) -- 0:00:52
      132500 -- (-775.269) (-772.302) [-769.855] (-770.499) * (-772.738) [-772.248] (-776.784) (-772.035) -- 0:00:52
      133000 -- (-777.814) (-770.849) (-770.728) [-771.135] * (-771.475) (-769.735) (-772.336) [-771.408] -- 0:00:58
      133500 -- (-771.817) (-770.539) (-769.998) [-772.224] * (-770.306) (-776.233) (-771.438) [-773.164] -- 0:00:58
      134000 -- [-774.725] (-771.097) (-773.472) (-771.021) * (-772.518) (-774.481) [-772.911] (-773.251) -- 0:00:58
      134500 -- (-771.759) [-771.524] (-771.581) (-771.688) * (-771.996) [-772.784] (-773.555) (-774.456) -- 0:00:57
      135000 -- (-771.847) (-773.206) (-772.694) [-771.973] * (-770.659) (-771.291) [-772.065] (-771.011) -- 0:00:57

      Average standard deviation of split frequencies: 0.019064

      135500 -- (-779.966) (-774.262) (-773.494) [-771.462] * (-772.729) [-774.934] (-771.667) (-771.699) -- 0:00:57
      136000 -- (-775.956) (-775.163) (-770.173) [-771.587] * (-772.076) [-770.365] (-773.367) (-771.306) -- 0:00:57
      136500 -- (-770.667) (-773.537) [-770.327] (-771.377) * (-772.270) [-769.893] (-776.648) (-773.201) -- 0:00:56
      137000 -- (-775.213) [-772.440] (-773.056) (-775.046) * (-771.385) [-769.815] (-775.455) (-772.016) -- 0:00:56
      137500 -- (-775.143) [-772.285] (-773.742) (-775.161) * (-772.534) (-771.922) (-772.977) [-771.742] -- 0:00:56
      138000 -- (-771.025) [-775.719] (-774.495) (-775.058) * [-773.407] (-773.639) (-770.375) (-772.367) -- 0:00:56
      138500 -- (-771.662) (-775.997) (-772.808) [-771.129] * [-770.943] (-770.841) (-770.530) (-773.621) -- 0:00:55
      139000 -- (-770.867) (-776.819) (-773.350) [-771.928] * [-772.655] (-774.913) (-773.436) (-771.606) -- 0:00:55
      139500 -- (-770.247) (-775.227) (-773.731) [-771.676] * [-771.921] (-771.805) (-770.918) (-773.929) -- 0:00:55
      140000 -- [-773.178] (-775.605) (-777.704) (-773.147) * [-771.586] (-772.178) (-772.750) (-773.764) -- 0:00:55

      Average standard deviation of split frequencies: 0.020989

      140500 -- [-771.960] (-770.734) (-771.694) (-774.313) * (-770.939) [-772.970] (-772.401) (-773.646) -- 0:00:55
      141000 -- [-771.048] (-773.324) (-771.677) (-775.385) * (-774.069) (-772.769) [-772.374] (-771.215) -- 0:00:54
      141500 -- [-772.226] (-771.258) (-772.652) (-771.698) * [-771.732] (-770.308) (-772.378) (-771.553) -- 0:00:54
      142000 -- (-771.704) [-771.320] (-772.145) (-772.008) * (-771.534) [-770.497] (-774.889) (-772.325) -- 0:00:54
      142500 -- (-771.059) (-772.752) [-771.874] (-772.283) * (-770.690) [-770.199] (-769.996) (-770.693) -- 0:00:54
      143000 -- (-772.752) [-771.647] (-770.692) (-771.553) * (-771.816) (-772.461) (-772.603) [-771.062] -- 0:00:53
      143500 -- [-770.528] (-771.839) (-770.709) (-772.202) * [-770.706] (-773.776) (-773.160) (-770.193) -- 0:00:53
      144000 -- [-770.852] (-773.954) (-771.219) (-773.796) * (-772.218) (-774.856) (-772.830) [-771.161] -- 0:00:53
      144500 -- (-772.851) [-772.801] (-772.755) (-772.473) * (-770.996) (-770.037) [-770.962] (-772.712) -- 0:00:53
      145000 -- [-774.131] (-772.110) (-773.826) (-771.810) * (-773.680) [-771.661] (-773.449) (-772.610) -- 0:00:53

      Average standard deviation of split frequencies: 0.019713

      145500 -- (-772.627) (-770.481) (-772.323) [-770.398] * (-775.181) (-776.289) (-771.011) [-772.887] -- 0:00:52
      146000 -- (-771.345) [-771.660] (-773.893) (-773.550) * (-773.908) (-769.970) (-771.755) [-769.712] -- 0:00:52
      146500 -- [-771.679] (-772.841) (-772.804) (-770.949) * (-772.493) (-770.302) (-770.567) [-773.130] -- 0:00:52
      147000 -- [-770.075] (-770.088) (-774.618) (-774.863) * [-777.913] (-772.065) (-770.364) (-772.157) -- 0:00:52
      147500 -- [-770.407] (-772.517) (-770.970) (-775.707) * (-771.478) (-772.775) [-772.013] (-771.640) -- 0:00:52
      148000 -- (-772.221) (-773.852) (-770.848) [-778.813] * (-770.599) (-771.825) (-770.916) [-770.209] -- 0:00:51
      148500 -- (-772.027) (-777.530) (-771.493) [-774.674] * (-772.064) [-772.319] (-771.058) (-771.547) -- 0:00:51
      149000 -- (-775.504) (-772.351) (-771.271) [-771.560] * (-770.896) (-773.920) (-778.538) [-771.192] -- 0:00:51
      149500 -- (-770.941) (-770.392) [-771.748] (-771.474) * [-773.530] (-770.297) (-774.345) (-772.205) -- 0:00:56
      150000 -- (-772.405) (-771.872) (-772.195) [-771.582] * (-770.727) (-775.053) [-771.033] (-771.865) -- 0:00:56

      Average standard deviation of split frequencies: 0.020511

      150500 -- [-773.610] (-771.725) (-771.159) (-780.833) * [-770.964] (-773.380) (-775.021) (-771.324) -- 0:00:56
      151000 -- (-772.411) [-771.002] (-773.825) (-774.333) * (-770.574) (-773.806) (-772.444) [-771.562] -- 0:00:56
      151500 -- (-772.268) [-771.731] (-772.338) (-774.104) * [-771.619] (-770.234) (-772.840) (-770.247) -- 0:00:56
      152000 -- (-772.093) (-774.122) [-772.534] (-772.059) * (-772.166) [-770.715] (-770.406) (-771.835) -- 0:00:55
      152500 -- [-772.555] (-773.406) (-772.655) (-772.055) * [-772.804] (-770.584) (-770.707) (-770.301) -- 0:00:55
      153000 -- [-771.820] (-773.737) (-773.610) (-772.926) * [-772.232] (-772.892) (-773.236) (-772.893) -- 0:00:55
      153500 -- (-771.874) (-771.681) (-772.130) [-772.657] * [-771.168] (-770.271) (-771.951) (-774.023) -- 0:00:55
      154000 -- (-770.702) [-769.942] (-772.061) (-771.457) * (-770.735) (-774.817) [-773.752] (-771.985) -- 0:00:54
      154500 -- (-771.148) (-772.303) [-771.903] (-773.035) * (-779.398) (-770.659) (-771.155) [-772.038] -- 0:00:54
      155000 -- (-772.084) (-771.267) (-770.645) [-771.638] * (-772.079) [-773.750] (-772.794) (-772.386) -- 0:00:54

      Average standard deviation of split frequencies: 0.020817

      155500 -- (-773.478) (-774.367) [-775.321] (-772.080) * (-771.058) (-775.026) (-771.723) [-773.169] -- 0:00:54
      156000 -- (-772.489) [-770.598] (-771.726) (-773.900) * (-775.871) (-770.581) (-778.487) [-770.296] -- 0:00:54
      156500 -- [-772.666] (-771.963) (-770.661) (-776.717) * [-773.144] (-770.108) (-770.802) (-771.061) -- 0:00:53
      157000 -- [-771.709] (-771.949) (-771.039) (-772.266) * (-774.220) (-771.120) (-772.522) [-771.124] -- 0:00:53
      157500 -- (-773.050) (-771.047) [-769.825] (-772.939) * (-771.775) [-770.169] (-770.514) (-771.348) -- 0:00:53
      158000 -- (-773.328) (-770.921) (-770.818) [-772.529] * [-773.940] (-773.074) (-771.792) (-772.222) -- 0:00:53
      158500 -- (-770.372) (-770.303) [-772.491] (-771.278) * (-772.307) [-773.694] (-770.938) (-772.292) -- 0:00:53
      159000 -- (-770.762) (-770.471) (-773.228) [-771.359] * (-771.168) (-772.231) [-770.820] (-772.074) -- 0:00:52
      159500 -- (-771.562) [-770.646] (-774.032) (-772.229) * (-771.191) (-771.558) [-770.822] (-770.756) -- 0:00:52
      160000 -- (-771.159) [-773.968] (-774.071) (-772.326) * [-770.209] (-771.810) (-771.026) (-770.840) -- 0:00:52

      Average standard deviation of split frequencies: 0.020193

      160500 -- (-770.403) (-775.687) [-776.607] (-772.784) * (-771.785) (-772.247) [-776.796] (-770.351) -- 0:00:52
      161000 -- (-771.103) [-773.029] (-771.249) (-772.437) * (-771.277) [-771.480] (-771.398) (-774.452) -- 0:00:52
      161500 -- (-774.581) (-773.135) [-773.665] (-773.147) * (-773.193) [-771.206] (-772.078) (-770.404) -- 0:00:51
      162000 -- [-769.980] (-773.134) (-771.389) (-771.822) * (-771.660) (-771.210) [-771.922] (-770.195) -- 0:00:51
      162500 -- [-771.571] (-773.957) (-771.922) (-771.196) * (-771.926) [-773.210] (-771.363) (-775.454) -- 0:00:51
      163000 -- (-771.618) [-770.868] (-772.730) (-772.650) * [-771.644] (-772.181) (-770.939) (-770.398) -- 0:00:51
      163500 -- [-771.686] (-774.322) (-771.675) (-772.562) * [-771.918] (-774.316) (-771.552) (-771.559) -- 0:00:51
      164000 -- (-771.654) (-771.552) [-772.091] (-772.765) * (-772.171) (-773.651) [-772.938] (-775.058) -- 0:00:50
      164500 -- [-772.446] (-772.185) (-770.400) (-770.168) * (-771.127) [-771.910] (-775.744) (-773.720) -- 0:00:50
      165000 -- (-774.776) (-775.095) [-770.547] (-770.179) * [-772.486] (-773.259) (-772.919) (-775.603) -- 0:00:50

      Average standard deviation of split frequencies: 0.019131

      165500 -- (-772.843) (-774.868) (-771.084) [-771.724] * (-771.377) [-770.918] (-776.589) (-772.607) -- 0:00:50
      166000 -- (-776.359) (-773.825) (-771.153) [-770.436] * (-772.810) [-772.857] (-774.140) (-771.143) -- 0:00:55
      166500 -- (-772.498) (-770.721) [-771.139] (-770.279) * (-773.751) (-776.852) [-772.705] (-773.588) -- 0:00:55
      167000 -- [-773.520] (-776.615) (-774.940) (-770.650) * (-773.390) [-776.947] (-775.654) (-771.428) -- 0:00:54
      167500 -- (-773.067) (-773.885) [-772.196] (-772.400) * (-771.749) (-769.971) [-772.030] (-770.244) -- 0:00:54
      168000 -- (-771.226) (-771.857) (-771.541) [-769.842] * (-773.064) [-771.924] (-773.584) (-771.703) -- 0:00:54
      168500 -- [-773.216] (-771.706) (-773.458) (-769.851) * (-773.844) (-772.109) [-772.810] (-770.167) -- 0:00:54
      169000 -- [-774.721] (-773.251) (-771.671) (-773.243) * (-771.677) (-772.410) [-769.716] (-770.649) -- 0:00:54
      169500 -- [-771.580] (-772.671) (-772.880) (-772.493) * [-773.535] (-771.836) (-772.289) (-769.945) -- 0:00:53
      170000 -- (-772.602) (-773.647) [-773.267] (-773.673) * (-771.459) (-771.895) [-770.465] (-770.884) -- 0:00:53

      Average standard deviation of split frequencies: 0.020563

      170500 -- [-770.877] (-771.707) (-773.143) (-771.316) * (-771.750) (-776.542) [-772.965] (-769.946) -- 0:00:53
      171000 -- (-771.212) [-770.665] (-772.126) (-771.387) * (-774.879) (-775.230) (-775.576) [-769.957] -- 0:00:53
      171500 -- (-774.449) [-769.915] (-779.961) (-771.467) * (-772.602) (-774.254) (-771.314) [-770.396] -- 0:00:53
      172000 -- (-775.212) [-772.244] (-773.089) (-774.098) * (-775.987) (-772.475) (-770.639) [-770.064] -- 0:00:52
      172500 -- (-770.741) [-777.475] (-771.825) (-771.241) * [-776.345] (-772.852) (-774.245) (-770.894) -- 0:00:52
      173000 -- (-770.467) (-772.243) [-772.438] (-771.266) * (-775.487) (-771.623) [-772.796] (-770.551) -- 0:00:52
      173500 -- (-770.820) (-769.997) [-772.491] (-769.842) * (-772.927) (-771.426) [-773.295] (-771.092) -- 0:00:52
      174000 -- (-770.892) (-771.121) (-770.685) [-772.478] * [-775.874] (-772.937) (-770.982) (-772.339) -- 0:00:52
      174500 -- [-771.884] (-773.446) (-770.890) (-771.939) * (-772.280) [-770.929] (-771.035) (-772.268) -- 0:00:52
      175000 -- [-770.164] (-774.279) (-773.139) (-769.998) * (-775.328) (-770.795) (-772.154) [-776.955] -- 0:00:51

      Average standard deviation of split frequencies: 0.021743

      175500 -- (-774.259) [-774.552] (-772.286) (-771.727) * (-771.495) [-771.112] (-771.683) (-776.427) -- 0:00:51
      176000 -- (-773.779) (-770.118) (-771.222) [-772.100] * (-770.765) (-773.578) [-771.256] (-774.834) -- 0:00:51
      176500 -- (-770.024) (-772.607) [-774.067] (-773.232) * [-771.192] (-773.917) (-770.416) (-770.966) -- 0:00:51
      177000 -- (-771.154) (-774.795) (-771.769) [-771.070] * (-772.571) (-772.084) (-770.633) [-769.986] -- 0:00:51
      177500 -- [-772.849] (-770.797) (-772.050) (-776.799) * (-776.432) (-771.050) (-771.288) [-770.894] -- 0:00:50
      178000 -- (-773.776) [-774.055] (-776.569) (-771.105) * (-773.455) [-769.995] (-771.956) (-774.077) -- 0:00:50
      178500 -- [-772.685] (-771.091) (-774.986) (-771.131) * (-773.139) (-772.128) (-772.640) [-771.602] -- 0:00:50
      179000 -- (-771.687) (-770.089) [-773.561] (-770.786) * (-772.374) (-771.797) (-773.630) [-771.712] -- 0:00:50
      179500 -- (-771.076) (-770.064) [-772.246] (-771.725) * [-772.730] (-771.276) (-773.361) (-773.354) -- 0:00:50
      180000 -- (-774.713) (-773.259) (-771.257) [-771.196] * (-773.823) (-770.564) (-773.664) [-770.187] -- 0:00:50

      Average standard deviation of split frequencies: 0.022179

      180500 -- (-771.060) (-769.608) (-770.720) [-771.672] * (-773.080) (-770.381) (-774.103) [-771.997] -- 0:00:49
      181000 -- (-770.527) (-771.111) (-772.228) [-771.095] * (-770.098) (-770.776) [-772.127] (-774.461) -- 0:00:49
      181500 -- (-771.586) (-771.327) (-770.501) [-772.835] * [-770.166] (-771.823) (-771.504) (-771.430) -- 0:00:49
      182000 -- (-771.524) (-771.053) (-774.898) [-771.970] * (-774.257) (-771.545) [-772.115] (-771.580) -- 0:00:49
      182500 -- (-772.886) [-772.192] (-775.184) (-771.373) * (-769.981) (-771.649) (-774.544) [-772.304] -- 0:00:53
      183000 -- (-771.340) (-777.496) [-773.665] (-770.277) * (-769.946) (-771.938) (-773.016) [-772.336] -- 0:00:53
      183500 -- (-774.892) (-773.513) [-774.990] (-770.133) * (-770.490) (-776.355) (-771.184) [-770.211] -- 0:00:53
      184000 -- (-770.291) (-770.712) (-770.745) [-771.160] * (-771.654) (-775.778) (-770.861) [-772.536] -- 0:00:53
      184500 -- (-773.575) [-771.011] (-770.690) (-771.454) * [-771.601] (-770.948) (-774.822) (-771.430) -- 0:00:53
      185000 -- (-772.822) (-773.806) [-770.583] (-772.736) * (-769.999) (-773.071) (-771.890) [-770.221] -- 0:00:52

      Average standard deviation of split frequencies: 0.022410

      185500 -- (-770.839) (-771.786) (-775.171) [-771.717] * (-771.594) [-775.329] (-776.122) (-772.365) -- 0:00:52
      186000 -- (-771.474) (-771.507) (-772.315) [-773.798] * (-773.993) (-771.681) (-772.049) [-769.850] -- 0:00:52
      186500 -- (-771.677) (-774.102) [-772.995] (-771.106) * (-775.834) [-772.466] (-772.072) (-775.836) -- 0:00:52
      187000 -- [-771.308] (-771.141) (-772.091) (-769.816) * [-772.893] (-773.340) (-771.808) (-771.170) -- 0:00:52
      187500 -- [-772.767] (-770.877) (-770.504) (-770.387) * (-772.270) (-775.250) (-773.209) [-774.334] -- 0:00:52
      188000 -- (-777.393) (-770.909) (-771.843) [-770.509] * (-770.268) (-774.147) (-775.557) [-772.381] -- 0:00:51
      188500 -- [-773.419] (-774.464) (-772.641) (-771.063) * [-770.644] (-773.091) (-771.751) (-771.466) -- 0:00:51
      189000 -- [-772.560] (-775.423) (-770.146) (-771.861) * (-776.298) (-773.281) (-770.761) [-770.229] -- 0:00:51
      189500 -- (-773.576) (-777.723) [-774.794] (-770.376) * (-776.812) (-773.885) [-770.274] (-772.689) -- 0:00:51
      190000 -- (-776.823) [-770.615] (-772.762) (-771.786) * (-776.944) (-772.320) [-770.897] (-773.008) -- 0:00:51

      Average standard deviation of split frequencies: 0.023293

      190500 -- (-771.411) (-772.161) (-771.164) [-771.602] * (-777.545) [-773.775] (-771.044) (-771.618) -- 0:00:50
      191000 -- [-774.471] (-771.992) (-770.925) (-773.244) * (-779.029) [-771.432] (-772.662) (-774.309) -- 0:00:50
      191500 -- [-773.019] (-773.672) (-770.548) (-770.922) * (-771.652) (-773.099) [-775.292] (-775.330) -- 0:00:50
      192000 -- (-775.689) (-770.912) (-770.550) [-770.496] * (-770.110) (-770.192) (-772.034) [-775.295] -- 0:00:50
      192500 -- (-775.429) [-773.343] (-770.864) (-771.286) * [-770.752] (-770.733) (-771.592) (-773.246) -- 0:00:50
      193000 -- (-772.092) (-774.259) [-771.902] (-771.738) * (-772.512) (-771.203) [-771.792] (-772.403) -- 0:00:50
      193500 -- [-770.345] (-770.642) (-775.357) (-773.061) * [-771.088] (-773.955) (-773.667) (-773.974) -- 0:00:50
      194000 -- (-772.384) [-773.175] (-772.018) (-770.815) * (-773.672) (-773.713) [-771.418] (-774.438) -- 0:00:49
      194500 -- (-775.461) (-775.893) (-770.101) [-770.763] * (-772.356) (-772.217) [-770.250] (-779.947) -- 0:00:49
      195000 -- (-770.425) [-773.065] (-771.553) (-771.980) * (-772.115) (-771.893) [-770.257] (-773.223) -- 0:00:49

      Average standard deviation of split frequencies: 0.021188

      195500 -- (-770.497) (-769.866) (-771.379) [-771.996] * (-775.093) (-770.882) [-771.116] (-771.299) -- 0:00:49
      196000 -- (-769.864) (-769.756) (-771.956) [-772.717] * (-771.620) [-772.687] (-773.838) (-775.341) -- 0:00:49
      196500 -- [-771.639] (-770.756) (-771.157) (-770.778) * (-774.809) (-773.642) [-771.371] (-772.352) -- 0:00:49
      197000 -- [-770.408] (-772.673) (-771.729) (-777.613) * (-778.651) (-778.038) [-773.360] (-770.816) -- 0:00:48
      197500 -- (-770.510) [-772.534] (-772.304) (-774.502) * (-776.483) (-774.874) [-770.036] (-769.991) -- 0:00:48
      198000 -- (-770.261) [-772.293] (-773.729) (-772.262) * (-775.810) (-775.669) (-771.477) [-771.121] -- 0:00:48
      198500 -- (-772.716) (-773.047) (-770.569) [-775.504] * (-770.612) (-774.637) (-772.374) [-771.205] -- 0:00:48
      199000 -- (-773.588) (-770.301) [-772.558] (-772.509) * (-774.511) (-770.535) (-772.175) [-770.737] -- 0:00:52
      199500 -- [-772.623] (-770.576) (-771.837) (-770.950) * (-772.791) (-771.253) (-771.614) [-770.284] -- 0:00:52
      200000 -- (-773.611) (-772.230) (-772.873) [-775.312] * (-771.261) (-772.521) (-770.555) [-770.527] -- 0:00:51

      Average standard deviation of split frequencies: 0.022256

      200500 -- (-771.834) [-772.470] (-771.692) (-774.217) * [-772.018] (-770.397) (-777.376) (-770.642) -- 0:00:51
      201000 -- (-772.242) (-775.804) (-771.746) [-771.859] * [-772.129] (-769.759) (-774.122) (-772.997) -- 0:00:51
      201500 -- (-772.529) [-771.781] (-772.569) (-772.605) * [-773.315] (-770.759) (-775.487) (-774.308) -- 0:00:51
      202000 -- (-773.976) (-772.082) [-771.180] (-771.549) * (-771.598) [-771.645] (-771.114) (-775.153) -- 0:00:51
      202500 -- [-770.602] (-771.773) (-770.729) (-774.721) * (-772.853) (-771.501) [-771.421] (-770.452) -- 0:00:51
      203000 -- [-772.473] (-775.014) (-771.855) (-775.230) * (-774.966) (-772.439) [-771.156] (-770.743) -- 0:00:51
      203500 -- (-770.617) (-773.586) [-772.215] (-773.292) * (-772.166) (-771.129) [-771.982] (-769.984) -- 0:00:50
      204000 -- (-769.932) [-776.674] (-771.600) (-771.008) * [-772.329] (-772.292) (-775.089) (-772.428) -- 0:00:50
      204500 -- (-772.348) (-770.755) (-772.290) [-775.675] * (-774.379) (-772.461) (-771.475) [-771.996] -- 0:00:50
      205000 -- [-770.049] (-777.558) (-770.873) (-775.140) * [-771.337] (-770.654) (-772.883) (-771.722) -- 0:00:50

      Average standard deviation of split frequencies: 0.021358

      205500 -- (-770.022) (-771.180) (-772.337) [-774.837] * [-770.413] (-771.694) (-773.239) (-772.221) -- 0:00:50
      206000 -- (-770.431) [-771.089] (-778.222) (-772.649) * [-773.269] (-773.602) (-774.544) (-770.737) -- 0:00:50
      206500 -- (-769.669) (-771.566) (-775.542) [-771.847] * (-770.691) [-770.659] (-771.680) (-770.922) -- 0:00:49
      207000 -- (-771.004) [-770.958] (-774.192) (-774.188) * [-770.279] (-773.650) (-770.730) (-773.237) -- 0:00:49
      207500 -- (-771.027) [-772.232] (-773.287) (-770.525) * (-771.425) (-777.279) [-770.922] (-771.438) -- 0:00:49
      208000 -- (-771.361) (-771.196) [-771.971] (-773.543) * [-772.611] (-772.966) (-770.295) (-775.524) -- 0:00:49
      208500 -- (-769.886) (-771.255) [-771.164] (-770.945) * [-772.703] (-770.015) (-770.847) (-775.147) -- 0:00:49
      209000 -- [-771.245] (-771.745) (-770.656) (-772.821) * (-775.011) (-770.973) [-771.469] (-770.891) -- 0:00:49
      209500 -- [-772.364] (-771.358) (-775.512) (-771.665) * [-772.819] (-770.483) (-771.973) (-770.201) -- 0:00:49
      210000 -- [-770.693] (-774.417) (-774.628) (-772.921) * [-774.329] (-771.213) (-772.612) (-770.286) -- 0:00:48

      Average standard deviation of split frequencies: 0.023201

      210500 -- (-771.464) [-776.442] (-771.896) (-773.978) * (-775.808) [-773.310] (-773.935) (-774.629) -- 0:00:48
      211000 -- (-770.441) (-771.060) [-775.254] (-772.907) * (-771.725) (-771.391) (-773.688) [-774.537] -- 0:00:48
      211500 -- (-773.824) [-772.027] (-781.915) (-773.764) * (-770.367) [-770.310] (-771.627) (-771.767) -- 0:00:48
      212000 -- (-773.993) (-771.257) [-776.210] (-770.423) * (-771.204) [-770.648] (-775.882) (-770.531) -- 0:00:48
      212500 -- (-772.376) (-770.962) [-771.420] (-770.297) * (-771.721) [-770.180] (-773.570) (-770.965) -- 0:00:48
      213000 -- [-773.093] (-770.792) (-769.781) (-770.396) * (-769.795) (-770.247) (-775.130) [-773.225] -- 0:00:48
      213500 -- (-771.540) (-779.191) [-772.581] (-776.681) * [-773.553] (-770.631) (-774.668) (-773.263) -- 0:00:47
      214000 -- (-773.200) (-773.937) [-770.913] (-772.079) * (-771.622) (-771.401) [-776.664] (-773.792) -- 0:00:47
      214500 -- (-772.423) [-774.178] (-772.664) (-774.883) * (-772.389) [-770.191] (-774.958) (-773.712) -- 0:00:47
      215000 -- (-772.587) [-773.855] (-771.612) (-771.571) * [-771.278] (-777.676) (-770.368) (-772.379) -- 0:00:47

      Average standard deviation of split frequencies: 0.021279

      215500 -- (-773.689) (-770.309) [-771.763] (-775.846) * (-770.440) (-771.572) [-775.148] (-774.359) -- 0:00:50
      216000 -- (-773.814) [-771.019] (-772.932) (-772.562) * (-771.169) (-772.634) [-773.303] (-774.672) -- 0:00:50
      216500 -- (-772.410) (-773.812) [-770.190] (-771.255) * (-773.430) (-771.600) (-770.435) [-771.233] -- 0:00:50
      217000 -- [-771.049] (-774.119) (-771.098) (-774.375) * (-770.889) [-770.387] (-772.286) (-773.807) -- 0:00:50
      217500 -- [-770.504] (-774.489) (-772.884) (-773.706) * (-770.658) (-771.117) (-772.370) [-772.949] -- 0:00:50
      218000 -- (-771.742) [-774.213] (-773.064) (-772.574) * (-771.877) (-772.008) (-770.810) [-771.184] -- 0:00:50
      218500 -- (-773.089) (-770.910) (-772.523) [-771.884] * (-771.267) (-770.754) (-771.748) [-771.329] -- 0:00:50
      219000 -- [-770.201] (-775.245) (-771.799) (-771.777) * (-771.666) (-774.093) (-770.681) [-770.378] -- 0:00:49
      219500 -- (-774.621) [-777.510] (-773.668) (-772.975) * (-776.382) [-771.222] (-771.777) (-772.194) -- 0:00:49
      220000 -- (-773.011) (-772.057) [-774.018] (-770.343) * [-771.758] (-772.555) (-771.219) (-770.799) -- 0:00:49

      Average standard deviation of split frequencies: 0.022368

      220500 -- (-773.452) (-772.453) (-771.916) [-773.950] * (-771.970) (-770.230) [-770.065] (-774.288) -- 0:00:49
      221000 -- (-772.290) (-775.129) [-772.942] (-775.721) * (-771.381) (-773.571) (-772.616) [-774.768] -- 0:00:49
      221500 -- (-774.176) (-770.563) (-771.332) [-771.534] * (-771.450) (-771.501) [-771.303] (-773.411) -- 0:00:49
      222000 -- (-776.146) (-771.123) [-771.166] (-775.978) * (-777.054) (-773.920) (-771.347) [-775.094] -- 0:00:49
      222500 -- (-771.610) (-770.308) [-770.641] (-775.638) * [-775.381] (-775.288) (-771.149) (-772.225) -- 0:00:48
      223000 -- (-770.346) (-771.571) (-770.726) [-774.557] * (-781.724) (-772.195) (-773.193) [-772.390] -- 0:00:48
      223500 -- (-771.117) [-771.474] (-772.354) (-770.702) * (-780.265) (-772.191) (-774.510) [-771.926] -- 0:00:48
      224000 -- (-769.965) (-772.936) [-772.390] (-775.207) * (-775.779) (-771.944) [-771.932] (-770.559) -- 0:00:48
      224500 -- [-772.206] (-771.507) (-772.831) (-771.497) * [-771.077] (-770.880) (-772.248) (-770.460) -- 0:00:48
      225000 -- (-771.638) (-773.517) [-771.290] (-771.275) * (-772.576) [-769.700] (-771.263) (-770.030) -- 0:00:48

      Average standard deviation of split frequencies: 0.020163

      225500 -- [-769.782] (-772.479) (-774.005) (-771.588) * (-770.313) (-773.293) [-771.667] (-771.132) -- 0:00:48
      226000 -- (-769.714) (-771.608) (-770.078) [-773.858] * [-772.780] (-777.795) (-777.718) (-772.983) -- 0:00:47
      226500 -- (-771.294) (-772.690) [-772.169] (-771.358) * (-773.330) [-772.221] (-770.374) (-773.216) -- 0:00:47
      227000 -- (-771.787) (-771.170) (-774.758) [-771.267] * (-771.354) [-775.350] (-773.448) (-772.721) -- 0:00:47
      227500 -- (-771.388) [-772.321] (-772.151) (-770.054) * (-771.076) (-778.805) (-770.557) [-771.172] -- 0:00:47
      228000 -- (-773.533) [-770.992] (-771.231) (-771.646) * (-771.809) [-772.285] (-770.591) (-773.846) -- 0:00:47
      228500 -- (-771.366) (-770.943) [-771.985] (-771.821) * (-772.070) (-774.183) (-772.420) [-771.035] -- 0:00:47
      229000 -- (-771.520) (-770.597) [-772.748] (-772.967) * (-774.013) [-772.184] (-771.801) (-770.042) -- 0:00:47
      229500 -- (-769.903) (-772.208) [-770.927] (-774.268) * (-771.526) (-774.493) [-773.112] (-771.313) -- 0:00:47
      230000 -- (-772.393) (-770.437) [-772.752] (-776.059) * (-770.042) [-770.343] (-773.745) (-769.880) -- 0:00:50

      Average standard deviation of split frequencies: 0.019982

      230500 -- [-772.363] (-773.244) (-772.632) (-772.986) * (-773.000) (-772.384) [-772.054] (-770.154) -- 0:00:50
      231000 -- [-772.232] (-771.232) (-772.511) (-770.352) * [-771.483] (-776.930) (-774.403) (-773.478) -- 0:00:49
      231500 -- (-771.085) (-772.595) (-772.127) [-771.807] * (-770.885) (-774.751) (-776.951) [-771.823] -- 0:00:49
      232000 -- (-772.695) (-771.178) (-774.991) [-771.253] * (-772.294) (-776.246) (-773.215) [-770.411] -- 0:00:49
      232500 -- [-771.860] (-777.438) (-771.783) (-771.908) * (-774.621) [-770.856] (-775.608) (-771.819) -- 0:00:49
      233000 -- [-771.086] (-771.421) (-772.130) (-772.453) * (-773.369) (-771.288) [-771.175] (-771.910) -- 0:00:49
      233500 -- [-771.561] (-769.875) (-779.930) (-772.343) * (-772.633) (-770.775) [-771.584] (-772.317) -- 0:00:49
      234000 -- [-775.660] (-771.282) (-774.776) (-769.992) * (-771.773) (-771.927) [-770.071] (-774.251) -- 0:00:49
      234500 -- (-773.662) (-771.880) [-770.659] (-771.696) * (-775.135) [-773.760] (-770.120) (-774.416) -- 0:00:48
      235000 -- [-772.440] (-776.448) (-773.835) (-772.550) * [-770.952] (-771.004) (-773.435) (-771.037) -- 0:00:48

      Average standard deviation of split frequencies: 0.020308

      235500 -- (-771.470) [-773.729] (-773.279) (-771.127) * (-772.803) (-773.918) [-770.841] (-770.871) -- 0:00:48
      236000 -- (-770.702) (-772.721) (-773.254) [-770.577] * (-772.217) [-774.468] (-770.776) (-772.135) -- 0:00:48
      236500 -- (-774.969) (-774.398) [-771.283] (-772.407) * (-771.600) (-772.247) [-771.558] (-772.582) -- 0:00:48
      237000 -- [-771.313] (-770.948) (-772.327) (-777.794) * (-770.826) [-772.958] (-773.277) (-774.041) -- 0:00:48
      237500 -- (-771.095) [-770.619] (-771.394) (-774.675) * (-774.525) [-772.704] (-777.475) (-772.786) -- 0:00:48
      238000 -- (-775.536) (-771.255) [-772.497] (-773.907) * [-772.988] (-777.385) (-772.836) (-773.237) -- 0:00:48
      238500 -- (-771.088) (-771.382) [-770.430] (-774.443) * (-774.386) (-775.302) [-771.533] (-773.209) -- 0:00:47
      239000 -- (-769.957) (-771.555) [-771.575] (-775.065) * (-770.265) (-776.413) (-774.121) [-771.775] -- 0:00:47
      239500 -- (-773.570) [-770.734] (-774.685) (-776.520) * [-772.306] (-771.193) (-774.160) (-773.328) -- 0:00:47
      240000 -- (-772.639) (-770.631) [-772.833] (-774.379) * (-769.651) (-770.603) (-773.664) [-771.290] -- 0:00:47

      Average standard deviation of split frequencies: 0.018499

      240500 -- (-771.618) (-771.847) [-771.297] (-772.382) * (-775.363) [-773.143] (-774.834) (-770.814) -- 0:00:47
      241000 -- (-773.885) [-771.270] (-773.468) (-775.156) * (-772.750) (-772.501) (-770.825) [-773.704] -- 0:00:47
      241500 -- (-770.788) (-770.512) (-770.201) [-771.199] * (-769.631) (-773.597) (-771.423) [-771.535] -- 0:00:47
      242000 -- [-773.013] (-772.451) (-771.575) (-773.518) * (-771.713) (-776.487) [-773.821] (-775.597) -- 0:00:46
      242500 -- (-776.192) [-771.655] (-780.484) (-772.224) * (-770.011) [-771.247] (-772.687) (-774.664) -- 0:00:46
      243000 -- (-778.118) (-770.862) [-774.241] (-774.291) * (-769.917) (-773.239) [-774.267] (-775.394) -- 0:00:46
      243500 -- (-774.915) (-770.574) [-772.659] (-770.782) * (-771.754) (-771.154) [-771.572] (-773.155) -- 0:00:46
      244000 -- [-772.845] (-770.670) (-771.386) (-770.466) * (-770.407) (-773.003) (-774.721) [-770.462] -- 0:00:46
      244500 -- (-777.386) (-771.400) [-772.254] (-771.161) * [-772.439] (-772.059) (-772.377) (-771.058) -- 0:00:46
      245000 -- [-771.238] (-770.789) (-771.852) (-772.051) * (-770.919) (-774.724) (-773.081) [-771.427] -- 0:00:46

      Average standard deviation of split frequencies: 0.019163

      245500 -- [-772.775] (-770.022) (-771.950) (-772.998) * [-772.117] (-770.454) (-777.001) (-771.834) -- 0:00:46
      246000 -- (-773.486) (-770.229) [-772.851] (-771.947) * (-778.131) [-772.737] (-770.467) (-772.740) -- 0:00:49
      246500 -- (-770.767) (-771.178) [-776.273] (-771.028) * (-772.658) [-770.981] (-770.732) (-771.304) -- 0:00:48
      247000 -- (-772.483) (-771.946) [-771.306] (-770.913) * (-772.484) (-770.667) [-770.136] (-771.038) -- 0:00:48
      247500 -- (-772.068) [-770.983] (-772.361) (-771.595) * (-770.833) (-771.337) [-771.484] (-770.432) -- 0:00:48
      248000 -- (-770.880) (-772.766) [-772.738] (-771.003) * (-770.919) [-773.107] (-771.028) (-771.482) -- 0:00:48
      248500 -- (-773.901) [-771.383] (-771.750) (-770.592) * (-770.461) (-770.618) [-772.248] (-773.053) -- 0:00:48
      249000 -- (-772.333) [-772.523] (-774.429) (-772.149) * (-772.931) [-770.419] (-771.757) (-772.134) -- 0:00:48
      249500 -- [-771.357] (-775.694) (-772.574) (-773.576) * (-772.422) (-771.860) [-771.632] (-772.859) -- 0:00:48
      250000 -- [-772.490] (-771.513) (-778.471) (-772.177) * (-771.347) [-771.241] (-774.889) (-772.369) -- 0:00:48

      Average standard deviation of split frequencies: 0.017239

      250500 -- (-773.938) (-770.889) [-770.740] (-771.786) * (-771.956) (-772.411) [-773.705] (-770.669) -- 0:00:47
      251000 -- (-773.155) (-770.926) [-772.653] (-770.891) * [-771.472] (-771.261) (-774.210) (-773.160) -- 0:00:47
      251500 -- (-774.815) (-772.005) (-772.707) [-772.495] * (-772.593) (-777.044) (-773.366) [-770.489] -- 0:00:47
      252000 -- [-772.614] (-770.951) (-771.711) (-770.506) * [-774.724] (-773.442) (-773.733) (-770.671) -- 0:00:47
      252500 -- (-774.180) [-770.736] (-772.007) (-771.709) * [-771.075] (-770.502) (-771.625) (-771.413) -- 0:00:47
      253000 -- [-772.821] (-773.530) (-774.532) (-772.327) * (-770.745) [-772.175] (-770.109) (-775.490) -- 0:00:47
      253500 -- (-773.467) [-772.214] (-778.921) (-773.351) * [-772.603] (-771.575) (-777.130) (-771.651) -- 0:00:47
      254000 -- (-771.923) (-770.248) [-775.440] (-770.905) * (-771.078) (-776.788) [-772.700] (-776.096) -- 0:00:46
      254500 -- (-772.432) (-770.788) [-775.849] (-771.789) * (-772.812) (-772.116) (-771.240) [-773.158] -- 0:00:46
      255000 -- (-771.912) [-770.762] (-772.938) (-771.430) * (-774.656) [-770.981] (-770.778) (-772.654) -- 0:00:46

      Average standard deviation of split frequencies: 0.016368

      255500 -- (-771.023) [-771.391] (-773.636) (-774.380) * (-772.984) [-771.518] (-773.019) (-776.872) -- 0:00:46
      256000 -- (-771.290) (-771.735) (-772.609) [-771.515] * (-773.101) [-772.184] (-774.938) (-770.844) -- 0:00:46
      256500 -- (-773.589) (-774.899) [-774.122] (-772.140) * (-772.157) [-772.190] (-781.467) (-775.198) -- 0:00:46
      257000 -- (-771.846) (-773.407) (-774.041) [-771.831] * (-771.201) (-774.015) (-774.827) [-770.774] -- 0:00:46
      257500 -- [-770.501] (-772.128) (-775.196) (-771.188) * (-770.966) (-772.894) (-773.646) [-773.593] -- 0:00:46
      258000 -- [-774.235] (-771.135) (-775.284) (-771.521) * (-773.109) [-769.883] (-772.300) (-776.858) -- 0:00:46
      258500 -- (-772.112) (-772.821) (-771.235) [-770.341] * (-770.783) (-771.985) (-773.298) [-770.503] -- 0:00:45
      259000 -- (-773.542) (-774.297) [-771.132] (-775.506) * (-776.402) [-772.916] (-774.361) (-780.646) -- 0:00:45
      259500 -- (-773.579) (-773.100) [-770.649] (-778.827) * (-772.708) [-772.483] (-773.169) (-773.483) -- 0:00:45
      260000 -- (-773.343) [-772.053] (-770.834) (-777.745) * (-774.798) (-770.722) (-774.162) [-771.114] -- 0:00:45

      Average standard deviation of split frequencies: 0.016489

      260500 -- [-771.665] (-771.018) (-772.806) (-773.352) * [-772.506] (-772.115) (-769.850) (-773.657) -- 0:00:45
      261000 -- (-771.320) (-774.257) [-772.553] (-777.105) * (-772.019) [-774.013] (-771.066) (-774.755) -- 0:00:45
      261500 -- (-770.937) (-771.853) [-770.239] (-770.423) * (-770.584) (-773.007) (-772.457) [-773.244] -- 0:00:45
      262000 -- (-771.630) (-772.656) (-771.941) [-769.745] * (-772.001) (-771.485) (-771.316) [-770.966] -- 0:00:45
      262500 -- (-771.295) (-773.764) (-774.692) [-773.919] * (-773.814) (-774.167) (-774.072) [-769.772] -- 0:00:47
      263000 -- (-771.944) (-770.144) (-771.430) [-774.729] * (-773.905) [-774.867] (-771.330) (-772.830) -- 0:00:47
      263500 -- (-770.901) (-772.680) [-770.656] (-770.927) * (-772.279) [-770.810] (-770.724) (-772.778) -- 0:00:47
      264000 -- (-770.724) (-771.519) [-770.615] (-771.769) * (-771.435) (-773.094) (-774.190) [-774.278] -- 0:00:47
      264500 -- (-770.347) (-773.912) [-770.018] (-774.473) * (-770.257) (-771.435) [-771.565] (-772.038) -- 0:00:47
      265000 -- (-772.511) (-775.079) (-776.456) [-772.146] * (-770.303) [-771.623] (-771.327) (-775.593) -- 0:00:47

      Average standard deviation of split frequencies: 0.015753

      265500 -- (-771.940) (-776.103) (-770.666) [-772.040] * (-769.577) (-772.551) [-775.229] (-771.258) -- 0:00:47
      266000 -- (-774.283) (-770.796) (-772.891) [-772.921] * (-770.288) (-773.032) (-774.100) [-771.955] -- 0:00:46
      266500 -- (-771.326) [-772.448] (-770.243) (-774.523) * [-772.772] (-771.769) (-773.036) (-774.874) -- 0:00:46
      267000 -- (-771.466) (-770.309) (-779.765) [-770.958] * (-771.961) (-770.931) (-775.297) [-771.782] -- 0:00:46
      267500 -- [-770.981] (-775.062) (-772.315) (-771.784) * (-775.860) [-771.939] (-774.930) (-777.238) -- 0:00:46
      268000 -- (-770.672) [-773.100] (-770.202) (-771.963) * (-772.177) [-772.066] (-771.983) (-772.090) -- 0:00:46
      268500 -- (-770.652) [-773.837] (-773.257) (-772.083) * (-771.550) (-771.513) [-771.022] (-774.204) -- 0:00:46
      269000 -- [-773.703] (-773.877) (-771.813) (-770.687) * (-773.954) (-771.102) [-771.616] (-778.183) -- 0:00:46
      269500 -- (-772.624) (-771.967) (-772.255) [-772.547] * (-772.424) [-770.522] (-772.701) (-771.131) -- 0:00:46
      270000 -- [-770.691] (-773.976) (-775.204) (-773.980) * (-774.897) (-770.530) (-773.044) [-770.201] -- 0:00:45

      Average standard deviation of split frequencies: 0.016392

      270500 -- [-770.497] (-772.889) (-772.169) (-773.531) * (-770.886) (-772.177) (-771.987) [-770.185] -- 0:00:45
      271000 -- (-770.196) [-773.341] (-771.039) (-770.377) * (-769.953) (-772.800) (-770.833) [-775.104] -- 0:00:45
      271500 -- [-775.359] (-771.464) (-769.713) (-770.519) * [-771.598] (-773.571) (-774.467) (-772.506) -- 0:00:45
      272000 -- (-773.554) (-769.986) [-770.009] (-771.641) * (-772.186) (-771.855) [-772.490] (-770.924) -- 0:00:45
      272500 -- (-770.908) (-771.308) [-770.197] (-773.279) * (-772.643) (-770.997) (-772.020) [-771.739] -- 0:00:45
      273000 -- (-772.043) [-770.509] (-770.475) (-774.510) * (-772.450) (-771.186) [-772.756] (-770.477) -- 0:00:45
      273500 -- (-771.763) [-770.904] (-770.170) (-775.842) * (-774.227) [-770.635] (-773.258) (-770.273) -- 0:00:45
      274000 -- [-772.546] (-770.613) (-770.176) (-772.706) * (-771.844) [-770.288] (-769.817) (-770.181) -- 0:00:45
      274500 -- [-772.879] (-770.896) (-770.183) (-771.075) * (-771.765) (-771.540) (-771.231) [-771.962] -- 0:00:44
      275000 -- (-778.668) (-771.495) [-769.637] (-771.170) * (-771.761) [-772.078] (-770.413) (-775.404) -- 0:00:44

      Average standard deviation of split frequencies: 0.015372

      275500 -- (-771.461) (-771.284) (-770.812) [-771.008] * (-772.187) (-774.791) (-770.725) [-771.878] -- 0:00:44
      276000 -- (-771.362) (-773.393) [-770.457] (-771.911) * (-772.543) [-771.799] (-771.238) (-772.322) -- 0:00:44
      276500 -- (-775.050) (-770.689) (-771.361) [-770.736] * (-772.232) [-771.526] (-770.214) (-776.448) -- 0:00:44
      277000 -- (-779.866) [-771.028] (-775.582) (-770.001) * (-771.314) [-773.452] (-771.921) (-771.002) -- 0:00:44
      277500 -- [-772.489] (-772.169) (-772.168) (-771.289) * [-771.586] (-771.759) (-770.043) (-774.378) -- 0:00:44
      278000 -- [-772.596] (-772.715) (-772.094) (-771.674) * (-771.118) (-773.491) [-770.162] (-776.537) -- 0:00:44
      278500 -- [-771.938] (-770.289) (-770.990) (-773.328) * (-772.036) (-771.544) (-770.825) [-773.102] -- 0:00:44
      279000 -- (-779.369) (-770.905) (-771.538) [-772.977] * (-770.187) (-774.419) [-770.151] (-770.392) -- 0:00:46
      279500 -- (-776.239) (-769.880) [-771.522] (-770.378) * (-769.821) [-773.173] (-770.007) (-772.288) -- 0:00:46
      280000 -- (-772.789) [-776.628] (-771.784) (-771.395) * [-770.218] (-770.195) (-770.835) (-773.983) -- 0:00:46

      Average standard deviation of split frequencies: 0.013140

      280500 -- [-771.027] (-774.093) (-773.658) (-771.615) * [-771.186] (-771.501) (-770.340) (-772.028) -- 0:00:46
      281000 -- (-774.575) (-770.037) [-772.336] (-773.423) * (-769.836) (-771.724) (-773.698) [-772.132] -- 0:00:46
      281500 -- (-773.311) (-774.769) [-771.476] (-772.082) * (-773.564) [-770.530] (-771.317) (-770.439) -- 0:00:45
      282000 -- (-771.557) (-775.736) (-773.353) [-772.878] * (-770.190) (-774.456) [-770.647] (-772.396) -- 0:00:45
      282500 -- (-772.436) (-770.598) (-775.126) [-769.864] * (-771.953) (-775.966) [-770.710] (-772.598) -- 0:00:45
      283000 -- (-771.230) [-770.372] (-771.243) (-772.662) * (-771.244) (-772.188) (-771.156) [-771.376] -- 0:00:45
      283500 -- (-771.942) [-769.866] (-770.881) (-772.040) * (-772.953) (-769.989) (-772.044) [-771.395] -- 0:00:45
      284000 -- (-770.699) [-769.835] (-771.857) (-772.833) * (-770.432) (-770.620) [-771.762] (-771.756) -- 0:00:45
      284500 -- [-770.100] (-771.814) (-771.989) (-771.635) * (-771.229) [-772.212] (-772.522) (-772.822) -- 0:00:45
      285000 -- (-772.118) [-772.544] (-772.615) (-771.437) * [-770.009] (-772.085) (-772.072) (-771.640) -- 0:00:45

      Average standard deviation of split frequencies: 0.014059

      285500 -- (-774.228) (-771.726) [-776.245] (-772.136) * (-771.532) (-772.317) (-771.779) [-771.774] -- 0:00:45
      286000 -- (-777.454) [-770.826] (-771.862) (-769.942) * (-773.163) (-775.690) [-771.140] (-770.065) -- 0:00:44
      286500 -- (-773.580) (-770.864) (-771.677) [-773.597] * (-777.518) (-772.517) (-773.627) [-771.243] -- 0:00:44
      287000 -- (-770.621) (-772.731) (-770.341) [-775.266] * (-778.977) (-770.445) [-770.242] (-772.727) -- 0:00:44
      287500 -- (-772.589) [-772.790] (-769.863) (-775.335) * (-771.951) (-770.295) [-771.825] (-771.126) -- 0:00:44
      288000 -- (-771.002) (-772.354) (-772.191) [-771.171] * (-776.965) (-771.563) (-771.601) [-771.080] -- 0:00:44
      288500 -- (-771.574) (-772.755) [-771.411] (-772.745) * (-772.152) (-772.639) [-774.348] (-773.439) -- 0:00:44
      289000 -- (-771.429) (-771.243) [-770.770] (-773.702) * (-774.696) (-772.815) (-777.361) [-770.600] -- 0:00:44
      289500 -- [-773.448] (-776.294) (-774.948) (-772.975) * (-771.894) (-770.948) (-773.052) [-770.593] -- 0:00:44
      290000 -- (-770.229) [-770.870] (-770.652) (-770.174) * (-778.025) [-771.006] (-771.419) (-774.897) -- 0:00:44

      Average standard deviation of split frequencies: 0.012784

      290500 -- (-774.156) (-771.294) (-775.003) [-770.950] * (-777.560) [-772.128] (-771.146) (-773.683) -- 0:00:43
      291000 -- [-770.358] (-772.948) (-773.861) (-771.468) * (-772.682) [-770.922] (-770.241) (-775.335) -- 0:00:43
      291500 -- (-773.815) [-774.230] (-772.355) (-772.964) * (-772.651) [-771.383] (-770.359) (-773.040) -- 0:00:43
      292000 -- (-771.667) (-774.839) [-775.130] (-770.363) * (-773.282) (-770.668) (-772.036) [-770.564] -- 0:00:43
      292500 -- (-776.661) (-771.426) (-773.498) [-772.108] * (-772.432) (-771.065) [-771.684] (-772.577) -- 0:00:43
      293000 -- (-772.057) [-772.735] (-772.310) (-771.307) * (-770.677) (-772.164) [-772.036] (-772.667) -- 0:00:43
      293500 -- [-771.358] (-770.506) (-772.361) (-771.534) * (-770.440) (-770.096) [-770.493] (-772.507) -- 0:00:43
      294000 -- (-772.940) [-770.645] (-773.293) (-771.531) * [-770.753] (-773.143) (-773.725) (-770.222) -- 0:00:43
      294500 -- (-772.792) [-772.091] (-770.759) (-771.830) * (-771.075) (-774.750) [-773.024] (-770.393) -- 0:00:43
      295000 -- (-774.595) (-770.953) (-773.815) [-771.261] * [-770.983] (-773.804) (-771.904) (-772.213) -- 0:00:43

      Average standard deviation of split frequencies: 0.013022

      295500 -- [-771.105] (-772.570) (-772.027) (-773.742) * (-771.070) (-771.096) [-771.552] (-772.061) -- 0:00:45
      296000 -- (-770.194) [-771.617] (-771.243) (-778.578) * (-772.196) (-770.898) (-773.976) [-769.828] -- 0:00:45
      296500 -- (-770.311) [-777.914] (-770.917) (-774.005) * (-775.094) (-770.360) (-770.725) [-770.375] -- 0:00:45
      297000 -- (-771.011) [-772.033] (-771.545) (-773.053) * (-773.521) [-772.760] (-771.519) (-772.547) -- 0:00:44
      297500 -- [-771.442] (-771.018) (-771.203) (-770.648) * [-774.056] (-772.478) (-772.606) (-772.112) -- 0:00:44
      298000 -- (-770.405) (-771.307) [-771.366] (-770.899) * (-770.444) (-772.368) [-773.078] (-772.437) -- 0:00:44
      298500 -- (-771.821) (-773.023) (-774.441) [-770.450] * [-770.270] (-776.281) (-774.221) (-772.415) -- 0:00:44
      299000 -- (-772.712) (-771.062) [-770.914] (-771.585) * [-776.801] (-775.335) (-774.166) (-777.566) -- 0:00:44
      299500 -- (-776.973) (-770.179) (-771.274) [-770.047] * [-771.768] (-771.513) (-771.088) (-773.080) -- 0:00:44
      300000 -- (-771.427) [-771.069] (-770.882) (-770.864) * (-775.391) (-770.926) [-771.933] (-773.394) -- 0:00:44

      Average standard deviation of split frequencies: 0.012635

      300500 -- (-773.939) [-769.815] (-773.133) (-770.689) * (-775.968) (-771.203) [-770.606] (-781.153) -- 0:00:44
      301000 -- [-772.622] (-770.983) (-771.171) (-769.968) * (-776.263) (-771.141) (-770.843) [-776.126] -- 0:00:44
      301500 -- [-772.997] (-774.348) (-776.066) (-770.514) * (-773.461) (-774.469) (-775.063) [-775.096] -- 0:00:44
      302000 -- [-772.173] (-771.540) (-772.644) (-770.676) * (-773.202) (-776.196) [-771.667] (-773.308) -- 0:00:43
      302500 -- (-772.509) (-772.148) [-771.016] (-770.466) * (-775.930) (-775.840) [-770.912] (-772.313) -- 0:00:43
      303000 -- (-772.575) (-772.851) (-771.788) [-771.667] * (-771.441) (-772.451) [-770.166] (-771.113) -- 0:00:43
      303500 -- (-771.034) [-772.737] (-771.952) (-771.474) * (-770.757) (-773.894) (-770.618) [-770.763] -- 0:00:43
      304000 -- (-771.360) (-770.969) [-774.000] (-771.215) * (-777.567) (-770.808) (-771.066) [-771.240] -- 0:00:43
      304500 -- (-771.106) (-772.470) [-771.551] (-774.928) * (-769.834) [-772.319] (-773.640) (-770.580) -- 0:00:43
      305000 -- (-772.307) [-770.428] (-774.455) (-772.872) * (-769.882) (-770.559) (-770.476) [-771.673] -- 0:00:43

      Average standard deviation of split frequencies: 0.012415

      305500 -- (-770.605) (-771.391) (-775.657) [-771.123] * (-769.557) (-771.377) (-774.749) [-770.740] -- 0:00:43
      306000 -- [-771.147] (-770.281) (-773.378) (-771.044) * (-770.634) (-771.924) [-773.109] (-770.254) -- 0:00:43
      306500 -- [-772.088] (-772.027) (-772.451) (-773.206) * (-773.203) (-770.608) (-772.601) [-772.423] -- 0:00:42
      307000 -- [-772.082] (-775.300) (-773.745) (-771.541) * (-771.341) (-772.470) (-770.087) [-771.307] -- 0:00:42
      307500 -- [-770.285] (-772.725) (-773.016) (-775.200) * (-770.625) (-771.151) (-770.571) [-771.205] -- 0:00:42
      308000 -- [-770.398] (-773.086) (-778.119) (-772.302) * (-774.243) (-775.842) (-770.640) [-770.059] -- 0:00:42
      308500 -- (-770.671) (-774.985) (-770.927) [-772.059] * [-771.687] (-774.762) (-773.565) (-773.621) -- 0:00:42
      309000 -- (-770.348) (-772.230) [-771.558] (-770.841) * [-772.912] (-771.559) (-775.032) (-778.306) -- 0:00:42
      309500 -- (-771.069) [-772.718] (-777.345) (-770.994) * (-774.841) [-771.046] (-773.488) (-773.658) -- 0:00:42
      310000 -- [-772.809] (-773.719) (-775.383) (-771.156) * [-771.117] (-770.666) (-771.127) (-772.311) -- 0:00:42

      Average standard deviation of split frequencies: 0.012585

      310500 -- (-773.769) [-772.376] (-775.330) (-775.036) * (-771.171) (-771.573) [-771.665] (-770.792) -- 0:00:42
      311000 -- (-772.529) [-770.621] (-777.511) (-773.425) * [-771.439] (-771.982) (-773.561) (-769.909) -- 0:00:44
      311500 -- (-773.300) (-772.068) (-774.445) [-773.523] * (-772.207) (-777.703) (-770.244) [-769.647] -- 0:00:44
      312000 -- (-773.797) (-770.521) [-778.635] (-771.352) * (-771.713) (-773.073) [-770.422] (-770.998) -- 0:00:44
      312500 -- (-773.500) (-773.806) [-773.007] (-771.855) * [-774.977] (-774.579) (-771.808) (-773.819) -- 0:00:44
      313000 -- (-772.830) (-772.039) [-771.822] (-772.499) * (-772.071) (-774.914) [-772.448] (-771.084) -- 0:00:43
      313500 -- (-773.545) (-773.846) [-771.577] (-771.811) * [-771.654] (-772.649) (-769.983) (-774.742) -- 0:00:43
      314000 -- (-774.518) [-770.582] (-770.546) (-774.787) * (-773.956) (-771.184) (-771.780) [-772.617] -- 0:00:43
      314500 -- (-774.781) [-771.569] (-772.205) (-772.493) * (-770.988) [-772.655] (-772.794) (-773.289) -- 0:00:43
      315000 -- [-770.488] (-772.447) (-774.488) (-771.252) * [-770.350] (-771.274) (-772.352) (-772.567) -- 0:00:43

      Average standard deviation of split frequencies: 0.013163

      315500 -- (-776.945) (-772.875) [-773.739] (-771.141) * (-771.168) [-771.062] (-773.538) (-770.153) -- 0:00:43
      316000 -- (-775.449) (-771.539) [-777.134] (-772.046) * (-770.562) (-770.562) [-771.743] (-775.797) -- 0:00:43
      316500 -- (-772.827) [-772.018] (-773.631) (-772.801) * (-770.266) [-772.611] (-773.062) (-774.116) -- 0:00:43
      317000 -- (-770.594) [-771.670] (-773.821) (-773.970) * [-773.596] (-771.318) (-774.005) (-773.230) -- 0:00:43
      317500 -- (-775.539) (-769.673) [-770.793] (-770.933) * (-771.064) [-770.688] (-770.115) (-773.187) -- 0:00:42
      318000 -- (-772.614) [-771.525] (-771.660) (-773.839) * (-772.825) (-770.628) (-772.681) [-772.612] -- 0:00:42
      318500 -- (-772.269) (-773.347) (-770.507) [-770.902] * [-770.897] (-771.379) (-772.307) (-771.748) -- 0:00:42
      319000 -- (-772.400) (-773.911) [-772.422] (-772.579) * [-771.075] (-773.616) (-773.586) (-772.856) -- 0:00:42
      319500 -- (-772.586) (-773.940) [-771.581] (-773.910) * (-774.805) (-771.912) [-773.845] (-773.556) -- 0:00:42
      320000 -- (-772.854) [-771.218] (-770.868) (-772.830) * (-774.571) (-770.999) (-769.830) [-771.317] -- 0:00:42

      Average standard deviation of split frequencies: 0.011934

      320500 -- (-774.541) (-774.192) (-772.741) [-772.365] * (-771.528) (-773.927) (-770.483) [-772.716] -- 0:00:42
      321000 -- (-772.467) (-775.650) [-772.586] (-773.216) * [-771.350] (-775.151) (-771.489) (-772.322) -- 0:00:42
      321500 -- [-772.188] (-776.400) (-772.867) (-773.244) * (-770.718) [-770.122] (-771.637) (-774.873) -- 0:00:42
      322000 -- (-770.571) (-774.176) [-777.481] (-773.107) * (-771.297) (-774.913) (-773.401) [-770.729] -- 0:00:42
      322500 -- (-770.769) (-771.240) [-772.688] (-773.821) * (-770.988) (-774.719) (-772.229) [-770.611] -- 0:00:42
      323000 -- (-776.760) (-772.201) [-775.424] (-772.808) * (-772.358) (-776.673) (-777.320) [-770.990] -- 0:00:41
      323500 -- (-771.422) [-771.464] (-772.635) (-774.053) * (-771.538) (-773.490) [-772.096] (-771.140) -- 0:00:41
      324000 -- [-770.372] (-771.824) (-773.294) (-772.788) * (-771.938) [-771.799] (-772.319) (-771.613) -- 0:00:41
      324500 -- (-771.369) (-773.657) (-771.742) [-774.985] * (-772.772) [-770.475] (-774.202) (-772.187) -- 0:00:41
      325000 -- (-771.657) (-780.801) (-776.415) [-771.139] * (-771.155) (-770.305) (-775.499) [-772.383] -- 0:00:41

      Average standard deviation of split frequencies: 0.012674

      325500 -- (-772.171) (-771.713) [-772.787] (-773.005) * [-769.990] (-771.010) (-774.228) (-774.356) -- 0:00:41
      326000 -- (-770.151) (-771.758) [-772.064] (-772.153) * (-771.037) (-771.336) [-771.738] (-772.755) -- 0:00:41
      326500 -- [-772.065] (-775.500) (-777.414) (-771.591) * [-774.252] (-771.652) (-771.552) (-772.949) -- 0:00:41
      327000 -- [-771.290] (-770.811) (-775.282) (-770.733) * [-771.130] (-772.405) (-774.225) (-771.251) -- 0:00:43
      327500 -- [-770.838] (-770.811) (-770.915) (-772.652) * (-771.511) (-771.439) [-772.153] (-771.067) -- 0:00:43
      328000 -- [-773.507] (-770.335) (-771.046) (-771.689) * (-773.280) (-771.386) (-770.391) [-771.748] -- 0:00:43
      328500 -- (-772.259) [-773.968] (-771.059) (-771.649) * (-770.637) [-771.881] (-773.298) (-772.843) -- 0:00:42
      329000 -- (-771.944) (-774.143) [-770.900] (-775.012) * (-773.069) [-771.798] (-773.663) (-771.498) -- 0:00:42
      329500 -- (-771.633) (-769.941) (-772.325) [-771.816] * (-772.757) [-770.921] (-771.180) (-771.225) -- 0:00:42
      330000 -- (-772.487) (-770.823) (-773.432) [-772.588] * (-771.962) [-769.903] (-772.738) (-770.665) -- 0:00:42

      Average standard deviation of split frequencies: 0.011321

      330500 -- (-772.012) (-770.316) [-772.287] (-770.311) * (-771.493) (-775.061) [-769.600] (-772.629) -- 0:00:42
      331000 -- (-772.031) (-773.726) (-769.978) [-771.575] * (-771.246) (-775.411) [-770.097] (-771.475) -- 0:00:42
      331500 -- [-770.288] (-778.172) (-769.979) (-774.175) * (-770.498) [-775.849] (-770.365) (-771.493) -- 0:00:42
      332000 -- (-770.914) (-772.392) (-771.516) [-771.382] * (-772.963) (-771.122) (-771.779) [-772.129] -- 0:00:42
      332500 -- (-773.493) [-771.614] (-770.817) (-769.897) * (-770.145) (-774.105) (-773.555) [-773.040] -- 0:00:42
      333000 -- (-773.225) (-772.433) [-773.442] (-772.621) * (-773.746) (-770.734) [-775.638] (-776.177) -- 0:00:42
      333500 -- (-771.364) (-770.108) [-772.540] (-771.383) * (-773.875) (-772.816) (-776.519) [-773.359] -- 0:00:41
      334000 -- (-770.216) (-770.488) (-772.107) [-774.604] * (-772.278) [-772.712] (-772.343) (-771.911) -- 0:00:41
      334500 -- [-772.843] (-772.731) (-770.648) (-771.632) * (-774.898) (-770.496) [-772.457] (-770.339) -- 0:00:41
      335000 -- (-774.582) (-774.020) (-777.072) [-774.532] * (-772.004) [-771.019] (-769.916) (-773.627) -- 0:00:41

      Average standard deviation of split frequencies: 0.010729

      335500 -- (-770.156) [-771.254] (-773.852) (-770.833) * (-775.132) [-772.745] (-773.121) (-773.625) -- 0:00:41
      336000 -- (-770.302) [-772.811] (-770.683) (-770.433) * (-770.167) (-771.461) [-772.775] (-773.809) -- 0:00:41
      336500 -- (-770.280) (-772.607) [-771.726] (-773.088) * (-769.834) (-772.348) [-770.447] (-775.666) -- 0:00:41
      337000 -- [-772.290] (-772.162) (-773.241) (-775.712) * (-769.859) [-770.473] (-770.055) (-775.198) -- 0:00:41
      337500 -- (-772.031) [-771.866] (-777.816) (-772.330) * [-772.542] (-769.972) (-771.913) (-773.457) -- 0:00:41
      338000 -- (-771.716) (-773.718) (-778.129) [-775.872] * [-772.405] (-770.915) (-770.524) (-772.807) -- 0:00:41
      338500 -- (-772.949) [-771.758] (-771.189) (-770.367) * (-772.675) (-771.769) [-771.701] (-772.880) -- 0:00:41
      339000 -- (-770.564) (-771.662) [-770.641] (-772.597) * (-776.792) [-770.640] (-771.757) (-771.053) -- 0:00:40
      339500 -- (-771.521) (-772.069) [-771.172] (-772.211) * (-774.019) [-773.488] (-771.583) (-771.323) -- 0:00:40
      340000 -- (-774.669) (-772.663) (-771.815) [-773.717] * (-775.973) (-770.621) [-771.814] (-775.311) -- 0:00:40

      Average standard deviation of split frequencies: 0.010093

      340500 -- (-775.365) (-770.905) [-770.953] (-770.683) * (-773.365) [-770.621] (-770.887) (-776.055) -- 0:00:40
      341000 -- (-770.389) (-771.459) [-773.804] (-774.423) * (-770.310) [-772.249] (-770.072) (-773.544) -- 0:00:40
      341500 -- (-770.947) (-770.417) (-774.564) [-772.011] * (-773.049) [-770.969] (-770.558) (-776.305) -- 0:00:40
      342000 -- (-771.938) [-773.644] (-781.167) (-773.817) * (-770.466) (-774.020) [-771.764] (-771.995) -- 0:00:40
      342500 -- (-770.724) [-775.175] (-776.844) (-773.082) * [-772.043] (-771.839) (-772.547) (-773.754) -- 0:00:40
      343000 -- (-771.187) (-770.964) (-771.862) [-770.118] * [-770.001] (-772.143) (-771.880) (-774.888) -- 0:00:40
      343500 -- (-778.790) (-774.993) (-770.613) [-772.710] * (-772.142) (-772.297) [-771.874] (-770.811) -- 0:00:40
      344000 -- (-773.177) [-772.866] (-773.539) (-771.326) * (-773.002) [-771.616] (-772.287) (-770.642) -- 0:00:41
      344500 -- (-773.393) (-773.616) [-772.639] (-774.129) * [-771.125] (-775.183) (-772.082) (-770.416) -- 0:00:41
      345000 -- (-770.831) (-772.171) [-770.618] (-771.681) * [-770.717] (-773.927) (-770.339) (-771.297) -- 0:00:41

      Average standard deviation of split frequencies: 0.010659

      345500 -- [-772.869] (-771.529) (-773.199) (-771.863) * [-770.458] (-773.991) (-773.035) (-772.203) -- 0:00:41
      346000 -- (-771.695) [-772.652] (-775.012) (-773.336) * (-770.922) (-770.711) (-772.613) [-772.397] -- 0:00:41
      346500 -- (-769.995) (-772.245) (-770.856) [-775.888] * (-771.880) (-774.448) (-771.762) [-773.739] -- 0:00:41
      347000 -- (-770.111) (-773.267) (-770.616) [-771.076] * [-770.114] (-771.102) (-770.591) (-771.638) -- 0:00:41
      347500 -- (-770.960) (-775.383) [-770.529] (-772.259) * [-770.814] (-773.349) (-771.387) (-770.241) -- 0:00:41
      348000 -- [-775.802] (-772.489) (-770.244) (-771.009) * (-770.792) (-773.828) [-772.463] (-771.224) -- 0:00:41
      348500 -- (-771.239) (-772.668) (-769.866) [-773.475] * (-770.890) [-776.401] (-771.385) (-771.635) -- 0:00:41
      349000 -- (-771.233) [-772.114] (-770.457) (-772.189) * (-773.433) (-775.534) [-773.118] (-771.651) -- 0:00:41
      349500 -- [-770.644] (-772.688) (-770.451) (-771.702) * (-771.470) (-773.621) [-774.452] (-777.822) -- 0:00:40
      350000 -- (-770.477) [-771.407] (-771.184) (-776.421) * (-771.430) (-774.299) [-774.693] (-779.043) -- 0:00:40

      Average standard deviation of split frequencies: 0.010122

      350500 -- (-772.774) (-771.605) (-769.735) [-770.753] * (-772.770) [-770.063] (-774.394) (-770.677) -- 0:00:40
      351000 -- [-771.955] (-770.425) (-770.465) (-774.706) * (-772.532) (-774.483) (-772.026) [-774.029] -- 0:00:40
      351500 -- (-770.510) (-770.421) [-769.741] (-771.257) * (-774.791) (-770.499) (-770.075) [-770.287] -- 0:00:40
      352000 -- [-771.866] (-770.901) (-771.033) (-776.562) * (-773.953) [-770.908] (-771.199) (-772.987) -- 0:00:40
      352500 -- (-771.326) (-774.226) [-770.626] (-772.962) * (-772.185) [-772.092] (-772.702) (-775.172) -- 0:00:40
      353000 -- (-771.043) (-773.693) [-771.765] (-776.007) * [-770.522] (-771.250) (-771.535) (-774.088) -- 0:00:40
      353500 -- (-771.767) (-769.896) [-771.125] (-770.802) * (-772.984) [-770.664] (-771.695) (-774.194) -- 0:00:40
      354000 -- [-770.837] (-770.687) (-769.714) (-770.639) * (-770.439) [-771.503] (-774.187) (-773.772) -- 0:00:40
      354500 -- (-771.218) (-772.016) [-772.046] (-770.908) * (-777.888) (-772.034) (-771.206) [-771.013] -- 0:00:40
      355000 -- (-772.353) (-771.942) (-771.832) [-771.935] * (-770.764) [-772.948] (-771.462) (-771.355) -- 0:00:39

      Average standard deviation of split frequencies: 0.009970

      355500 -- [-771.235] (-773.113) (-773.599) (-774.551) * [-770.853] (-773.280) (-773.557) (-771.361) -- 0:00:39
      356000 -- (-774.129) (-776.167) (-771.170) [-771.390] * (-772.403) (-770.930) (-771.451) [-771.862] -- 0:00:39
      356500 -- (-772.053) (-771.968) [-770.343] (-771.698) * (-773.267) (-769.679) (-770.250) [-772.951] -- 0:00:39
      357000 -- (-771.138) (-770.952) [-772.427] (-770.634) * (-773.101) (-770.321) [-772.133] (-771.849) -- 0:00:39
      357500 -- (-770.195) (-770.296) (-771.108) [-771.342] * [-773.887] (-773.281) (-770.647) (-771.001) -- 0:00:39
      358000 -- (-769.924) (-771.900) [-771.876] (-773.260) * (-771.044) (-773.377) (-769.683) [-774.488] -- 0:00:39
      358500 -- (-770.326) (-770.611) [-770.934] (-777.387) * [-769.832] (-772.388) (-770.672) (-775.872) -- 0:00:39
      359000 -- (-771.177) [-771.225] (-771.217) (-773.824) * (-771.524) [-771.807] (-773.045) (-773.216) -- 0:00:39
      359500 -- (-770.158) (-770.536) [-771.209] (-771.385) * (-771.077) [-771.483] (-771.261) (-773.847) -- 0:00:39
      360000 -- (-775.180) (-770.442) [-770.918] (-771.947) * (-772.064) (-773.338) [-771.269] (-773.832) -- 0:00:39

      Average standard deviation of split frequencies: 0.010687

      360500 -- (-772.733) (-772.924) [-769.891] (-772.277) * (-772.472) [-776.060] (-770.377) (-771.727) -- 0:00:40
      361000 -- [-774.653] (-775.369) (-770.299) (-771.678) * (-772.278) (-773.486) (-771.218) [-771.614] -- 0:00:40
      361500 -- [-773.004] (-772.299) (-776.723) (-780.252) * (-769.905) (-772.694) (-770.342) [-773.562] -- 0:00:40
      362000 -- (-772.582) (-771.728) [-771.161] (-778.004) * (-773.237) (-772.684) [-771.058] (-771.347) -- 0:00:40
      362500 -- (-772.094) (-773.777) (-771.710) [-770.951] * [-772.516] (-771.532) (-771.007) (-773.902) -- 0:00:40
      363000 -- (-772.777) (-776.873) [-772.274] (-770.519) * (-774.135) (-770.059) (-770.395) [-771.921] -- 0:00:40
      363500 -- (-776.690) [-770.111] (-769.953) (-773.944) * (-770.369) [-770.103] (-769.824) (-771.260) -- 0:00:40
      364000 -- (-771.521) (-770.342) [-771.352] (-777.618) * [-770.453] (-773.173) (-770.418) (-773.018) -- 0:00:40
      364500 -- [-770.463] (-772.555) (-771.956) (-771.431) * (-770.479) (-772.418) [-771.177] (-771.521) -- 0:00:40
      365000 -- (-771.227) (-772.557) (-770.608) [-776.620] * (-771.485) [-772.281] (-770.475) (-770.623) -- 0:00:40

      Average standard deviation of split frequencies: 0.010759

      365500 -- (-771.153) (-772.124) (-774.020) [-772.994] * [-774.937] (-771.884) (-773.323) (-770.255) -- 0:00:39
      366000 -- (-773.902) [-771.186] (-771.081) (-774.411) * [-771.304] (-770.860) (-775.514) (-770.776) -- 0:00:39
      366500 -- (-772.022) [-772.490] (-772.053) (-771.345) * (-773.866) (-771.767) (-770.105) [-773.120] -- 0:00:39
      367000 -- (-772.937) (-771.659) (-770.373) [-771.060] * (-770.764) (-771.697) [-770.510] (-775.198) -- 0:00:39
      367500 -- (-772.419) (-774.371) (-769.912) [-772.480] * (-771.047) (-770.530) [-771.014] (-771.862) -- 0:00:39
      368000 -- (-778.697) [-773.739] (-769.846) (-779.138) * (-773.588) [-771.339] (-770.132) (-774.580) -- 0:00:39
      368500 -- (-772.923) (-772.315) [-771.477] (-779.288) * (-770.953) [-772.261] (-771.257) (-773.283) -- 0:00:39
      369000 -- (-771.265) (-771.151) [-771.288] (-777.067) * (-773.697) (-773.123) [-776.000] (-771.790) -- 0:00:39
      369500 -- (-775.733) (-774.121) [-773.666] (-776.564) * (-771.266) [-775.009] (-775.755) (-772.929) -- 0:00:39
      370000 -- (-776.983) (-771.682) (-769.867) [-771.059] * (-770.080) (-770.778) [-771.480] (-772.690) -- 0:00:39

      Average standard deviation of split frequencies: 0.010572

      370500 -- [-772.511] (-772.698) (-771.408) (-770.487) * (-772.633) [-770.641] (-771.708) (-771.831) -- 0:00:39
      371000 -- (-773.605) (-771.735) (-770.416) [-774.753] * (-771.153) [-770.012] (-772.542) (-771.548) -- 0:00:38
      371500 -- [-776.877] (-771.933) (-772.468) (-772.436) * (-770.868) [-771.268] (-770.473) (-771.089) -- 0:00:38
      372000 -- [-772.484] (-777.315) (-773.418) (-771.357) * (-770.458) (-780.589) [-770.802] (-770.389) -- 0:00:38
      372500 -- (-771.002) (-773.308) (-771.985) [-771.571] * (-770.866) [-771.523] (-772.821) (-771.155) -- 0:00:38
      373000 -- (-772.561) (-775.639) [-771.501] (-778.877) * (-771.662) (-774.173) (-771.587) [-771.584] -- 0:00:38
      373500 -- (-770.239) (-777.809) (-773.203) [-771.174] * [-771.182] (-770.110) (-771.555) (-770.972) -- 0:00:38
      374000 -- (-772.087) (-771.252) [-773.961] (-770.751) * (-776.509) (-770.598) [-769.924] (-770.242) -- 0:00:38
      374500 -- (-772.269) [-770.950] (-773.868) (-770.480) * (-771.786) [-770.763] (-773.731) (-771.133) -- 0:00:38
      375000 -- [-769.888] (-773.052) (-773.998) (-773.121) * (-770.348) (-773.127) [-770.423] (-770.407) -- 0:00:38

      Average standard deviation of split frequencies: 0.011049

      375500 -- (-772.123) (-773.554) [-772.767] (-772.505) * (-770.673) (-772.471) [-770.383] (-771.303) -- 0:00:38
      376000 -- (-774.536) (-775.861) [-770.269] (-773.966) * (-772.663) (-770.177) (-770.343) [-772.988] -- 0:00:38
      376500 -- [-771.636] (-773.450) (-770.946) (-772.107) * (-771.828) [-770.491] (-772.556) (-772.768) -- 0:00:38
      377000 -- (-771.758) [-773.514] (-772.104) (-772.051) * (-770.654) (-769.984) (-770.958) [-771.863] -- 0:00:39
      377500 -- (-772.326) (-772.385) (-770.053) [-771.346] * [-773.367] (-771.797) (-771.401) (-771.708) -- 0:00:39
      378000 -- (-774.824) (-772.204) [-771.402] (-772.604) * (-772.339) (-772.292) (-772.551) [-770.479] -- 0:00:39
      378500 -- (-770.973) [-770.484] (-769.640) (-773.795) * [-770.301] (-773.126) (-777.127) (-770.608) -- 0:00:39
      379000 -- (-772.058) [-773.840] (-770.275) (-770.409) * [-773.345] (-771.150) (-775.687) (-771.934) -- 0:00:39
      379500 -- (-771.970) (-774.555) (-770.721) [-771.556] * (-775.910) (-772.279) (-772.384) [-771.721] -- 0:00:39
      380000 -- (-771.117) (-773.199) [-769.944] (-772.054) * (-770.267) [-771.292] (-771.168) (-772.337) -- 0:00:39

      Average standard deviation of split frequencies: 0.011919

      380500 -- (-772.541) (-771.789) [-774.119] (-772.962) * (-772.508) (-774.057) [-771.148] (-776.198) -- 0:00:39
      381000 -- [-772.880] (-771.929) (-773.732) (-773.157) * (-774.459) (-772.609) [-771.583] (-772.435) -- 0:00:38
      381500 -- [-770.909] (-773.740) (-772.642) (-775.517) * (-773.844) [-773.023] (-770.764) (-770.045) -- 0:00:38
      382000 -- (-770.991) [-771.737] (-772.184) (-771.175) * (-775.363) [-770.539] (-771.711) (-771.736) -- 0:00:38
      382500 -- (-769.775) (-771.012) (-773.982) [-771.060] * (-773.266) [-776.991] (-771.167) (-770.234) -- 0:00:38
      383000 -- (-773.389) [-771.669] (-770.238) (-772.001) * (-774.497) (-778.555) (-773.111) [-771.783] -- 0:00:38
      383500 -- (-770.082) [-775.144] (-774.028) (-772.541) * (-771.316) (-770.633) (-774.628) [-771.957] -- 0:00:38
      384000 -- [-772.405] (-774.949) (-774.924) (-771.671) * [-771.245] (-771.989) (-770.656) (-775.040) -- 0:00:38
      384500 -- (-770.569) (-779.608) (-771.873) [-771.155] * [-771.650] (-772.404) (-771.448) (-772.840) -- 0:00:38
      385000 -- (-778.375) [-771.453] (-772.519) (-771.068) * (-771.769) (-771.574) (-771.218) [-771.464] -- 0:00:38

      Average standard deviation of split frequencies: 0.011997

      385500 -- [-773.613] (-770.915) (-775.495) (-774.106) * (-772.446) [-771.383] (-772.420) (-770.149) -- 0:00:38
      386000 -- [-772.091] (-773.902) (-773.871) (-777.250) * (-772.224) (-769.821) [-772.067] (-774.505) -- 0:00:38
      386500 -- (-773.931) (-771.384) [-771.731] (-771.175) * (-774.344) (-770.064) (-773.886) [-773.401] -- 0:00:38
      387000 -- [-770.634] (-772.123) (-774.938) (-772.579) * [-771.742] (-771.660) (-773.395) (-774.709) -- 0:00:38
      387500 -- [-772.759] (-771.928) (-772.596) (-774.763) * (-776.422) (-775.609) (-773.860) [-772.954] -- 0:00:37
      388000 -- (-772.840) (-770.857) (-775.211) [-775.556] * (-778.867) [-773.678] (-772.883) (-771.503) -- 0:00:37
      388500 -- [-770.588] (-772.793) (-771.154) (-774.834) * (-771.781) (-772.977) [-772.379] (-773.919) -- 0:00:37
      389000 -- [-772.849] (-774.140) (-772.529) (-771.468) * (-771.598) (-781.300) [-770.651] (-778.400) -- 0:00:37
      389500 -- (-773.919) (-770.842) (-770.507) [-771.269] * (-770.159) [-773.067] (-772.081) (-770.709) -- 0:00:37
      390000 -- [-773.484] (-770.996) (-772.282) (-770.959) * (-771.450) (-771.378) [-770.820] (-771.819) -- 0:00:37

      Average standard deviation of split frequencies: 0.011996

      390500 -- [-773.628] (-772.129) (-772.291) (-770.640) * [-771.335] (-773.003) (-775.969) (-771.201) -- 0:00:37
      391000 -- (-771.431) (-772.453) (-773.259) [-771.106] * (-771.260) (-771.014) (-769.931) [-770.412] -- 0:00:37
      391500 -- [-771.964] (-770.877) (-771.178) (-771.256) * [-770.775] (-771.088) (-770.411) (-776.264) -- 0:00:37
      392000 -- (-771.156) [-770.796] (-771.118) (-770.701) * (-773.961) (-771.013) (-772.441) [-772.464] -- 0:00:37
      392500 -- (-771.309) (-770.380) (-771.672) [-775.796] * (-774.062) [-771.137] (-771.529) (-773.893) -- 0:00:37
      393000 -- (-771.461) [-774.419] (-771.555) (-772.348) * (-772.526) (-772.377) [-770.189] (-773.265) -- 0:00:37
      393500 -- (-770.675) [-771.438] (-772.688) (-773.524) * (-771.317) [-772.748] (-771.548) (-770.224) -- 0:00:38
      394000 -- (-770.894) (-774.030) [-769.847] (-770.159) * [-772.522] (-773.709) (-771.588) (-771.778) -- 0:00:38
      394500 -- (-771.111) [-771.612] (-769.831) (-770.717) * (-772.760) (-773.503) (-770.221) [-772.096] -- 0:00:38
      395000 -- (-773.829) (-770.752) (-771.414) [-771.580] * [-770.231] (-771.274) (-773.888) (-773.465) -- 0:00:38

      Average standard deviation of split frequencies: 0.011484

      395500 -- (-772.023) (-771.287) (-771.094) [-773.711] * [-773.097] (-771.844) (-775.987) (-775.609) -- 0:00:38
      396000 -- (-772.917) (-771.858) (-772.043) [-773.911] * (-772.886) (-772.083) [-777.193] (-770.142) -- 0:00:38
      396500 -- [-775.222] (-773.402) (-770.467) (-773.953) * (-775.283) (-770.409) (-770.131) [-771.238] -- 0:00:38
      397000 -- (-773.318) (-772.927) (-772.911) [-775.440] * (-773.536) [-770.473] (-770.947) (-771.653) -- 0:00:37
      397500 -- (-775.211) [-773.561] (-774.696) (-774.083) * (-773.477) (-770.946) [-771.410] (-771.128) -- 0:00:37
      398000 -- [-770.612] (-771.201) (-771.054) (-771.750) * (-772.075) [-772.015] (-773.508) (-771.933) -- 0:00:37
      398500 -- [-772.388] (-773.286) (-778.383) (-771.715) * [-772.890] (-771.617) (-777.316) (-770.440) -- 0:00:37
      399000 -- [-772.685] (-773.657) (-772.237) (-769.914) * (-770.515) (-772.287) (-775.322) [-772.905] -- 0:00:37
      399500 -- [-773.567] (-775.702) (-772.236) (-770.018) * (-772.168) (-773.634) (-772.374) [-773.948] -- 0:00:37
      400000 -- (-772.964) (-772.269) [-771.147] (-771.000) * (-772.029) (-770.223) [-770.593] (-772.491) -- 0:00:37

      Average standard deviation of split frequencies: 0.010866

      400500 -- [-772.687] (-774.682) (-772.899) (-769.833) * (-769.880) [-772.079] (-772.724) (-770.686) -- 0:00:37
      401000 -- [-777.468] (-771.815) (-773.974) (-770.712) * (-771.895) (-772.615) [-776.069] (-774.660) -- 0:00:37
      401500 -- (-772.229) [-770.303] (-770.274) (-773.587) * [-774.863] (-772.507) (-780.391) (-771.068) -- 0:00:37
      402000 -- (-776.102) (-771.790) [-770.474] (-777.382) * (-772.522) (-770.528) (-778.139) [-771.094] -- 0:00:37
      402500 -- (-770.441) (-773.271) (-770.971) [-772.312] * (-771.533) (-773.712) (-773.171) [-774.274] -- 0:00:37
      403000 -- (-774.775) (-773.175) (-771.278) [-771.568] * (-774.219) [-771.336] (-771.708) (-771.136) -- 0:00:37
      403500 -- [-770.333] (-773.504) (-773.334) (-771.585) * (-774.626) (-771.246) [-772.068] (-771.728) -- 0:00:36
      404000 -- (-770.625) (-775.024) [-774.461] (-772.194) * (-776.256) (-770.693) (-775.767) [-777.657] -- 0:00:36
      404500 -- (-770.242) (-770.436) [-773.002] (-773.481) * [-773.045] (-772.758) (-771.485) (-771.064) -- 0:00:36
      405000 -- (-774.500) (-769.687) (-775.061) [-771.930] * (-771.768) (-775.080) [-770.272] (-771.136) -- 0:00:36

      Average standard deviation of split frequencies: 0.010108

      405500 -- (-773.824) (-770.369) (-775.343) [-770.544] * (-771.067) [-771.629] (-772.217) (-773.711) -- 0:00:36
      406000 -- (-771.918) (-772.355) (-772.454) [-771.532] * (-773.404) [-773.165] (-771.559) (-773.576) -- 0:00:36
      406500 -- [-771.887] (-774.874) (-770.442) (-771.125) * [-772.250] (-772.165) (-774.462) (-775.280) -- 0:00:36
      407000 -- (-773.370) (-772.420) (-771.052) [-770.819] * [-771.855] (-772.071) (-772.245) (-778.567) -- 0:00:36
      407500 -- [-770.053] (-769.854) (-771.265) (-771.785) * (-770.979) (-772.318) [-772.513] (-771.140) -- 0:00:36
      408000 -- [-772.418] (-771.720) (-773.457) (-771.631) * (-771.501) (-772.763) [-771.466] (-771.994) -- 0:00:36
      408500 -- [-771.763] (-779.704) (-771.004) (-773.061) * (-771.886) (-771.753) [-772.160] (-771.010) -- 0:00:36
      409000 -- (-773.365) (-772.874) (-770.637) [-772.481] * (-771.160) (-771.617) (-771.859) [-772.348] -- 0:00:36
      409500 -- (-773.737) (-773.472) (-770.480) [-772.506] * (-771.037) (-770.534) (-772.857) [-773.026] -- 0:00:37
      410000 -- (-770.739) (-771.458) (-770.902) [-771.213] * (-770.195) (-776.573) (-773.309) [-770.232] -- 0:00:37

      Average standard deviation of split frequencies: 0.010259

      410500 -- [-772.433] (-771.075) (-770.583) (-775.442) * [-769.873] (-773.278) (-772.789) (-770.693) -- 0:00:37
      411000 -- (-773.445) (-771.986) [-771.274] (-775.337) * [-769.935] (-772.595) (-772.897) (-778.663) -- 0:00:37
      411500 -- [-770.616] (-773.392) (-770.702) (-775.234) * (-775.419) [-770.415] (-771.778) (-776.667) -- 0:00:37
      412000 -- [-769.946] (-774.046) (-771.973) (-771.780) * (-772.322) (-769.967) [-771.425] (-772.216) -- 0:00:37
      412500 -- (-770.211) [-771.542] (-770.801) (-773.933) * (-771.673) (-769.981) [-770.102] (-772.543) -- 0:00:37
      413000 -- [-770.596] (-774.431) (-770.197) (-773.697) * (-771.648) [-769.981] (-771.459) (-772.486) -- 0:00:36
      413500 -- (-772.656) [-772.677] (-770.120) (-772.358) * (-772.995) [-772.383] (-772.896) (-773.106) -- 0:00:36
      414000 -- (-773.534) [-774.157] (-770.973) (-771.980) * [-773.720] (-772.654) (-772.913) (-770.171) -- 0:00:36
      414500 -- (-772.490) (-772.258) [-770.538] (-772.315) * (-772.541) (-769.948) (-771.211) [-770.854] -- 0:00:36
      415000 -- (-772.276) [-772.392] (-772.751) (-770.278) * [-771.521] (-771.082) (-772.378) (-770.818) -- 0:00:36

      Average standard deviation of split frequencies: 0.011190

      415500 -- (-771.641) [-774.802] (-771.297) (-774.321) * (-771.582) (-770.369) (-770.380) [-772.125] -- 0:00:36
      416000 -- (-772.774) (-773.199) (-771.103) [-771.475] * [-772.089] (-769.692) (-771.690) (-770.395) -- 0:00:36
      416500 -- (-774.271) [-771.300] (-773.014) (-772.275) * (-774.145) (-771.851) (-771.902) [-770.332] -- 0:00:36
      417000 -- [-770.464] (-771.277) (-773.884) (-772.834) * (-775.178) (-771.033) [-772.575] (-770.852) -- 0:00:36
      417500 -- [-769.719] (-771.401) (-770.944) (-776.074) * (-770.011) [-770.425] (-772.698) (-771.630) -- 0:00:36
      418000 -- (-774.237) [-771.213] (-769.893) (-773.424) * [-770.085] (-770.523) (-771.638) (-771.065) -- 0:00:36
      418500 -- (-771.943) (-770.673) [-770.451] (-771.579) * (-772.159) [-773.425] (-772.684) (-771.391) -- 0:00:36
      419000 -- (-776.805) [-769.740] (-771.583) (-771.338) * [-775.760] (-775.334) (-774.411) (-779.586) -- 0:00:36
      419500 -- (-773.447) (-770.582) (-770.033) [-770.595] * (-771.252) (-773.737) [-770.989] (-772.139) -- 0:00:35
      420000 -- (-772.966) (-770.907) (-771.083) [-772.453] * (-770.263) [-773.415] (-771.246) (-771.485) -- 0:00:35

      Average standard deviation of split frequencies: 0.010296

      420500 -- (-772.473) (-772.253) [-772.953] (-770.297) * (-770.286) [-774.294] (-773.435) (-769.725) -- 0:00:35
      421000 -- (-771.981) (-772.335) (-772.343) [-770.749] * (-770.307) (-772.327) [-772.038] (-770.700) -- 0:00:35
      421500 -- (-770.621) (-775.079) (-772.919) [-772.498] * (-770.550) (-773.217) (-774.001) [-771.168] -- 0:00:35
      422000 -- (-770.052) (-773.168) [-770.724] (-772.032) * [-770.761] (-773.709) (-772.335) (-771.168) -- 0:00:35
      422500 -- [-777.114] (-771.500) (-773.295) (-771.693) * (-770.833) (-773.773) [-769.855] (-771.940) -- 0:00:35
      423000 -- (-772.816) [-772.221] (-775.871) (-771.528) * [-770.115] (-769.726) (-770.136) (-772.325) -- 0:00:35
      423500 -- (-772.779) [-772.166] (-777.336) (-773.828) * (-771.443) [-771.707] (-773.241) (-770.336) -- 0:00:35
      424000 -- (-771.804) [-772.981] (-772.292) (-774.611) * [-771.040] (-771.599) (-771.609) (-770.525) -- 0:00:35
      424500 -- (-770.683) (-771.755) [-772.055] (-771.855) * (-774.068) [-770.344] (-772.735) (-771.540) -- 0:00:35
      425000 -- (-770.620) [-772.396] (-773.019) (-772.133) * (-770.778) (-772.401) (-772.869) [-770.370] -- 0:00:35

      Average standard deviation of split frequencies: 0.010374

      425500 -- [-774.387] (-774.437) (-773.683) (-772.303) * [-771.465] (-774.840) (-775.879) (-770.485) -- 0:00:36
      426000 -- (-770.908) (-774.313) [-773.812] (-770.416) * [-770.715] (-773.963) (-772.306) (-771.155) -- 0:00:36
      426500 -- (-774.800) (-770.104) [-772.673] (-772.476) * (-770.892) (-772.046) [-771.968] (-772.712) -- 0:00:36
      427000 -- (-774.700) [-770.374] (-775.170) (-770.339) * (-775.766) (-778.639) [-770.987] (-772.042) -- 0:00:36
      427500 -- (-773.120) (-771.105) [-770.125] (-771.347) * (-771.156) (-772.949) [-772.355] (-775.064) -- 0:00:36
      428000 -- (-772.976) (-771.283) (-769.620) [-771.028] * (-771.019) (-771.683) (-771.515) [-773.560] -- 0:00:36
      428500 -- (-771.520) (-771.530) [-770.270] (-771.573) * (-774.006) [-770.162] (-769.789) (-774.019) -- 0:00:36
      429000 -- (-772.250) (-770.290) [-770.100] (-770.869) * (-772.302) (-770.918) [-770.645] (-773.532) -- 0:00:35
      429500 -- (-772.994) [-772.786] (-770.783) (-770.311) * [-770.598] (-773.117) (-770.455) (-771.558) -- 0:00:35
      430000 -- (-769.923) [-773.383] (-771.302) (-770.501) * [-772.540] (-773.696) (-771.499) (-772.538) -- 0:00:35

      Average standard deviation of split frequencies: 0.009715

      430500 -- [-771.518] (-772.089) (-771.085) (-770.096) * (-774.171) (-773.901) [-773.618] (-773.209) -- 0:00:35
      431000 -- (-770.211) (-770.763) (-771.900) [-771.027] * (-771.014) (-773.471) (-770.791) [-776.082] -- 0:00:35
      431500 -- (-772.627) (-771.209) (-771.881) [-771.573] * (-772.252) (-775.587) (-774.674) [-772.472] -- 0:00:35
      432000 -- [-772.308] (-771.901) (-773.292) (-771.196) * (-771.693) (-771.019) (-774.288) [-773.091] -- 0:00:35
      432500 -- [-770.807] (-773.739) (-773.637) (-773.959) * [-772.487] (-774.946) (-771.942) (-771.576) -- 0:00:35
      433000 -- (-770.441) [-771.087] (-770.759) (-771.849) * (-770.240) (-774.886) (-772.996) [-769.935] -- 0:00:35
      433500 -- (-769.956) [-771.652] (-770.081) (-771.162) * (-771.610) (-771.994) [-772.293] (-772.150) -- 0:00:35
      434000 -- (-774.036) (-772.053) (-770.955) [-770.228] * [-771.778] (-771.352) (-772.774) (-770.590) -- 0:00:35
      434500 -- (-774.039) (-772.310) [-771.952] (-772.983) * (-771.948) (-771.338) (-775.571) [-770.252] -- 0:00:35
      435000 -- (-770.848) (-773.882) [-770.111] (-770.791) * [-773.177] (-770.720) (-773.951) (-770.418) -- 0:00:35

      Average standard deviation of split frequencies: 0.010884

      435500 -- (-770.680) (-772.348) [-771.242] (-773.669) * (-772.336) (-770.974) (-771.575) [-772.221] -- 0:00:34
      436000 -- (-772.905) [-770.404] (-770.694) (-771.141) * [-771.110] (-771.285) (-770.382) (-772.639) -- 0:00:34
      436500 -- (-772.297) (-771.938) (-770.945) [-777.252] * [-771.969] (-771.275) (-770.413) (-772.812) -- 0:00:34
      437000 -- (-771.993) (-771.144) [-770.482] (-769.719) * (-773.615) [-772.114] (-771.812) (-772.107) -- 0:00:34
      437500 -- (-771.767) [-771.585] (-770.593) (-770.312) * [-771.709] (-776.984) (-770.256) (-773.002) -- 0:00:34
      438000 -- [-770.018] (-774.836) (-773.882) (-770.630) * [-772.163] (-772.341) (-772.656) (-773.283) -- 0:00:34
      438500 -- (-772.541) [-770.752] (-771.791) (-770.733) * (-770.678) (-770.457) (-770.768) [-770.586] -- 0:00:34
      439000 -- (-772.232) (-770.846) (-772.361) [-770.927] * (-775.266) (-771.879) (-784.524) [-770.752] -- 0:00:34
      439500 -- (-771.099) (-772.790) (-774.070) [-769.975] * [-770.628] (-772.588) (-777.769) (-772.412) -- 0:00:34
      440000 -- (-771.566) [-771.577] (-772.289) (-771.354) * (-769.961) (-772.413) [-772.233] (-772.589) -- 0:00:34

      Average standard deviation of split frequencies: 0.010430

      440500 -- (-772.092) [-773.298] (-773.320) (-770.965) * (-770.392) [-771.809] (-771.718) (-771.866) -- 0:00:34
      441000 -- (-770.670) (-772.061) [-770.732] (-770.770) * (-771.356) (-774.067) (-773.310) [-775.789] -- 0:00:34
      441500 -- (-775.970) (-772.594) (-771.460) [-771.107] * [-771.971] (-769.844) (-770.590) (-775.201) -- 0:00:34
      442000 -- [-772.348] (-773.582) (-774.214) (-774.462) * (-771.930) (-771.063) [-771.957] (-771.306) -- 0:00:34
      442500 -- (-771.341) (-772.859) [-774.935] (-772.859) * (-770.630) [-770.496] (-770.971) (-773.575) -- 0:00:35
      443000 -- (-770.447) (-770.138) [-772.043] (-772.519) * (-771.039) (-770.823) (-773.747) [-770.763] -- 0:00:35
      443500 -- (-773.098) (-769.985) [-772.720] (-773.143) * (-770.136) (-771.184) [-773.681] (-774.388) -- 0:00:35
      444000 -- (-772.197) (-769.835) (-771.945) [-771.049] * (-773.625) [-770.125] (-772.697) (-773.114) -- 0:00:35
      444500 -- (-770.814) [-770.905] (-773.991) (-772.670) * (-770.643) (-770.105) (-772.232) [-774.492] -- 0:00:34
      445000 -- (-771.370) (-770.023) (-770.316) [-771.350] * (-774.031) [-770.864] (-770.584) (-770.623) -- 0:00:34

      Average standard deviation of split frequencies: 0.009975

      445500 -- (-774.175) (-772.298) (-770.316) [-772.092] * [-771.203] (-771.178) (-770.503) (-770.964) -- 0:00:34
      446000 -- (-772.354) (-770.340) (-770.587) [-771.841] * (-771.654) (-770.104) [-770.602] (-771.537) -- 0:00:34
      446500 -- (-771.516) (-771.123) [-771.512] (-771.151) * (-773.631) [-771.562] (-772.671) (-770.534) -- 0:00:34
      447000 -- (-771.306) (-773.895) [-772.352] (-771.237) * [-770.347] (-771.519) (-773.890) (-771.422) -- 0:00:34
      447500 -- (-772.892) (-774.415) [-771.822] (-771.042) * (-773.430) [-772.069] (-769.784) (-773.889) -- 0:00:34
      448000 -- [-771.418] (-774.767) (-770.309) (-770.383) * [-770.380] (-773.709) (-769.976) (-772.198) -- 0:00:34
      448500 -- (-775.537) (-772.868) [-770.897] (-769.983) * [-770.948] (-770.130) (-773.776) (-771.270) -- 0:00:34
      449000 -- (-770.145) (-774.345) [-769.914] (-772.034) * (-770.419) [-770.882] (-771.442) (-771.730) -- 0:00:34
      449500 -- (-772.251) (-773.904) [-770.756] (-774.096) * (-770.121) (-770.077) (-771.718) [-770.626] -- 0:00:34
      450000 -- (-774.395) [-772.934] (-770.528) (-772.832) * [-770.891] (-770.707) (-771.899) (-774.498) -- 0:00:34

      Average standard deviation of split frequencies: 0.009480

      450500 -- [-771.621] (-771.116) (-771.702) (-772.963) * (-773.549) (-769.970) [-771.230] (-775.948) -- 0:00:34
      451000 -- (-771.138) (-770.812) (-772.709) [-772.693] * (-773.849) [-771.157] (-774.916) (-771.955) -- 0:00:34
      451500 -- (-770.006) [-770.626] (-771.507) (-773.621) * (-772.772) (-772.658) (-772.882) [-773.080] -- 0:00:34
      452000 -- [-770.330] (-772.880) (-772.163) (-773.199) * (-769.852) (-772.051) [-771.429] (-771.035) -- 0:00:33
      452500 -- (-773.183) [-771.990] (-771.289) (-773.203) * [-771.643] (-772.093) (-771.042) (-770.748) -- 0:00:33
      453000 -- (-773.426) [-770.722] (-771.149) (-773.401) * (-774.499) [-772.130] (-770.359) (-772.679) -- 0:00:33
      453500 -- (-772.855) (-771.756) (-771.093) [-772.624] * (-774.539) (-776.579) [-771.246] (-770.287) -- 0:00:33
      454000 -- (-772.570) [-774.257] (-772.017) (-773.641) * (-774.691) (-773.794) (-772.205) [-770.145] -- 0:00:33
      454500 -- (-775.593) (-771.962) (-771.143) [-774.220] * (-776.948) (-772.578) (-771.723) [-773.450] -- 0:00:33
      455000 -- (-772.914) (-771.379) (-771.442) [-773.545] * (-772.643) (-770.062) [-772.368] (-777.682) -- 0:00:33

      Average standard deviation of split frequencies: 0.009786

      455500 -- (-773.545) (-772.939) (-772.529) [-771.681] * (-770.940) (-769.836) [-771.269] (-773.183) -- 0:00:33
      456000 -- (-771.051) (-774.233) [-772.253] (-770.006) * (-771.462) [-769.760] (-771.694) (-777.112) -- 0:00:33
      456500 -- (-771.220) (-770.341) (-772.535) [-769.787] * [-771.698] (-770.299) (-771.415) (-771.407) -- 0:00:33
      457000 -- (-771.284) [-770.633] (-770.344) (-771.997) * (-772.151) (-771.080) [-769.974] (-770.619) -- 0:00:33
      457500 -- (-771.376) (-771.408) (-772.807) [-772.663] * (-771.570) (-770.170) (-769.758) [-772.722] -- 0:00:33
      458000 -- (-771.997) (-770.988) [-771.139] (-771.710) * (-772.253) (-770.329) (-774.880) [-770.704] -- 0:00:33
      458500 -- [-771.901] (-770.941) (-777.529) (-772.023) * (-770.847) (-769.520) (-771.402) [-770.581] -- 0:00:33
      459000 -- (-771.966) (-770.914) [-773.356] (-771.495) * (-772.272) [-770.562] (-773.036) (-773.268) -- 0:00:34
      459500 -- (-772.697) [-770.749] (-770.387) (-770.703) * (-770.928) (-774.220) [-777.580] (-770.992) -- 0:00:34
      460000 -- [-775.016] (-772.539) (-772.896) (-771.582) * (-773.319) [-772.791] (-770.739) (-770.403) -- 0:00:34

      Average standard deviation of split frequencies: 0.008664

      460500 -- (-772.026) (-771.454) (-772.844) [-771.081] * (-770.431) [-772.624] (-771.577) (-770.100) -- 0:00:33
      461000 -- [-771.397] (-773.751) (-770.875) (-773.444) * (-770.018) [-772.326] (-772.578) (-771.139) -- 0:00:33
      461500 -- (-770.384) (-774.182) (-772.880) [-773.628] * [-776.922] (-772.347) (-776.019) (-770.568) -- 0:00:33
      462000 -- [-770.231] (-774.301) (-771.487) (-775.610) * (-771.425) (-771.496) [-770.443] (-772.814) -- 0:00:33
      462500 -- (-773.837) [-770.978] (-771.660) (-770.161) * [-770.607] (-773.562) (-771.456) (-770.846) -- 0:00:33
      463000 -- (-771.861) (-771.061) (-772.504) [-772.759] * (-770.584) [-770.310] (-772.138) (-772.153) -- 0:00:33
      463500 -- [-772.717] (-770.865) (-773.137) (-770.716) * (-773.466) [-770.057] (-770.063) (-772.688) -- 0:00:33
      464000 -- [-773.788] (-772.694) (-771.861) (-773.950) * (-770.606) (-771.699) (-770.088) [-773.196] -- 0:00:33
      464500 -- (-773.083) [-773.390] (-775.611) (-771.462) * (-775.826) [-771.401] (-774.205) (-772.317) -- 0:00:33
      465000 -- [-770.643] (-773.544) (-773.001) (-773.444) * (-772.509) [-772.703] (-773.217) (-772.575) -- 0:00:33

      Average standard deviation of split frequencies: 0.008219

      465500 -- (-772.455) (-773.562) (-772.043) [-771.536] * (-771.790) (-774.120) [-771.010] (-771.983) -- 0:00:33
      466000 -- (-770.156) (-771.688) [-771.173] (-772.347) * [-773.104] (-772.918) (-771.035) (-773.600) -- 0:00:33
      466500 -- (-775.110) (-772.108) [-770.886] (-772.219) * (-771.921) (-774.039) (-770.263) [-772.405] -- 0:00:33
      467000 -- (-774.040) (-770.670) (-770.483) [-771.554] * (-772.976) (-774.459) [-770.614] (-773.970) -- 0:00:33
      467500 -- [-775.810] (-773.114) (-771.498) (-776.508) * (-774.260) (-771.683) [-770.729] (-771.562) -- 0:00:33
      468000 -- (-774.834) [-772.286] (-772.950) (-772.847) * (-770.463) (-771.855) [-770.591] (-778.099) -- 0:00:32
      468500 -- (-772.388) [-775.766] (-771.072) (-774.288) * (-773.167) (-772.097) (-773.333) [-772.139] -- 0:00:32
      469000 -- (-771.089) [-771.456] (-770.667) (-774.928) * [-770.448] (-773.549) (-770.807) (-772.563) -- 0:00:32
      469500 -- (-771.777) [-771.022] (-776.403) (-771.548) * [-772.951] (-774.283) (-774.260) (-772.108) -- 0:00:32
      470000 -- (-771.753) (-771.115) (-776.679) [-771.194] * (-772.925) (-776.612) (-771.800) [-770.375] -- 0:00:32

      Average standard deviation of split frequencies: 0.008947

      470500 -- [-775.916] (-772.683) (-773.725) (-773.024) * [-770.634] (-769.628) (-770.892) (-775.104) -- 0:00:32
      471000 -- (-774.235) [-773.004] (-772.696) (-771.963) * [-771.765] (-771.174) (-773.127) (-772.640) -- 0:00:32
      471500 -- (-772.403) (-770.357) (-775.393) [-770.566] * (-774.472) (-772.823) (-773.188) [-770.120] -- 0:00:32
      472000 -- (-771.851) (-772.098) [-771.169] (-770.836) * (-772.923) (-775.461) [-772.542] (-771.532) -- 0:00:32
      472500 -- (-771.002) (-773.085) [-773.720] (-775.347) * (-770.018) (-770.399) [-772.077] (-770.579) -- 0:00:32
      473000 -- (-772.796) (-775.261) (-777.102) [-771.163] * [-775.048] (-771.010) (-774.490) (-773.121) -- 0:00:32
      473500 -- [-771.949] (-771.649) (-771.527) (-771.958) * [-770.234] (-770.705) (-774.285) (-775.071) -- 0:00:32
      474000 -- (-776.836) [-770.527] (-773.385) (-770.723) * [-771.880] (-774.066) (-775.788) (-775.322) -- 0:00:32
      474500 -- (-771.696) (-771.041) (-773.630) [-773.394] * (-772.771) [-770.482] (-777.229) (-773.615) -- 0:00:32
      475000 -- (-777.248) (-771.436) (-772.416) [-771.379] * [-771.133] (-770.455) (-770.132) (-775.499) -- 0:00:32

      Average standard deviation of split frequencies: 0.008451

      475500 -- [-773.982] (-773.460) (-772.537) (-771.172) * (-772.508) [-778.152] (-771.345) (-772.650) -- 0:00:33
      476000 -- [-770.349] (-772.418) (-770.196) (-774.836) * (-772.069) (-774.429) (-772.020) [-770.570] -- 0:00:33
      476500 -- (-771.889) [-774.598] (-773.277) (-771.249) * (-776.680) [-773.404] (-771.798) (-771.115) -- 0:00:32
      477000 -- (-772.144) (-771.294) [-770.421] (-772.551) * (-773.021) [-770.982] (-774.917) (-771.054) -- 0:00:32
      477500 -- (-773.054) [-773.019] (-773.246) (-772.498) * [-775.132] (-773.622) (-770.953) (-771.400) -- 0:00:32
      478000 -- (-771.683) [-771.430] (-771.913) (-775.037) * (-772.126) (-774.123) (-775.409) [-773.154] -- 0:00:32
      478500 -- [-769.733] (-774.176) (-771.971) (-773.518) * (-774.118) (-774.246) (-777.645) [-770.965] -- 0:00:32
      479000 -- [-769.665] (-771.432) (-770.701) (-771.113) * (-773.569) (-772.297) (-774.029) [-771.037] -- 0:00:32
      479500 -- (-776.139) (-771.937) [-769.923] (-772.865) * (-770.483) (-774.349) (-772.354) [-771.382] -- 0:00:32
      480000 -- (-773.089) (-772.054) [-772.264] (-771.153) * (-772.371) [-770.618] (-770.544) (-772.401) -- 0:00:32

      Average standard deviation of split frequencies: 0.008565

      480500 -- [-773.245] (-770.491) (-772.930) (-781.655) * (-770.821) (-771.366) [-771.605] (-771.447) -- 0:00:32
      481000 -- (-773.187) (-771.826) [-778.593] (-778.823) * (-772.616) (-770.718) [-771.547] (-777.065) -- 0:00:32
      481500 -- [-771.331] (-771.859) (-772.609) (-774.585) * (-770.401) [-773.132] (-771.994) (-771.706) -- 0:00:32
      482000 -- (-771.874) (-771.867) (-772.912) [-771.977] * (-771.307) [-770.436] (-771.141) (-773.326) -- 0:00:32
      482500 -- (-770.736) [-770.467] (-771.841) (-770.005) * [-770.188] (-771.536) (-773.466) (-775.807) -- 0:00:32
      483000 -- [-773.111] (-770.465) (-774.230) (-770.363) * (-772.365) (-770.123) (-775.099) [-773.063] -- 0:00:32
      483500 -- [-769.717] (-770.935) (-772.192) (-772.739) * (-773.990) (-771.283) (-771.627) [-771.153] -- 0:00:32
      484000 -- (-775.125) (-773.006) [-773.056] (-772.004) * (-773.014) (-770.710) (-771.795) [-772.627] -- 0:00:31
      484500 -- (-770.603) (-772.631) [-770.211] (-771.901) * (-773.018) (-776.185) [-771.860] (-773.816) -- 0:00:31
      485000 -- (-773.377) (-773.469) (-772.070) [-772.654] * [-772.286] (-775.622) (-774.524) (-771.535) -- 0:00:31

      Average standard deviation of split frequencies: 0.008406

      485500 -- (-772.408) (-775.239) [-771.609] (-773.419) * [-770.128] (-769.878) (-771.439) (-770.259) -- 0:00:31
      486000 -- [-775.375] (-771.771) (-771.961) (-772.818) * (-770.863) [-772.383] (-773.521) (-771.789) -- 0:00:31
      486500 -- [-773.350] (-770.998) (-771.274) (-776.345) * (-772.464) (-770.424) (-771.360) [-774.134] -- 0:00:31
      487000 -- [-771.678] (-771.433) (-771.150) (-774.766) * [-772.027] (-771.473) (-770.459) (-772.243) -- 0:00:31
      487500 -- (-775.439) (-772.820) (-771.201) [-771.441] * (-776.089) (-771.604) (-770.353) [-773.995] -- 0:00:31
      488000 -- (-771.337) [-770.282] (-771.748) (-771.015) * (-771.008) (-771.526) [-770.918] (-773.275) -- 0:00:31
      488500 -- [-775.453] (-773.243) (-770.564) (-772.131) * [-772.997] (-770.884) (-773.284) (-772.574) -- 0:00:31
      489000 -- (-772.556) (-775.400) [-770.418] (-775.758) * (-771.285) [-771.294] (-772.958) (-772.987) -- 0:00:31
      489500 -- [-771.655] (-776.454) (-770.335) (-773.089) * (-771.021) [-771.137] (-771.740) (-771.869) -- 0:00:31
      490000 -- (-773.713) [-771.597] (-771.460) (-770.797) * (-770.256) (-770.901) [-770.820] (-772.648) -- 0:00:31

      Average standard deviation of split frequencies: 0.008326

      490500 -- [-772.881] (-770.615) (-772.444) (-772.335) * [-772.741] (-771.965) (-770.706) (-773.882) -- 0:00:31
      491000 -- (-771.995) (-769.715) [-772.428] (-775.153) * (-771.365) (-771.041) (-771.247) [-772.438] -- 0:00:32
      491500 -- [-772.373] (-773.590) (-771.902) (-773.883) * (-776.138) (-770.919) (-770.881) [-772.578] -- 0:00:32
      492000 -- (-771.206) [-775.449] (-773.639) (-771.646) * (-772.183) (-773.588) (-774.127) [-770.949] -- 0:00:32
      492500 -- (-770.234) (-773.064) [-769.988] (-776.630) * (-771.734) [-772.133] (-772.441) (-771.703) -- 0:00:31
      493000 -- (-770.549) (-769.937) (-774.378) [-772.093] * (-773.577) [-771.388] (-771.206) (-772.283) -- 0:00:31
      493500 -- (-772.052) (-774.145) (-779.462) [-771.731] * (-773.295) [-772.882] (-774.429) (-773.854) -- 0:00:31
      494000 -- (-771.432) (-775.732) [-771.686] (-771.238) * (-769.755) [-772.265] (-774.653) (-772.351) -- 0:00:31
      494500 -- [-771.615] (-774.120) (-770.760) (-770.243) * (-771.865) (-770.949) [-777.275] (-772.418) -- 0:00:31
      495000 -- (-770.372) [-774.684] (-771.796) (-774.475) * (-772.244) (-770.111) (-774.991) [-773.826] -- 0:00:31

      Average standard deviation of split frequencies: 0.008364

      495500 -- (-771.497) (-773.869) (-770.214) [-771.426] * (-771.920) [-771.113] (-773.350) (-771.107) -- 0:00:31
      496000 -- (-772.003) (-777.850) (-774.546) [-773.243] * [-776.539] (-769.791) (-771.481) (-770.745) -- 0:00:31
      496500 -- (-773.715) (-772.581) (-773.162) [-770.680] * (-777.034) [-771.470] (-771.378) (-773.271) -- 0:00:31
      497000 -- (-774.020) (-771.906) (-773.913) [-773.940] * (-773.351) [-771.905] (-771.690) (-775.769) -- 0:00:31
      497500 -- (-770.362) (-772.529) (-771.008) [-771.164] * (-771.234) (-773.104) (-770.716) [-774.617] -- 0:00:31
      498000 -- [-771.536] (-774.133) (-770.140) (-771.174) * (-770.938) (-770.553) [-769.936] (-775.615) -- 0:00:31
      498500 -- (-772.756) (-771.517) (-770.677) [-771.176] * (-774.932) (-773.488) [-771.385] (-772.080) -- 0:00:31
      499000 -- (-775.416) (-773.729) [-771.603] (-770.441) * (-772.178) [-771.084] (-770.892) (-776.949) -- 0:00:31
      499500 -- (-774.887) [-773.743] (-770.094) (-771.066) * [-771.498] (-773.627) (-771.265) (-774.166) -- 0:00:31
      500000 -- (-773.440) [-775.629] (-770.094) (-772.077) * (-771.619) (-771.609) (-771.580) [-772.146] -- 0:00:31

      Average standard deviation of split frequencies: 0.007784

      500500 -- [-770.246] (-774.720) (-772.416) (-770.208) * (-772.470) [-772.380] (-775.360) (-771.732) -- 0:00:30
      501000 -- (-772.066) (-772.774) [-771.876] (-773.572) * (-771.106) (-771.880) [-774.757] (-773.817) -- 0:00:30
      501500 -- (-773.685) (-771.827) (-770.121) [-770.552] * (-774.244) (-769.945) (-771.760) [-774.060] -- 0:00:30
      502000 -- (-774.836) (-771.536) (-770.575) [-770.347] * [-772.955] (-771.092) (-774.670) (-772.764) -- 0:00:30
      502500 -- (-772.070) (-775.457) [-772.764] (-770.985) * (-774.166) (-773.621) [-772.931] (-770.760) -- 0:00:30
      503000 -- (-771.019) (-777.879) [-770.215] (-771.684) * (-773.059) [-772.653] (-770.605) (-771.483) -- 0:00:30
      503500 -- (-773.357) (-773.952) (-775.610) [-772.465] * [-770.917] (-770.434) (-772.606) (-770.595) -- 0:00:30
      504000 -- (-772.100) (-774.408) [-772.236] (-771.385) * (-773.119) [-773.202] (-777.863) (-773.291) -- 0:00:30
      504500 -- (-772.593) [-770.750] (-772.637) (-771.849) * (-773.424) [-773.949] (-776.295) (-772.922) -- 0:00:30
      505000 -- (-772.768) (-773.066) (-772.763) [-770.107] * (-770.019) [-772.297] (-770.754) (-770.102) -- 0:00:30

      Average standard deviation of split frequencies: 0.007278

      505500 -- (-777.072) [-770.349] (-771.032) (-770.262) * (-771.632) [-772.555] (-771.011) (-773.634) -- 0:00:30
      506000 -- [-771.423] (-772.705) (-772.910) (-770.205) * (-770.814) (-774.802) [-769.623] (-773.379) -- 0:00:30
      506500 -- (-770.452) (-771.401) [-772.779] (-774.987) * [-772.387] (-772.612) (-770.231) (-775.029) -- 0:00:30
      507000 -- [-771.986] (-772.888) (-771.452) (-772.948) * (-772.052) (-776.947) (-773.010) [-770.808] -- 0:00:30
      507500 -- (-771.984) (-771.647) [-771.814] (-772.395) * (-770.468) (-771.762) [-770.709] (-771.739) -- 0:00:31
      508000 -- (-770.403) (-771.820) (-775.132) [-770.786] * (-772.325) [-770.246] (-771.026) (-771.972) -- 0:00:30
      508500 -- (-769.789) (-771.111) [-773.870] (-770.250) * (-772.823) [-770.932] (-774.188) (-773.048) -- 0:00:30
      509000 -- (-772.526) (-776.648) (-775.145) [-772.782] * (-772.812) (-771.995) (-772.163) [-771.040] -- 0:00:30
      509500 -- (-770.527) (-772.993) (-773.171) [-770.286] * (-775.507) (-777.900) [-770.410] (-773.466) -- 0:00:30
      510000 -- (-775.368) (-770.476) (-772.845) [-772.134] * (-774.160) [-774.916] (-772.236) (-770.878) -- 0:00:30

      Average standard deviation of split frequencies: 0.007631

      510500 -- (-771.930) (-771.380) [-771.905] (-774.530) * (-773.100) (-774.281) [-773.695] (-776.009) -- 0:00:30
      511000 -- (-771.921) [-771.017] (-771.206) (-776.370) * (-770.763) (-773.379) (-770.911) [-772.102] -- 0:00:30
      511500 -- (-770.733) [-774.885] (-770.413) (-770.234) * [-770.858] (-770.568) (-771.487) (-771.431) -- 0:00:30
      512000 -- (-770.054) (-770.861) [-771.754] (-773.072) * (-773.160) (-770.885) [-773.409] (-773.934) -- 0:00:30
      512500 -- (-771.185) [-771.738] (-774.687) (-770.270) * (-771.864) (-776.261) (-773.967) [-772.229] -- 0:00:30
      513000 -- [-771.703] (-771.961) (-774.593) (-770.804) * (-772.853) (-773.897) [-772.160] (-775.074) -- 0:00:30
      513500 -- (-770.561) [-771.595] (-770.793) (-770.866) * [-770.941] (-771.135) (-772.310) (-776.981) -- 0:00:30
      514000 -- [-770.264] (-773.346) (-770.351) (-770.765) * [-771.334] (-770.404) (-774.311) (-777.121) -- 0:00:30
      514500 -- (-769.835) [-771.467] (-771.250) (-773.771) * (-773.657) [-777.306] (-774.237) (-776.915) -- 0:00:30
      515000 -- (-770.198) (-774.288) [-777.547] (-774.184) * (-774.621) (-771.948) (-773.888) [-777.405] -- 0:00:30

      Average standard deviation of split frequencies: 0.007023

      515500 -- (-771.422) (-773.192) (-772.468) [-770.141] * (-776.087) (-771.560) (-770.367) [-775.950] -- 0:00:30
      516000 -- (-771.691) (-772.333) [-770.744] (-772.521) * [-770.406] (-771.154) (-771.808) (-773.786) -- 0:00:30
      516500 -- (-771.987) (-773.114) (-775.110) [-771.311] * (-769.969) (-770.848) (-770.390) [-771.633] -- 0:00:29
      517000 -- (-770.073) (-773.251) [-772.821] (-774.204) * (-771.944) (-772.372) [-771.134] (-772.170) -- 0:00:29
      517500 -- (-771.463) (-773.150) [-772.244] (-771.895) * (-770.368) (-772.662) [-770.947] (-773.140) -- 0:00:29
      518000 -- [-771.102] (-774.664) (-770.217) (-775.227) * (-770.900) (-772.686) (-771.163) [-772.547] -- 0:00:29
      518500 -- (-770.895) [-770.903] (-772.656) (-773.190) * (-772.717) (-771.606) [-773.557] (-770.447) -- 0:00:29
      519000 -- (-771.040) (-772.043) (-774.664) [-771.136] * (-773.562) (-772.641) (-770.601) [-770.366] -- 0:00:29
      519500 -- (-771.646) (-771.112) (-770.992) [-770.148] * (-776.144) (-771.238) (-770.042) [-771.423] -- 0:00:29
      520000 -- [-771.061] (-771.901) (-769.591) (-769.987) * [-772.674] (-773.297) (-772.733) (-774.359) -- 0:00:29

      Average standard deviation of split frequencies: 0.007073

      520500 -- (-770.113) (-775.390) [-772.906] (-770.395) * (-772.504) [-770.478] (-771.793) (-771.558) -- 0:00:29
      521000 -- [-770.709] (-777.448) (-771.524) (-772.570) * (-772.035) [-770.221] (-772.451) (-777.450) -- 0:00:29
      521500 -- (-773.208) (-770.420) (-770.063) [-774.714] * [-771.206] (-770.670) (-772.420) (-772.379) -- 0:00:29
      522000 -- (-771.470) [-772.179] (-769.762) (-773.091) * (-771.808) (-772.804) (-772.919) [-770.255] -- 0:00:29
      522500 -- [-770.780] (-771.782) (-774.895) (-771.437) * (-771.507) (-772.182) (-771.677) [-771.300] -- 0:00:29
      523000 -- (-770.372) (-779.602) (-772.972) [-770.580] * (-772.753) [-773.209] (-772.979) (-774.341) -- 0:00:29
      523500 -- (-770.877) (-772.699) [-771.626] (-771.071) * [-771.927] (-774.495) (-773.043) (-771.588) -- 0:00:30
      524000 -- (-771.430) [-770.228] (-774.767) (-770.678) * (-775.029) (-772.974) [-774.812] (-770.996) -- 0:00:29
      524500 -- [-771.910] (-771.440) (-770.639) (-772.267) * (-772.538) [-773.162] (-773.161) (-773.402) -- 0:00:29
      525000 -- [-771.375] (-771.686) (-772.359) (-771.762) * (-771.973) (-770.197) [-774.818] (-774.463) -- 0:00:29

      Average standard deviation of split frequencies: 0.007450

      525500 -- (-773.555) [-771.256] (-771.276) (-771.565) * (-771.933) (-771.019) [-774.433] (-771.621) -- 0:00:29
      526000 -- (-774.581) (-769.874) (-773.361) [-774.216] * (-776.367) (-771.733) (-772.368) [-770.146] -- 0:00:29
      526500 -- (-772.755) (-770.982) [-772.971] (-771.640) * (-775.117) (-770.938) (-772.347) [-770.241] -- 0:00:29
      527000 -- (-770.856) (-772.676) [-770.613] (-772.867) * [-772.275] (-771.024) (-773.929) (-770.654) -- 0:00:29
      527500 -- (-772.085) (-773.308) [-771.356] (-771.053) * (-774.524) (-771.775) [-769.952] (-772.371) -- 0:00:29
      528000 -- [-773.688] (-772.640) (-770.628) (-770.330) * (-774.590) [-773.359] (-770.068) (-774.910) -- 0:00:29
      528500 -- (-769.621) (-773.766) (-773.244) [-770.733] * (-776.987) (-774.720) [-772.782] (-774.904) -- 0:00:29
      529000 -- (-778.541) (-775.145) [-770.308] (-771.785) * (-780.071) (-773.037) [-773.006] (-774.205) -- 0:00:29
      529500 -- (-778.374) (-770.576) [-770.631] (-770.054) * (-772.709) [-772.543] (-772.732) (-771.872) -- 0:00:29
      530000 -- [-771.282] (-771.010) (-774.097) (-770.606) * (-770.704) (-776.525) [-771.654] (-772.159) -- 0:00:29

      Average standard deviation of split frequencies: 0.007525

      530500 -- (-774.069) (-770.541) (-773.119) [-772.895] * [-772.915] (-776.819) (-773.437) (-770.427) -- 0:00:29
      531000 -- (-770.313) [-773.490] (-772.364) (-773.375) * (-773.748) (-775.288) [-773.344] (-772.324) -- 0:00:29
      531500 -- (-772.926) (-776.460) (-771.810) [-773.990] * (-777.732) (-772.677) [-771.364] (-773.008) -- 0:00:29
      532000 -- (-774.833) (-774.485) [-773.715] (-770.803) * (-769.967) (-771.392) [-773.357] (-771.969) -- 0:00:29
      532500 -- (-776.301) (-771.868) [-771.324] (-772.527) * (-770.563) [-772.520] (-774.742) (-772.868) -- 0:00:28
      533000 -- [-770.779] (-770.181) (-770.228) (-772.501) * (-772.261) [-772.598] (-772.104) (-773.748) -- 0:00:28
      533500 -- (-772.751) (-770.250) (-771.066) [-771.956] * (-770.763) (-770.944) (-770.314) [-773.886] -- 0:00:28
      534000 -- (-773.390) (-771.340) (-771.480) [-771.439] * (-769.906) (-772.714) [-771.166] (-770.790) -- 0:00:28
      534500 -- [-771.032] (-770.762) (-772.324) (-773.823) * (-772.066) (-771.550) (-773.060) [-773.198] -- 0:00:28
      535000 -- (-771.005) [-770.291] (-773.574) (-774.048) * (-773.506) [-770.871] (-771.394) (-770.852) -- 0:00:28

      Average standard deviation of split frequencies: 0.007450

      535500 -- [-771.299] (-773.763) (-771.133) (-772.562) * (-774.525) [-771.412] (-774.044) (-770.823) -- 0:00:28
      536000 -- (-772.534) (-773.732) [-769.941] (-773.482) * (-774.421) (-770.821) (-771.729) [-771.902] -- 0:00:28
      536500 -- [-772.905] (-774.389) (-772.667) (-771.764) * [-776.960] (-771.879) (-776.235) (-771.652) -- 0:00:28
      537000 -- (-773.230) [-770.217] (-770.851) (-772.925) * (-771.894) (-773.797) [-775.292] (-772.265) -- 0:00:28
      537500 -- (-770.950) [-770.471] (-773.941) (-771.337) * [-772.183] (-772.517) (-778.801) (-775.872) -- 0:00:28
      538000 -- (-774.814) [-770.360] (-775.342) (-773.026) * (-772.267) (-771.457) (-770.637) [-774.790] -- 0:00:28
      538500 -- (-777.363) (-770.039) [-773.934] (-774.363) * [-769.642] (-772.389) (-770.663) (-774.399) -- 0:00:28
      539000 -- (-779.761) (-771.854) (-772.628) [-771.316] * (-770.888) (-773.034) (-771.283) [-770.776] -- 0:00:28
      539500 -- (-774.204) [-772.689] (-773.005) (-773.362) * (-776.686) (-771.661) (-771.553) [-773.549] -- 0:00:28
      540000 -- [-771.000] (-773.968) (-773.015) (-771.739) * (-771.362) (-772.040) (-770.531) [-769.997] -- 0:00:28

      Average standard deviation of split frequencies: 0.007796

      540500 -- (-772.847) (-772.205) (-772.978) [-771.565] * (-773.239) (-771.390) [-770.592] (-771.454) -- 0:00:28
      541000 -- (-771.225) [-774.442] (-772.424) (-770.433) * [-772.923] (-770.966) (-774.682) (-771.317) -- 0:00:28
      541500 -- [-771.525] (-774.240) (-771.357) (-769.867) * [-772.141] (-771.494) (-770.960) (-771.560) -- 0:00:28
      542000 -- [-771.520] (-776.337) (-774.641) (-772.921) * (-772.180) (-772.085) (-773.365) [-774.225] -- 0:00:28
      542500 -- [-771.220] (-770.362) (-771.674) (-770.819) * (-771.392) [-774.548] (-770.928) (-770.718) -- 0:00:28
      543000 -- [-773.103] (-771.686) (-771.390) (-771.805) * [-771.457] (-773.952) (-770.978) (-775.373) -- 0:00:28
      543500 -- (-775.582) (-775.135) (-771.877) [-771.445] * [-774.529] (-770.337) (-775.921) (-770.515) -- 0:00:28
      544000 -- (-776.028) (-772.433) [-772.583] (-773.609) * [-771.348] (-771.630) (-772.875) (-769.640) -- 0:00:28
      544500 -- (-770.438) [-776.205] (-773.386) (-771.720) * [-771.306] (-774.351) (-775.087) (-775.019) -- 0:00:28
      545000 -- (-772.492) (-775.894) (-771.238) [-771.881] * (-770.109) (-771.882) [-775.413] (-769.885) -- 0:00:28

      Average standard deviation of split frequencies: 0.008442

      545500 -- (-773.357) [-771.140] (-773.877) (-772.906) * (-772.389) [-771.364] (-774.789) (-770.156) -- 0:00:28
      546000 -- (-771.944) (-770.083) (-773.092) [-772.224] * (-773.583) (-770.048) (-771.946) [-770.219] -- 0:00:28
      546500 -- (-774.194) (-770.364) [-770.789] (-772.451) * (-771.186) [-770.450] (-771.053) (-772.700) -- 0:00:28
      547000 -- (-771.221) (-776.413) [-772.244] (-771.245) * (-772.704) [-772.233] (-772.320) (-771.755) -- 0:00:28
      547500 -- [-771.080] (-773.283) (-774.436) (-769.850) * (-772.181) (-774.706) [-771.008] (-771.274) -- 0:00:28
      548000 -- [-774.645] (-770.282) (-771.783) (-772.036) * (-771.991) (-770.230) [-772.710] (-770.858) -- 0:00:28
      548500 -- [-772.819] (-771.619) (-769.843) (-771.494) * (-771.345) [-770.991] (-773.173) (-770.548) -- 0:00:27
      549000 -- (-771.600) [-772.858] (-774.270) (-776.074) * (-772.033) (-769.953) [-775.014] (-770.496) -- 0:00:27
      549500 -- (-773.954) (-771.912) (-772.708) [-773.127] * [-770.070] (-773.866) (-770.592) (-770.436) -- 0:00:27
      550000 -- [-773.150] (-778.519) (-774.743) (-770.564) * (-769.865) (-772.247) (-770.663) [-772.400] -- 0:00:27

      Average standard deviation of split frequencies: 0.008513

      550500 -- (-772.758) (-774.196) [-772.495] (-771.404) * (-773.346) (-772.198) [-771.278] (-775.439) -- 0:00:27
      551000 -- (-772.499) [-775.248] (-773.023) (-774.963) * [-771.029] (-772.818) (-772.112) (-774.018) -- 0:00:27
      551500 -- (-772.700) (-770.720) [-771.195] (-773.497) * (-774.035) [-772.438] (-770.694) (-773.418) -- 0:00:27
      552000 -- (-772.504) (-774.171) [-770.689] (-773.397) * (-771.048) (-770.774) [-770.533] (-771.662) -- 0:00:27
      552500 -- (-773.051) [-771.381] (-773.150) (-771.880) * (-770.752) (-771.138) [-770.311] (-773.184) -- 0:00:27
      553000 -- (-773.973) (-771.551) (-774.498) [-772.233] * (-771.078) (-774.236) (-769.601) [-770.776] -- 0:00:27
      553500 -- (-772.957) (-773.300) (-772.023) [-772.662] * (-769.750) (-774.459) [-772.021] (-770.688) -- 0:00:27
      554000 -- (-772.983) (-773.532) [-771.508] (-770.860) * [-774.869] (-771.518) (-772.178) (-770.638) -- 0:00:27
      554500 -- (-771.308) [-771.662] (-770.941) (-771.413) * (-772.103) (-772.342) (-771.192) [-770.260] -- 0:00:27
      555000 -- (-770.564) [-772.826] (-770.672) (-771.962) * (-772.473) (-771.334) [-772.187] (-775.428) -- 0:00:27

      Average standard deviation of split frequencies: 0.008526

      555500 -- (-771.561) (-773.278) [-770.616] (-770.043) * (-771.888) (-772.465) (-772.709) [-773.179] -- 0:00:27
      556000 -- (-771.918) [-772.067] (-769.785) (-773.863) * (-771.187) [-770.775] (-770.416) (-775.674) -- 0:00:27
      556500 -- [-773.091] (-771.307) (-769.519) (-772.106) * (-775.572) [-773.026] (-770.170) (-774.338) -- 0:00:27
      557000 -- (-770.578) (-773.728) (-769.575) [-770.917] * (-773.157) [-772.263] (-772.724) (-774.673) -- 0:00:27
      557500 -- [-771.808] (-770.556) (-771.556) (-774.059) * [-770.240] (-773.258) (-776.118) (-770.517) -- 0:00:27
      558000 -- (-771.037) (-771.716) (-771.715) [-772.926] * (-772.408) (-773.976) [-770.610] (-771.761) -- 0:00:27
      558500 -- [-770.110] (-771.427) (-773.149) (-769.658) * [-774.374] (-772.710) (-770.098) (-772.252) -- 0:00:27
      559000 -- (-769.986) [-772.612] (-773.495) (-771.401) * (-771.273) (-772.564) [-770.070] (-774.459) -- 0:00:27
      559500 -- [-769.810] (-771.296) (-773.525) (-773.039) * [-770.225] (-775.175) (-771.577) (-774.293) -- 0:00:27
      560000 -- (-772.034) [-771.993] (-770.377) (-771.673) * (-770.371) (-772.182) [-770.868] (-771.968) -- 0:00:27

      Average standard deviation of split frequencies: 0.008804

      560500 -- [-771.403] (-770.282) (-770.225) (-770.460) * (-771.732) (-770.056) [-770.935] (-773.083) -- 0:00:27
      561000 -- (-773.124) (-772.653) (-770.721) [-773.653] * (-780.288) (-772.162) (-771.092) [-771.201] -- 0:00:27
      561500 -- (-771.738) [-773.017] (-772.737) (-771.410) * (-775.230) (-775.511) [-771.090] (-772.046) -- 0:00:27
      562000 -- (-772.236) (-770.647) (-771.952) [-770.905] * (-774.820) (-771.085) [-773.138] (-773.041) -- 0:00:27
      562500 -- (-770.539) (-776.041) (-771.786) [-772.118] * (-771.285) (-771.688) (-771.225) [-774.370] -- 0:00:27
      563000 -- (-771.751) [-771.119] (-771.814) (-771.329) * (-775.097) [-772.289] (-775.877) (-771.563) -- 0:00:27
      563500 -- (-771.106) [-770.789] (-771.881) (-772.567) * (-770.342) [-771.166] (-776.101) (-770.495) -- 0:00:27
      564000 -- (-772.941) (-773.669) (-772.010) [-770.816] * (-771.690) (-774.067) [-772.787] (-770.861) -- 0:00:27
      564500 -- (-779.641) (-774.003) [-771.766] (-769.985) * (-770.975) [-771.465] (-770.537) (-772.756) -- 0:00:27
      565000 -- (-772.276) (-773.542) (-771.588) [-770.379] * (-770.405) [-771.277] (-770.637) (-770.946) -- 0:00:26

      Average standard deviation of split frequencies: 0.008574

      565500 -- (-773.110) (-772.040) (-774.362) [-770.836] * (-771.259) [-770.599] (-773.590) (-770.592) -- 0:00:26
      566000 -- [-770.929] (-776.436) (-770.830) (-770.519) * (-771.278) (-769.783) (-770.851) [-772.373] -- 0:00:26
      566500 -- (-771.413) (-771.067) (-772.052) [-775.559] * [-771.597] (-771.280) (-770.768) (-769.951) -- 0:00:26
      567000 -- [-774.098] (-772.599) (-772.811) (-772.107) * (-773.730) (-771.841) [-769.943] (-772.026) -- 0:00:26
      567500 -- (-770.986) [-772.086] (-777.639) (-770.563) * [-771.827] (-771.751) (-771.950) (-769.856) -- 0:00:26
      568000 -- (-771.853) [-772.362] (-771.469) (-771.746) * [-771.826] (-771.760) (-773.139) (-771.695) -- 0:00:26
      568500 -- (-770.237) (-772.270) [-772.066] (-772.135) * (-771.617) (-770.059) [-771.953] (-770.623) -- 0:00:26
      569000 -- [-772.888] (-775.799) (-774.354) (-771.090) * (-772.291) (-770.736) [-771.453] (-771.140) -- 0:00:26
      569500 -- [-773.598] (-772.627) (-775.839) (-772.553) * (-772.315) (-770.404) (-769.911) [-772.595] -- 0:00:26
      570000 -- (-772.744) (-771.109) [-775.062] (-779.697) * (-773.972) (-771.550) [-771.166] (-771.591) -- 0:00:26

      Average standard deviation of split frequencies: 0.009138

      570500 -- [-771.679] (-769.938) (-775.666) (-770.532) * (-772.804) (-772.062) [-772.721] (-772.667) -- 0:00:26
      571000 -- [-773.650] (-771.153) (-773.652) (-770.829) * (-772.106) (-770.299) [-771.836] (-771.646) -- 0:00:26
      571500 -- (-774.047) (-770.666) [-770.706] (-774.182) * (-772.162) [-771.454] (-776.098) (-777.265) -- 0:00:26
      572000 -- (-770.824) [-770.296] (-772.705) (-776.957) * (-770.760) (-770.203) [-771.529] (-775.457) -- 0:00:26
      572500 -- (-773.981) (-773.023) (-771.953) [-776.148] * [-770.349] (-772.679) (-773.016) (-773.473) -- 0:00:26
      573000 -- [-772.339] (-776.074) (-772.286) (-770.435) * (-770.892) (-772.145) [-772.381] (-771.953) -- 0:00:26
      573500 -- [-772.272] (-773.283) (-773.063) (-771.725) * (-770.634) (-772.464) (-771.989) [-773.232] -- 0:00:26
      574000 -- (-770.672) [-770.502] (-770.800) (-772.558) * (-772.797) (-771.778) (-776.005) [-770.251] -- 0:00:26
      574500 -- (-771.002) (-770.987) (-770.250) [-773.391] * (-773.876) (-772.929) [-775.149] (-770.203) -- 0:00:26
      575000 -- [-776.430] (-770.684) (-776.171) (-772.799) * (-774.822) (-771.980) (-769.825) [-770.728] -- 0:00:26

      Average standard deviation of split frequencies: 0.008389

      575500 -- (-770.683) [-770.725] (-771.042) (-771.397) * [-775.600] (-773.330) (-772.261) (-770.379) -- 0:00:26
      576000 -- (-770.797) (-772.541) (-771.599) [-771.339] * (-774.463) (-770.618) [-770.898] (-769.886) -- 0:00:26
      576500 -- (-773.211) [-771.526] (-772.805) (-771.446) * (-771.327) [-770.913] (-770.778) (-770.492) -- 0:00:26
      577000 -- (-773.506) (-770.426) (-771.052) [-771.314] * (-773.720) (-779.399) (-773.514) [-773.630] -- 0:00:26
      577500 -- (-771.402) [-774.184] (-771.635) (-770.159) * (-775.874) [-773.385] (-773.750) (-775.133) -- 0:00:26
      578000 -- [-771.762] (-773.283) (-772.417) (-769.939) * (-773.965) [-770.404] (-771.842) (-777.226) -- 0:00:26
      578500 -- (-774.061) [-775.687] (-776.708) (-770.881) * (-774.611) (-771.041) [-772.569] (-771.158) -- 0:00:26
      579000 -- (-772.996) (-772.375) (-772.749) [-770.914] * [-771.367] (-773.746) (-770.346) (-773.688) -- 0:00:26
      579500 -- (-772.194) [-771.662] (-770.030) (-770.878) * [-772.020] (-774.044) (-771.209) (-771.859) -- 0:00:26
      580000 -- (-773.498) (-772.750) (-770.033) [-770.327] * (-771.257) (-772.381) [-771.333] (-772.384) -- 0:00:26

      Average standard deviation of split frequencies: 0.008169

      580500 -- [-770.120] (-775.954) (-780.479) (-771.581) * (-770.887) (-772.523) (-773.378) [-772.039] -- 0:00:26
      581000 -- (-770.785) [-770.346] (-771.369) (-773.855) * [-773.299] (-777.554) (-774.250) (-772.244) -- 0:00:25
      581500 -- (-779.046) [-771.168] (-774.885) (-771.339) * (-774.068) (-770.419) (-771.001) [-772.350] -- 0:00:25
      582000 -- (-774.219) (-771.365) (-772.153) [-772.491] * (-773.312) (-770.108) (-771.569) [-774.591] -- 0:00:25
      582500 -- (-770.872) (-769.668) (-771.338) [-773.410] * (-771.420) (-772.317) (-770.965) [-771.628] -- 0:00:25
      583000 -- [-770.612] (-771.705) (-772.072) (-775.399) * (-772.690) (-772.502) [-771.194] (-771.849) -- 0:00:25
      583500 -- (-771.833) [-772.481] (-773.950) (-771.490) * (-773.889) (-772.295) [-769.987] (-772.329) -- 0:00:25
      584000 -- (-772.562) (-775.864) [-772.067] (-773.402) * (-770.300) (-770.625) [-772.232] (-772.276) -- 0:00:25
      584500 -- (-770.828) (-773.627) [-771.697] (-777.805) * [-771.840] (-770.899) (-770.167) (-776.681) -- 0:00:25
      585000 -- (-772.415) (-771.803) (-771.533) [-772.376] * (-771.486) (-774.276) [-772.680] (-772.160) -- 0:00:25

      Average standard deviation of split frequencies: 0.007843

      585500 -- (-770.778) [-772.580] (-779.476) (-772.031) * (-772.724) (-771.725) (-771.358) [-771.628] -- 0:00:25
      586000 -- [-771.289] (-770.140) (-770.793) (-771.780) * (-773.494) (-772.671) [-770.064] (-776.678) -- 0:00:25
      586500 -- (-771.174) (-773.583) [-770.759] (-771.214) * (-774.820) (-772.675) (-772.359) [-771.062] -- 0:00:25
      587000 -- [-770.665] (-774.088) (-774.357) (-770.607) * (-774.256) (-775.252) [-770.946] (-771.709) -- 0:00:25
      587500 -- [-773.597] (-771.632) (-770.931) (-772.591) * (-773.243) [-770.149] (-772.570) (-778.674) -- 0:00:25
      588000 -- (-771.316) [-773.448] (-769.621) (-774.160) * [-774.779] (-771.320) (-772.971) (-771.026) -- 0:00:25
      588500 -- (-772.163) (-774.124) [-771.700] (-772.573) * [-775.817] (-771.031) (-772.099) (-771.878) -- 0:00:25
      589000 -- (-772.136) (-773.824) [-773.076] (-771.671) * (-771.831) (-774.410) [-771.042] (-778.481) -- 0:00:25
      589500 -- (-773.552) [-770.861] (-772.637) (-773.015) * (-769.970) (-769.887) (-773.585) [-774.085] -- 0:00:25
      590000 -- [-772.268] (-772.127) (-776.393) (-772.301) * (-772.901) (-774.590) [-771.589] (-777.774) -- 0:00:25

      Average standard deviation of split frequencies: 0.008430

      590500 -- (-772.003) (-771.085) (-774.251) [-771.585] * (-772.488) [-773.738] (-770.638) (-773.589) -- 0:00:25
      591000 -- (-774.891) (-773.017) [-770.582] (-771.177) * (-770.882) [-771.059] (-771.846) (-775.860) -- 0:00:25
      591500 -- (-772.707) (-770.221) (-772.684) [-771.169] * (-773.234) (-772.393) [-769.945] (-774.613) -- 0:00:25
      592000 -- (-770.545) (-772.143) (-770.893) [-771.602] * (-774.571) (-774.757) [-771.872] (-774.295) -- 0:00:25
      592500 -- (-772.744) [-772.912] (-771.375) (-773.716) * (-771.304) (-771.660) [-769.796] (-775.856) -- 0:00:25
      593000 -- [-774.210] (-771.391) (-770.446) (-772.479) * (-770.985) (-770.884) [-772.316] (-772.607) -- 0:00:25
      593500 -- (-771.684) (-771.922) (-772.701) [-770.726] * (-771.503) [-771.177] (-770.287) (-773.729) -- 0:00:25
      594000 -- (-772.771) (-771.356) (-775.412) [-770.546] * (-770.683) [-771.154] (-770.510) (-770.462) -- 0:00:25
      594500 -- (-772.162) [-771.167] (-774.894) (-772.946) * (-770.170) (-771.866) (-777.006) [-770.641] -- 0:00:25
      595000 -- (-775.620) [-771.113] (-770.594) (-770.963) * (-770.240) (-771.693) (-773.166) [-774.842] -- 0:00:25

      Average standard deviation of split frequencies: 0.008700

      595500 -- [-771.741] (-769.802) (-776.574) (-773.428) * (-773.529) [-771.391] (-771.389) (-772.476) -- 0:00:25
      596000 -- (-770.658) (-769.593) [-772.330] (-775.396) * (-773.714) (-772.981) [-772.355] (-772.345) -- 0:00:25
      596500 -- (-770.989) (-769.984) (-777.454) [-772.828] * (-774.090) (-774.231) (-771.612) [-771.007] -- 0:00:25
      597000 -- (-774.160) (-771.370) (-773.496) [-772.706] * (-770.359) (-772.614) [-770.842] (-771.557) -- 0:00:24
      597500 -- [-775.248] (-771.725) (-772.892) (-770.799) * (-770.754) (-772.761) (-771.504) [-769.872] -- 0:00:24
      598000 -- [-773.016] (-771.896) (-774.944) (-772.205) * (-771.081) (-773.322) [-772.729] (-773.361) -- 0:00:24
      598500 -- (-772.255) (-771.811) [-775.757] (-773.920) * (-771.509) (-772.790) [-771.188] (-771.887) -- 0:00:24
      599000 -- (-769.894) (-770.892) [-770.690] (-773.301) * (-770.326) (-772.471) (-772.203) [-773.522] -- 0:00:24
      599500 -- (-770.363) (-771.383) [-770.854] (-774.946) * (-773.516) [-771.599] (-771.564) (-774.358) -- 0:00:24
      600000 -- (-772.562) [-770.757] (-772.909) (-772.881) * [-770.617] (-776.204) (-773.564) (-774.071) -- 0:00:24

      Average standard deviation of split frequencies: 0.008731

      600500 -- (-780.273) (-771.973) [-770.308] (-772.286) * (-770.530) (-772.086) [-777.883] (-772.105) -- 0:00:24
      601000 -- (-774.985) (-770.794) (-770.829) [-770.416] * (-772.148) (-772.033) (-773.321) [-772.420] -- 0:00:24
      601500 -- [-773.279] (-771.145) (-770.919) (-773.643) * (-770.215) (-774.375) (-771.438) [-774.441] -- 0:00:24
      602000 -- (-771.937) (-771.331) (-771.880) [-771.299] * [-771.731] (-773.431) (-773.397) (-773.886) -- 0:00:24
      602500 -- (-772.971) (-773.836) [-771.073] (-772.304) * [-773.440] (-773.362) (-770.265) (-778.460) -- 0:00:24
      603000 -- (-772.428) [-771.193] (-770.236) (-770.512) * (-772.601) (-770.414) [-771.044] (-784.564) -- 0:00:24
      603500 -- (-772.644) (-771.259) [-771.274] (-773.374) * (-774.508) (-770.898) (-771.235) [-773.945] -- 0:00:24
      604000 -- (-771.035) (-770.473) (-770.921) [-772.933] * (-776.303) (-772.897) (-771.657) [-773.420] -- 0:00:24
      604500 -- (-775.962) [-774.574] (-771.203) (-776.445) * (-772.292) [-772.285] (-770.711) (-770.791) -- 0:00:24
      605000 -- (-772.649) (-771.922) (-771.354) [-772.015] * (-770.659) (-775.044) [-771.899] (-770.042) -- 0:00:24

      Average standard deviation of split frequencies: 0.008119

      605500 -- (-775.841) [-771.921] (-770.549) (-779.004) * [-769.994] (-774.605) (-776.476) (-773.398) -- 0:00:24
      606000 -- (-769.929) (-772.425) [-772.512] (-776.044) * (-771.631) (-774.534) [-773.197] (-774.260) -- 0:00:24
      606500 -- (-772.251) [-771.872] (-771.482) (-778.238) * (-775.443) [-771.189] (-771.151) (-772.947) -- 0:00:24
      607000 -- (-771.138) (-772.131) [-771.027] (-775.522) * (-773.789) (-774.835) (-770.088) [-770.367] -- 0:00:24
      607500 -- (-774.410) (-770.777) [-775.673] (-771.924) * (-773.418) (-775.244) [-773.915] (-770.866) -- 0:00:24
      608000 -- (-773.841) (-772.867) (-772.723) [-771.405] * (-770.106) (-772.649) [-771.096] (-771.610) -- 0:00:24
      608500 -- [-771.321] (-771.719) (-772.271) (-770.549) * (-772.202) [-770.673] (-772.874) (-771.309) -- 0:00:24
      609000 -- (-770.676) (-771.562) (-772.499) [-770.145] * (-772.723) (-772.218) (-770.282) [-771.937] -- 0:00:24
      609500 -- (-770.684) (-771.492) [-770.802] (-773.828) * (-776.134) (-771.851) [-771.296] (-774.028) -- 0:00:24
      610000 -- (-772.716) (-771.973) [-771.916] (-771.794) * (-777.786) (-771.179) [-769.843] (-774.351) -- 0:00:24

      Average standard deviation of split frequencies: 0.008684

      610500 -- (-774.761) [-772.971] (-770.274) (-770.661) * (-773.774) (-773.451) [-772.432] (-772.695) -- 0:00:24
      611000 -- (-771.621) (-775.786) [-774.355] (-771.865) * (-771.829) (-771.405) (-771.859) [-771.995] -- 0:00:24
      611500 -- (-770.920) (-772.321) [-775.238] (-771.456) * (-770.838) [-770.198] (-771.244) (-771.192) -- 0:00:24
      612000 -- (-769.794) [-775.943] (-775.648) (-770.569) * (-770.653) (-770.904) (-774.586) [-771.842] -- 0:00:24
      612500 -- [-774.101] (-771.543) (-774.233) (-771.337) * [-774.064] (-770.585) (-774.577) (-780.867) -- 0:00:24
      613000 -- (-771.305) [-770.092] (-771.799) (-770.899) * (-773.285) [-770.204] (-772.100) (-772.332) -- 0:00:23
      613500 -- (-770.462) [-771.235] (-771.241) (-771.551) * [-771.941] (-771.416) (-771.421) (-770.129) -- 0:00:23
      614000 -- (-772.630) (-770.371) (-776.180) [-771.669] * (-774.659) (-773.632) [-771.289] (-771.345) -- 0:00:23
      614500 -- (-771.952) (-770.573) (-770.538) [-774.818] * [-771.891] (-772.446) (-771.242) (-771.659) -- 0:00:23
      615000 -- (-773.257) [-770.852] (-771.582) (-772.592) * (-771.457) (-774.746) [-771.650] (-776.604) -- 0:00:23

      Average standard deviation of split frequencies: 0.008848

      615500 -- (-771.768) (-770.222) (-770.986) [-775.611] * (-772.498) (-780.390) [-773.228] (-772.144) -- 0:00:23
      616000 -- (-771.561) [-770.937] (-770.526) (-772.202) * [-771.862] (-774.574) (-771.188) (-771.030) -- 0:00:23
      616500 -- [-772.222] (-771.621) (-770.965) (-771.543) * (-770.592) (-772.497) [-770.481] (-772.489) -- 0:00:23
      617000 -- (-773.211) (-773.977) (-770.873) [-772.721] * (-772.638) (-771.803) (-773.382) [-770.359] -- 0:00:23
      617500 -- [-770.218] (-771.936) (-779.128) (-770.607) * [-771.604] (-771.688) (-771.430) (-772.153) -- 0:00:23
      618000 -- [-773.591] (-772.374) (-771.370) (-771.368) * [-773.539] (-769.827) (-772.104) (-769.813) -- 0:00:23
      618500 -- [-771.598] (-770.506) (-772.065) (-772.175) * (-777.864) (-770.325) [-770.354] (-770.032) -- 0:00:23
      619000 -- (-776.093) (-771.317) (-771.874) [-772.899] * [-770.310] (-770.131) (-770.394) (-772.995) -- 0:00:23
      619500 -- (-770.851) (-772.498) [-771.180] (-778.748) * (-770.017) (-772.419) (-773.355) [-772.395] -- 0:00:23
      620000 -- (-770.589) (-772.041) (-770.874) [-772.369] * [-771.188] (-779.539) (-773.023) (-774.202) -- 0:00:23

      Average standard deviation of split frequencies: 0.008687

      620500 -- (-776.129) (-771.633) [-771.536] (-772.327) * (-771.994) (-770.780) [-772.783] (-773.198) -- 0:00:23
      621000 -- (-779.889) (-774.628) [-770.278] (-772.641) * (-772.041) (-769.902) [-771.598] (-774.185) -- 0:00:23
      621500 -- (-775.083) [-771.334] (-771.437) (-773.183) * [-771.401] (-771.236) (-770.990) (-774.971) -- 0:00:23
      622000 -- [-770.391] (-773.549) (-771.826) (-771.651) * (-771.063) [-770.275] (-770.114) (-770.643) -- 0:00:23
      622500 -- (-772.656) (-774.837) (-771.855) [-770.038] * (-771.700) [-771.958] (-770.932) (-771.740) -- 0:00:23
      623000 -- (-774.404) [-773.369] (-770.219) (-771.413) * (-771.139) (-775.825) [-770.018] (-773.335) -- 0:00:22
      623500 -- (-772.670) (-774.445) (-770.473) [-770.586] * (-772.028) (-774.837) [-770.874] (-771.313) -- 0:00:23
      624000 -- (-772.975) (-771.186) [-771.725] (-770.395) * (-772.639) (-776.345) (-769.996) [-771.323] -- 0:00:23
      624500 -- (-769.963) (-771.221) [-771.203] (-770.458) * [-770.671] (-773.767) (-771.653) (-771.657) -- 0:00:23
      625000 -- (-771.310) (-773.972) [-773.458] (-776.514) * (-770.755) (-773.305) [-773.114] (-773.288) -- 0:00:23

      Average standard deviation of split frequencies: 0.008331

      625500 -- [-771.919] (-774.514) (-771.985) (-770.003) * [-770.129] (-775.071) (-772.198) (-772.673) -- 0:00:23
      626000 -- (-772.104) [-774.175] (-771.522) (-771.837) * [-771.581] (-770.435) (-772.481) (-774.994) -- 0:00:23
      626500 -- (-773.365) (-772.953) (-769.793) [-769.790] * (-771.204) (-770.507) [-772.004] (-771.148) -- 0:00:23
      627000 -- (-777.237) (-772.519) [-771.807] (-770.129) * (-771.438) (-773.651) [-771.415] (-770.769) -- 0:00:23
      627500 -- (-773.467) (-773.243) [-773.119] (-771.645) * (-771.791) (-776.211) [-770.383] (-771.750) -- 0:00:23
      628000 -- (-774.608) (-771.181) (-772.517) [-771.858] * (-771.851) [-770.920] (-770.655) (-770.208) -- 0:00:23
      628500 -- (-772.972) (-770.182) [-771.657] (-770.504) * (-770.055) (-773.535) [-771.994] (-772.152) -- 0:00:23
      629000 -- (-771.114) (-771.111) (-773.337) [-771.966] * (-772.832) (-773.040) [-773.837] (-773.915) -- 0:00:23
      629500 -- (-771.462) [-773.443] (-770.297) (-770.353) * (-771.784) (-772.840) (-770.915) [-775.219] -- 0:00:22
      630000 -- (-770.005) [-771.016] (-776.087) (-770.408) * (-772.607) [-779.539] (-773.203) (-773.942) -- 0:00:22

      Average standard deviation of split frequencies: 0.008129

      630500 -- [-770.252] (-771.671) (-772.695) (-772.763) * (-771.990) (-772.483) (-772.649) [-772.272] -- 0:00:22
      631000 -- (-770.763) (-770.772) [-770.216] (-775.187) * (-774.017) (-772.798) [-770.273] (-770.501) -- 0:00:22
      631500 -- (-771.127) (-771.864) (-770.129) [-773.560] * (-772.055) (-771.600) (-770.884) [-770.988] -- 0:00:22
      632000 -- (-772.101) [-772.923] (-770.949) (-770.274) * (-771.627) [-773.400] (-770.194) (-771.410) -- 0:00:22
      632500 -- [-771.786] (-772.986) (-770.800) (-771.456) * (-769.844) (-771.344) [-771.513] (-772.236) -- 0:00:22
      633000 -- [-773.237] (-772.543) (-769.958) (-772.643) * [-772.399] (-770.805) (-773.106) (-770.321) -- 0:00:22
      633500 -- (-770.275) (-772.413) [-769.991] (-772.562) * (-772.194) (-770.682) (-771.748) [-770.676] -- 0:00:22
      634000 -- (-770.182) (-773.024) (-770.235) [-773.817] * [-772.053] (-770.362) (-774.045) (-772.839) -- 0:00:22
      634500 -- (-770.285) [-771.870] (-770.928) (-770.883) * (-775.617) [-773.674] (-776.854) (-773.632) -- 0:00:22
      635000 -- (-769.775) [-770.782] (-771.124) (-772.021) * (-771.825) [-772.510] (-771.691) (-772.057) -- 0:00:22

      Average standard deviation of split frequencies: 0.007644

      635500 -- (-770.186) [-769.717] (-770.887) (-772.689) * (-771.646) (-773.363) [-774.597] (-772.473) -- 0:00:22
      636000 -- (-770.468) [-773.009] (-771.386) (-774.707) * (-771.562) (-773.597) [-770.498] (-771.549) -- 0:00:22
      636500 -- (-770.200) (-771.474) (-773.970) [-770.793] * (-771.697) [-771.869] (-770.314) (-770.603) -- 0:00:22
      637000 -- (-771.479) (-772.873) [-769.942] (-774.443) * (-773.564) [-772.349] (-770.036) (-772.223) -- 0:00:22
      637500 -- (-772.074) (-771.625) [-770.900] (-770.444) * (-774.296) [-771.064] (-770.305) (-771.365) -- 0:00:22
      638000 -- (-771.335) [-771.574] (-770.357) (-770.680) * (-774.411) (-769.988) (-772.086) [-770.911] -- 0:00:22
      638500 -- [-771.042] (-777.266) (-771.923) (-770.944) * (-774.437) (-772.047) (-771.764) [-769.897] -- 0:00:22
      639000 -- (-770.867) [-772.672] (-774.522) (-770.457) * (-770.319) (-770.442) [-771.908] (-777.179) -- 0:00:22
      639500 -- (-770.889) (-773.884) [-773.142] (-773.831) * (-770.338) (-770.438) [-769.924] (-775.728) -- 0:00:21
      640000 -- (-774.255) [-772.933] (-773.414) (-775.978) * (-771.078) (-772.274) (-770.000) [-773.540] -- 0:00:21

      Average standard deviation of split frequencies: 0.008094

      640500 -- (-771.940) [-773.228] (-772.467) (-772.497) * [-770.572] (-772.238) (-773.985) (-776.995) -- 0:00:22
      641000 -- (-769.950) (-773.382) (-771.421) [-772.108] * (-771.737) (-776.631) (-773.682) [-773.150] -- 0:00:22
      641500 -- (-770.945) [-771.240] (-773.853) (-773.692) * (-771.632) (-771.958) [-773.777] (-774.214) -- 0:00:22
      642000 -- [-770.621] (-771.899) (-781.559) (-773.394) * (-771.476) (-774.232) [-771.774] (-771.841) -- 0:00:22
      642500 -- [-771.683] (-774.876) (-771.232) (-772.199) * (-773.226) (-770.364) (-771.361) [-773.460] -- 0:00:22
      643000 -- (-770.239) (-775.037) [-772.979] (-774.358) * [-770.691] (-773.006) (-772.698) (-773.371) -- 0:00:22
      643500 -- (-770.668) [-770.745] (-770.418) (-770.111) * (-771.934) (-774.809) (-770.870) [-771.565] -- 0:00:22
      644000 -- [-772.692] (-771.904) (-771.269) (-769.926) * [-772.910] (-769.907) (-770.873) (-771.256) -- 0:00:22
      644500 -- (-774.828) [-773.343] (-773.401) (-770.552) * (-773.876) [-771.364] (-771.189) (-771.703) -- 0:00:22
      645000 -- (-772.891) (-772.888) (-770.863) [-774.304] * [-773.777] (-770.398) (-773.103) (-771.728) -- 0:00:22

      Average standard deviation of split frequencies: 0.008437

      645500 -- (-770.871) [-773.749] (-773.234) (-773.123) * (-773.093) (-775.252) (-773.196) [-770.680] -- 0:00:21
      646000 -- (-770.860) [-771.221] (-770.458) (-773.904) * (-771.831) (-776.778) (-772.235) [-772.660] -- 0:00:21
      646500 -- (-770.234) [-774.128] (-771.244) (-771.123) * (-771.702) (-775.547) [-771.103] (-772.660) -- 0:00:21
      647000 -- (-780.879) [-770.533] (-769.888) (-770.676) * [-771.669] (-773.801) (-772.743) (-774.792) -- 0:00:21
      647500 -- [-776.920] (-770.071) (-779.509) (-774.382) * [-771.680] (-773.619) (-773.206) (-772.470) -- 0:00:21
      648000 -- (-771.776) [-770.627] (-773.104) (-777.129) * (-772.613) (-773.739) (-777.576) [-772.738] -- 0:00:21
      648500 -- [-772.226] (-771.222) (-775.207) (-772.348) * (-774.878) (-777.170) (-772.169) [-771.741] -- 0:00:21
      649000 -- (-770.996) [-771.758] (-774.597) (-771.292) * (-774.372) (-774.532) [-774.264] (-772.351) -- 0:00:21
      649500 -- (-773.448) (-771.486) [-771.374] (-771.950) * [-775.241] (-773.652) (-772.188) (-771.521) -- 0:00:21
      650000 -- (-772.218) [-771.287] (-770.511) (-771.324) * (-772.770) (-773.317) (-771.593) [-770.357] -- 0:00:21

      Average standard deviation of split frequencies: 0.008558

      650500 -- (-776.843) [-773.048] (-772.834) (-771.082) * (-772.212) [-770.230] (-774.714) (-770.499) -- 0:00:21
      651000 -- [-770.500] (-775.380) (-774.485) (-774.461) * (-771.701) [-771.902] (-776.616) (-772.008) -- 0:00:21
      651500 -- (-770.375) [-775.169] (-770.818) (-770.907) * [-771.183] (-771.061) (-770.572) (-772.353) -- 0:00:21
      652000 -- (-773.886) [-774.252] (-771.182) (-774.658) * [-771.168] (-771.745) (-770.038) (-771.238) -- 0:00:21
      652500 -- (-770.344) (-775.323) (-770.842) [-773.261] * (-772.674) (-771.705) [-770.000] (-770.805) -- 0:00:21
      653000 -- (-771.424) (-771.040) (-771.798) [-771.657] * (-773.531) [-770.915] (-770.215) (-772.361) -- 0:00:21
      653500 -- [-769.908] (-773.335) (-771.277) (-771.062) * (-770.758) (-774.242) [-774.565] (-770.760) -- 0:00:21
      654000 -- (-769.584) [-771.585] (-770.956) (-769.574) * [-769.744] (-774.121) (-770.438) (-772.773) -- 0:00:21
      654500 -- (-772.358) (-779.087) (-775.388) [-770.805] * (-771.208) (-771.271) (-772.973) [-772.385] -- 0:00:21
      655000 -- (-772.333) (-777.673) [-771.161] (-770.153) * [-771.051] (-771.080) (-771.055) (-771.762) -- 0:00:21

      Average standard deviation of split frequencies: 0.008489

      655500 -- [-772.542] (-772.891) (-770.622) (-770.575) * (-773.437) [-772.425] (-771.087) (-774.907) -- 0:00:21
      656000 -- (-773.131) (-772.859) (-770.625) [-769.997] * [-771.658] (-770.567) (-771.999) (-775.047) -- 0:00:20
      656500 -- [-770.561] (-770.275) (-772.812) (-769.968) * [-771.996] (-770.726) (-773.111) (-770.674) -- 0:00:21
      657000 -- (-770.748) (-770.182) (-772.160) [-769.726] * [-771.304] (-770.763) (-771.338) (-770.715) -- 0:00:21
      657500 -- [-774.014] (-772.377) (-770.058) (-769.727) * (-771.785) [-772.242] (-770.173) (-770.542) -- 0:00:21
      658000 -- (-772.333) (-775.950) [-770.016] (-771.805) * (-771.385) [-771.473] (-769.611) (-771.978) -- 0:00:21
      658500 -- (-772.314) [-775.848] (-771.541) (-771.472) * [-771.085] (-771.833) (-771.075) (-771.770) -- 0:00:21
      659000 -- (-773.834) (-770.913) (-772.514) [-771.930] * [-772.504] (-770.544) (-774.353) (-770.823) -- 0:00:21
      659500 -- (-772.717) (-771.827) [-771.865] (-773.506) * (-776.447) (-770.138) [-773.478] (-772.124) -- 0:00:21
      660000 -- [-770.387] (-772.592) (-772.176) (-772.345) * [-770.378] (-773.160) (-772.688) (-773.849) -- 0:00:21

      Average standard deviation of split frequencies: 0.007983

      660500 -- [-770.867] (-771.746) (-773.963) (-771.257) * (-771.560) (-775.313) (-771.509) [-771.630] -- 0:00:21
      661000 -- [-770.729] (-772.449) (-772.877) (-770.923) * (-771.761) (-778.681) [-771.410] (-772.592) -- 0:00:21
      661500 -- (-772.337) (-770.700) (-769.664) [-770.781] * [-771.617] (-772.800) (-770.801) (-772.186) -- 0:00:20
      662000 -- (-770.277) (-771.980) [-770.904] (-771.569) * (-772.950) (-771.563) (-771.056) [-770.472] -- 0:00:20
      662500 -- (-771.900) [-773.440] (-771.828) (-769.774) * (-771.808) [-773.344] (-773.814) (-775.457) -- 0:00:20
      663000 -- (-774.779) (-772.554) (-769.944) [-773.050] * (-770.889) [-773.452] (-775.459) (-773.209) -- 0:00:20
      663500 -- (-771.314) (-771.382) [-776.738] (-776.366) * [-770.672] (-772.661) (-772.873) (-772.773) -- 0:00:20
      664000 -- (-772.969) (-772.287) [-772.532] (-772.687) * (-771.314) (-773.963) (-772.935) [-774.410] -- 0:00:20
      664500 -- [-772.785] (-771.632) (-770.502) (-773.293) * (-771.622) (-771.525) (-770.047) [-772.242] -- 0:00:20
      665000 -- (-777.792) (-769.807) [-771.991] (-771.130) * [-771.298] (-773.303) (-776.845) (-770.060) -- 0:00:20

      Average standard deviation of split frequencies: 0.008273

      665500 -- [-772.427] (-772.363) (-773.908) (-772.855) * (-770.217) (-774.363) [-771.219] (-771.005) -- 0:00:20
      666000 -- [-774.416] (-775.797) (-772.883) (-771.849) * [-771.118] (-777.118) (-777.976) (-771.038) -- 0:00:20
      666500 -- (-774.126) (-778.505) [-772.425] (-770.962) * [-772.902] (-779.802) (-770.871) (-771.407) -- 0:00:20
      667000 -- (-771.101) (-770.926) (-774.178) [-770.691] * (-773.857) (-778.449) (-773.334) [-771.337] -- 0:00:20
      667500 -- (-771.810) (-778.067) (-771.037) [-773.464] * [-771.902] (-772.201) (-774.898) (-772.405) -- 0:00:20
      668000 -- (-772.838) (-771.003) [-773.190] (-771.364) * (-770.946) [-771.433] (-773.548) (-771.661) -- 0:00:20
      668500 -- (-774.942) (-770.585) [-773.137] (-772.525) * (-772.978) (-774.538) (-770.627) [-771.022] -- 0:00:20
      669000 -- [-772.385] (-771.815) (-771.463) (-773.759) * (-774.880) [-774.498] (-778.432) (-771.999) -- 0:00:20
      669500 -- (-770.267) (-774.672) [-772.047] (-771.674) * (-772.268) (-774.324) [-774.073] (-775.585) -- 0:00:20
      670000 -- (-774.388) [-771.221] (-775.934) (-771.226) * (-771.905) [-772.544] (-771.710) (-772.455) -- 0:00:20

      Average standard deviation of split frequencies: 0.008479

      670500 -- [-771.804] (-772.412) (-774.788) (-771.048) * (-774.983) (-771.660) (-771.941) [-770.661] -- 0:00:20
      671000 -- (-770.982) (-771.440) [-773.193] (-771.275) * (-774.859) (-771.614) (-771.360) [-774.504] -- 0:00:20
      671500 -- (-771.460) (-771.655) [-770.572] (-771.602) * (-771.849) [-771.360] (-773.700) (-773.648) -- 0:00:20
      672000 -- (-771.344) (-772.974) [-771.479] (-773.588) * (-772.676) [-772.706] (-770.246) (-774.424) -- 0:00:20
      672500 -- (-771.055) (-771.776) (-771.922) [-772.865] * (-770.887) (-771.908) [-770.333] (-776.114) -- 0:00:19
      673000 -- [-771.357] (-771.296) (-771.942) (-777.713) * (-773.459) (-776.193) [-774.231] (-778.183) -- 0:00:19
      673500 -- [-772.255] (-773.164) (-770.551) (-770.806) * [-771.195] (-773.866) (-776.219) (-771.688) -- 0:00:20
      674000 -- (-770.792) [-771.839] (-773.504) (-774.884) * (-774.100) [-771.205] (-774.299) (-776.009) -- 0:00:20
      674500 -- (-773.811) (-773.184) (-773.600) [-773.273] * (-771.217) [-771.746] (-772.135) (-771.456) -- 0:00:20
      675000 -- (-771.104) (-773.803) (-771.707) [-770.906] * (-770.624) (-772.827) [-770.809] (-771.386) -- 0:00:20

      Average standard deviation of split frequencies: 0.008150

      675500 -- (-770.472) [-774.401] (-773.572) (-771.158) * (-771.147) (-774.252) (-771.898) [-770.281] -- 0:00:20
      676000 -- (-770.717) [-771.403] (-779.786) (-770.865) * [-772.666] (-777.320) (-771.488) (-770.735) -- 0:00:20
      676500 -- (-770.517) (-770.538) [-773.823] (-772.818) * (-775.325) (-772.690) [-771.306] (-771.661) -- 0:00:20
      677000 -- (-770.976) (-770.153) (-772.783) [-770.424] * (-773.146) (-771.129) [-773.736] (-770.549) -- 0:00:20
      677500 -- (-770.679) (-771.306) (-770.857) [-771.718] * (-773.539) (-775.351) [-772.958] (-770.177) -- 0:00:19
      678000 -- [-772.779] (-772.543) (-775.739) (-772.716) * (-773.214) (-771.474) (-774.666) [-770.180] -- 0:00:19
      678500 -- (-770.345) [-770.955] (-770.817) (-773.010) * (-771.945) (-772.838) [-770.739] (-770.735) -- 0:00:19
      679000 -- (-770.763) (-770.327) (-772.068) [-772.321] * [-772.956] (-773.963) (-771.835) (-772.750) -- 0:00:19
      679500 -- (-771.076) (-770.312) (-773.053) [-773.215] * (-777.210) (-772.624) [-770.807] (-771.484) -- 0:00:19
      680000 -- (-774.194) (-771.088) (-770.265) [-770.360] * (-773.163) (-772.416) [-773.113] (-773.530) -- 0:00:19

      Average standard deviation of split frequencies: 0.008441

      680500 -- (-776.108) (-771.410) (-773.371) [-772.660] * (-770.704) [-771.224] (-771.985) (-770.887) -- 0:00:19
      681000 -- (-772.969) (-773.085) [-771.515] (-776.348) * (-773.237) (-779.078) (-775.717) [-770.686] -- 0:00:19
      681500 -- [-770.340] (-772.142) (-773.363) (-772.052) * [-775.049] (-772.639) (-773.319) (-771.319) -- 0:00:19
      682000 -- (-770.488) [-770.860] (-775.863) (-772.241) * (-773.518) (-773.318) (-772.422) [-769.815] -- 0:00:19
      682500 -- [-771.153] (-771.887) (-773.671) (-772.306) * (-769.796) (-773.197) (-770.310) [-769.690] -- 0:00:19
      683000 -- (-774.184) (-772.072) (-774.440) [-770.693] * (-770.061) [-776.942] (-776.647) (-771.426) -- 0:00:19
      683500 -- (-771.355) [-771.076] (-772.356) (-772.046) * (-771.759) [-772.665] (-771.178) (-775.931) -- 0:00:19
      684000 -- (-774.003) (-770.353) [-769.698] (-772.354) * [-771.729] (-775.405) (-773.305) (-769.959) -- 0:00:19
      684500 -- (-771.877) [-771.704] (-772.597) (-774.059) * (-772.415) (-771.850) [-770.828] (-774.282) -- 0:00:19
      685000 -- (-772.130) [-770.614] (-770.621) (-775.425) * [-771.156] (-771.022) (-770.935) (-771.034) -- 0:00:19

      Average standard deviation of split frequencies: 0.008160

      685500 -- (-773.616) (-773.616) (-771.791) [-772.229] * (-770.743) [-772.262] (-771.211) (-772.065) -- 0:00:19
      686000 -- (-773.443) (-773.209) (-772.601) [-772.486] * (-772.939) (-779.246) (-770.138) [-773.101] -- 0:00:19
      686500 -- (-771.684) (-772.316) (-774.184) [-773.648] * (-773.076) [-773.873] (-771.548) (-771.288) -- 0:00:19
      687000 -- (-772.431) [-774.836] (-772.780) (-772.483) * (-770.258) [-770.780] (-770.815) (-771.344) -- 0:00:19
      687500 -- (-773.352) [-771.596] (-771.263) (-776.260) * (-769.828) (-773.705) (-777.581) [-773.185] -- 0:00:19
      688000 -- (-774.875) (-771.775) [-771.510] (-772.267) * (-773.539) (-771.162) (-771.854) [-770.101] -- 0:00:19
      688500 -- [-774.089] (-771.309) (-770.362) (-774.393) * [-770.586] (-771.116) (-776.595) (-769.676) -- 0:00:19
      689000 -- [-771.440] (-772.167) (-773.244) (-772.258) * (-771.862) (-771.159) [-773.175] (-773.450) -- 0:00:18
      689500 -- (-771.958) (-774.035) [-770.168] (-775.048) * (-774.235) (-770.761) (-772.296) [-772.023] -- 0:00:18