--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:17:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1677/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.26 -774.57
2 -771.24 -774.49
--------------------------------------
TOTAL -771.25 -774.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890083 0.086225 0.365869 1.483477 0.861010 1501.00 1501.00 1.000
r(A<->C){all} 0.163753 0.018611 0.000015 0.431572 0.127768 139.96 155.84 1.008
r(A<->G){all} 0.166838 0.020197 0.000143 0.448462 0.125792 240.74 252.51 1.005
r(A<->T){all} 0.174781 0.021402 0.000110 0.472429 0.136649 183.24 196.39 1.000
r(C<->G){all} 0.159894 0.018443 0.000134 0.427793 0.121892 170.58 229.88 1.000
r(C<->T){all} 0.155123 0.018107 0.000077 0.415961 0.120349 251.04 311.70 1.000
r(G<->T){all} 0.179611 0.021697 0.000125 0.477631 0.140397 173.93 217.83 1.000
pi(A){all} 0.204286 0.000273 0.170463 0.234631 0.204034 1070.29 1101.63 1.000
pi(C){all} 0.358696 0.000392 0.319227 0.396658 0.358595 1045.96 1132.84 1.000
pi(G){all} 0.272190 0.000328 0.237122 0.305993 0.271941 997.24 1143.90 1.000
pi(T){all} 0.164829 0.000233 0.136801 0.194738 0.164560 1233.05 1286.00 1.001
alpha{1,2} 0.439401 0.259233 0.000190 1.461941 0.255873 1115.27 1185.70 1.000
alpha{3} 0.438784 0.216229 0.000314 1.397965 0.289855 1294.38 1306.40 1.000
pinvar{all} 0.997208 0.000011 0.990790 0.999998 0.998314 1234.94 1342.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -741.450683
Model 2: PositiveSelection -741.450653
Model 0: one-ratio -741.45072
Model 7: beta -741.45064
Model 8: beta&w>1 -741.450579
Model 0 vs 1 7.400000004054164E-5
Model 2 vs 1 6.000000007588824E-5
Model 8 vs 7 1.2200000014672696E-4
>C1
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C2
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C3
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C4
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C5
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C6
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=191
C1 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C2 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C3 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C4 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C5 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C6 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
**************************************************
C1 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C2 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C3 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C4 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C5 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C6 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
**************************************************
C1 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C2 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C3 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C4 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C5 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C6 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
**************************************************
C1 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C2 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C3 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C4 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C5 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C6 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
*****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 191 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 191 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5730]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5730]--->[5730]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.732 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C2 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C3 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C4 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C5 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
C6 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
**************************************************
C1 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C2 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C3 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C4 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C5 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
C6 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
**************************************************
C1 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C2 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C3 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C4 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C5 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
C6 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
**************************************************
C1 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C2 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C3 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C4 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C5 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
C6 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
*****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C2 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C3 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C4 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C5 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
C6 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
**************************************************
C1 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C2 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C3 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C4 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C5 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
C6 ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
**************************************************
C1 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C2 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C3 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C4 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C5 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
C6 CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
**************************************************
C1 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C2 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C3 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C4 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C5 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
C6 ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
**************************************************
C1 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C2 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C3 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C4 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C5 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
C6 GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
**************************************************
C1 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C2 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C3 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C4 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C5 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
C6 CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
**************************************************
C1 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C2 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C3 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C4 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C5 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
C6 GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
**************************************************
C1 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C2 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C3 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C4 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C5 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
C6 GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
**************************************************
C1 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C2 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C3 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C4 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C5 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
C6 CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
**************************************************
C1 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C2 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C3 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C4 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C5 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
C6 GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
**************************************************
C1 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C2 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C3 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C4 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C5 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
C6 ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
**************************************************
C1 CGATCAGCCCGGCTCAGTCTCAC
C2 CGATCAGCCCGGCTCAGTCTCAC
C3 CGATCAGCCCGGCTCAGTCTCAC
C4 CGATCAGCCCGGCTCAGTCTCAC
C5 CGATCAGCCCGGCTCAGTCTCAC
C6 CGATCAGCCCGGCTCAGTCTCAC
***********************
>C1
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C2
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C3
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C4
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C5
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C6
GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC
ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA
CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC
ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT
GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG
CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC
GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT
GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG
CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA
GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC
ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC
CGATCAGCCCGGCTCAGTCTCAC
>C1
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C2
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C3
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C4
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C5
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
>C6
VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 573 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857352
Setting output file names to "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1642522672
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5649937995
Seed = 851221243
Swapseed = 1579857352
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1282.401476 -- -24.965149
Chain 2 -- -1282.401476 -- -24.965149
Chain 3 -- -1282.401476 -- -24.965149
Chain 4 -- -1282.401280 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1282.401280 -- -24.965149
Chain 2 -- -1282.401476 -- -24.965149
Chain 3 -- -1282.401403 -- -24.965149
Chain 4 -- -1282.401403 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1282.401] (-1282.401) (-1282.401) (-1282.401) * [-1282.401] (-1282.401) (-1282.401) (-1282.401)
500 -- (-788.673) (-788.593) (-789.058) [-776.300] * (-791.505) (-789.119) (-784.725) [-780.220] -- 0:00:00
1000 -- [-779.785] (-793.291) (-784.258) (-781.717) * (-787.159) (-779.662) [-780.370] (-780.932) -- 0:00:00
1500 -- [-781.242] (-780.013) (-787.853) (-794.381) * (-779.223) [-778.930] (-780.891) (-781.038) -- 0:00:00
2000 -- (-787.737) (-789.051) (-778.702) [-777.471] * (-780.993) [-781.309] (-779.937) (-783.502) -- 0:00:00
2500 -- (-778.185) [-779.578] (-783.793) (-783.631) * (-791.706) [-776.066] (-784.164) (-779.948) -- 0:00:00
3000 -- (-789.646) [-783.937] (-777.238) (-784.624) * [-782.608] (-787.260) (-778.435) (-779.733) -- 0:00:00
3500 -- [-778.673] (-783.529) (-777.953) (-778.281) * (-785.810) (-786.646) (-785.325) [-777.133] -- 0:00:00
4000 -- (-778.957) (-781.828) (-782.527) [-784.382] * (-781.619) [-778.723] (-792.888) (-782.471) -- 0:00:00
4500 -- [-781.697] (-777.769) (-782.393) (-783.442) * [-780.509] (-779.587) (-776.567) (-780.728) -- 0:00:00
5000 -- (-781.589) [-775.562] (-782.160) (-778.576) * (-781.612) (-778.660) [-781.800] (-781.054) -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-778.736) (-777.927) (-776.014) [-787.562] * (-779.976) (-791.061) [-785.023] (-777.667) -- 0:00:00
6000 -- (-788.239) [-784.757] (-783.996) (-789.861) * (-783.936) (-783.051) (-783.293) [-776.445] -- 0:00:00
6500 -- (-784.712) (-783.515) (-783.871) [-777.603] * [-780.055] (-783.055) (-786.135) (-777.487) -- 0:00:00
7000 -- (-783.831) [-782.703] (-783.376) (-781.031) * (-794.697) (-781.678) (-781.527) [-781.122] -- 0:02:21
7500 -- (-786.365) [-778.616] (-785.509) (-787.020) * (-783.744) (-784.898) (-777.387) [-780.426] -- 0:02:12
8000 -- [-780.514] (-782.241) (-785.147) (-782.586) * (-779.683) (-779.660) (-779.831) [-779.248] -- 0:02:04
8500 -- (-782.272) (-779.617) (-788.695) [-780.723] * (-784.157) (-784.681) (-781.711) [-785.124] -- 0:01:56
9000 -- [-780.142] (-782.313) (-785.498) (-780.160) * (-780.507) [-781.169] (-792.715) (-777.244) -- 0:01:50
9500 -- (-783.170) [-778.854] (-782.547) (-781.404) * (-782.356) (-786.144) (-782.528) [-779.158] -- 0:01:44
10000 -- (-780.105) (-775.828) [-783.832] (-780.908) * (-800.475) (-788.713) (-784.167) [-782.990] -- 0:01:39
Average standard deviation of split frequencies: 0.072790
10500 -- (-786.515) (-780.646) [-787.303] (-775.652) * (-787.843) (-780.713) (-780.049) [-781.773] -- 0:01:34
11000 -- (-780.519) (-779.385) [-783.766] (-780.239) * (-772.806) (-784.088) [-786.218] (-785.153) -- 0:01:29
11500 -- (-780.859) (-783.034) [-783.292] (-782.978) * (-773.951) (-780.020) (-775.904) [-782.604] -- 0:01:25
12000 -- (-776.745) [-777.380] (-782.023) (-786.081) * (-771.441) (-785.172) [-781.668] (-788.866) -- 0:01:22
12500 -- (-776.967) (-777.442) [-779.364] (-789.067) * (-774.919) (-779.887) (-778.323) [-777.770] -- 0:01:19
13000 -- (-788.809) [-776.861] (-784.198) (-780.545) * [-770.692] (-793.083) (-778.020) (-785.132) -- 0:01:15
13500 -- (-779.273) [-780.364] (-776.490) (-786.478) * (-769.875) (-785.142) [-781.904] (-782.351) -- 0:01:13
14000 -- (-775.583) [-784.532] (-781.104) (-786.973) * [-770.051] (-777.504) (-786.643) (-780.117) -- 0:01:10
14500 -- (-775.890) [-781.934] (-782.151) (-777.945) * (-772.891) (-779.698) [-780.359] (-779.079) -- 0:01:07
15000 -- (-785.032) [-782.210] (-791.291) (-770.597) * [-772.412] (-787.215) (-784.042) (-776.647) -- 0:01:05
Average standard deviation of split frequencies: 0.069780
15500 -- (-776.609) (-780.905) (-779.089) [-770.986] * (-771.268) [-776.347] (-785.448) (-781.058) -- 0:01:03
16000 -- (-783.100) [-777.153] (-781.941) (-770.753) * (-773.513) (-786.241) [-776.171] (-781.521) -- 0:01:01
16500 -- (-781.532) [-781.717] (-775.665) (-772.521) * (-773.197) (-778.501) [-780.947] (-787.775) -- 0:00:59
17000 -- [-778.820] (-784.661) (-778.866) (-770.899) * [-772.277] (-776.838) (-783.289) (-789.038) -- 0:00:57
17500 -- [-782.477] (-779.422) (-779.610) (-772.276) * [-773.822] (-782.190) (-781.762) (-778.509) -- 0:00:56
18000 -- [-782.237] (-781.373) (-781.885) (-777.900) * (-778.042) (-774.273) (-790.523) [-781.305] -- 0:00:54
18500 -- [-781.906] (-782.081) (-783.368) (-771.745) * (-774.513) (-780.191) [-783.105] (-779.864) -- 0:00:53
19000 -- (-781.165) (-782.512) (-787.118) [-770.686] * (-774.343) (-781.514) [-782.388] (-783.301) -- 0:00:51
19500 -- [-777.210] (-780.226) (-797.395) (-771.582) * [-775.474] (-774.497) (-782.924) (-783.357) -- 0:00:50
20000 -- (-784.590) (-780.394) [-771.920] (-774.181) * (-772.296) (-771.955) (-792.893) [-781.327] -- 0:00:49
Average standard deviation of split frequencies: 0.038016
20500 -- (-780.706) (-780.071) (-770.073) [-770.188] * [-771.169] (-772.218) (-795.980) (-777.254) -- 0:00:47
21000 -- (-783.329) [-782.141] (-776.586) (-771.533) * (-771.288) (-771.509) (-772.347) [-776.659] -- 0:00:46
21500 -- (-779.809) [-784.568] (-771.396) (-772.924) * (-776.734) (-770.838) (-772.316) [-777.502] -- 0:01:31
22000 -- [-776.558] (-787.720) (-771.545) (-769.997) * [-773.285] (-773.612) (-770.746) (-784.210) -- 0:01:28
22500 -- (-787.786) (-778.696) [-771.864] (-773.433) * (-773.079) (-774.211) (-770.849) [-785.078] -- 0:01:26
23000 -- (-778.121) [-777.004] (-773.326) (-774.441) * (-773.441) (-770.288) [-772.059] (-777.262) -- 0:01:24
23500 -- (-780.238) [-779.877] (-770.837) (-771.963) * [-771.712] (-772.007) (-770.917) (-785.295) -- 0:01:23
24000 -- (-781.149) (-786.697) [-771.484] (-773.677) * (-771.443) (-772.837) (-770.440) [-780.438] -- 0:01:21
24500 -- (-781.501) (-784.060) [-772.645] (-772.465) * (-772.256) (-771.126) (-771.728) [-778.503] -- 0:01:19
25000 -- (-779.630) [-785.391] (-771.706) (-771.285) * (-772.682) (-773.689) [-772.597] (-785.991) -- 0:01:18
Average standard deviation of split frequencies: 0.039125
25500 -- [-779.858] (-781.923) (-774.085) (-770.435) * (-772.441) [-771.164] (-771.891) (-783.281) -- 0:01:16
26000 -- (-781.602) (-777.523) [-771.203] (-772.589) * [-772.659] (-772.889) (-771.979) (-774.372) -- 0:01:14
26500 -- (-780.553) (-778.460) [-770.736] (-770.614) * (-773.113) (-774.764) [-771.865] (-774.866) -- 0:01:13
27000 -- (-785.563) (-782.424) (-770.762) [-770.798] * [-770.341] (-771.799) (-772.174) (-776.719) -- 0:01:12
27500 -- (-784.852) (-778.720) (-771.806) [-773.299] * (-770.238) [-771.877] (-772.043) (-772.785) -- 0:01:10
28000 -- (-783.959) (-779.722) [-770.974] (-772.706) * [-769.943] (-774.249) (-771.358) (-772.990) -- 0:01:09
28500 -- (-779.875) [-776.977] (-770.991) (-770.537) * (-769.895) (-770.608) (-770.842) [-771.598] -- 0:01:08
29000 -- (-779.479) [-776.702] (-772.124) (-771.344) * (-772.158) [-770.922] (-771.041) (-771.458) -- 0:01:06
29500 -- [-779.235] (-782.681) (-770.999) (-771.089) * (-770.222) (-771.523) [-772.376] (-774.370) -- 0:01:05
30000 -- (-780.961) (-783.043) (-770.650) [-770.043] * [-770.561] (-773.221) (-775.412) (-774.044) -- 0:01:04
Average standard deviation of split frequencies: 0.041504
30500 -- (-781.519) (-776.994) (-770.331) [-769.740] * (-770.537) (-776.015) (-771.582) [-771.920] -- 0:01:03
31000 -- (-787.631) [-776.767] (-776.320) (-772.100) * (-773.638) (-772.278) (-771.209) [-772.993] -- 0:01:02
31500 -- (-774.441) (-794.473) [-770.696] (-771.258) * (-771.228) [-770.528] (-771.589) (-773.636) -- 0:01:01
32000 -- (-771.434) (-782.950) (-771.227) [-772.814] * (-772.506) (-772.683) (-772.641) [-773.677] -- 0:01:00
32500 -- (-770.159) (-781.841) (-774.052) [-774.494] * (-772.249) [-772.477] (-771.788) (-773.476) -- 0:00:59
33000 -- (-770.558) [-781.792] (-774.446) (-770.403) * (-770.427) (-774.433) (-771.481) [-771.095] -- 0:00:58
33500 -- [-771.153] (-777.774) (-772.216) (-772.813) * (-770.808) (-776.590) (-774.235) [-771.988] -- 0:00:57
34000 -- (-772.565) (-782.426) [-772.929] (-771.538) * (-771.377) [-770.978] (-772.248) (-770.393) -- 0:00:56
34500 -- [-771.194] (-783.737) (-773.911) (-770.588) * (-771.384) (-774.981) [-773.499] (-772.094) -- 0:00:55
35000 -- (-775.273) [-780.563] (-772.113) (-772.013) * [-771.868] (-773.715) (-772.780) (-770.619) -- 0:00:55
Average standard deviation of split frequencies: 0.039938
35500 -- [-773.905] (-783.921) (-772.609) (-773.263) * (-772.622) (-774.458) (-773.631) [-770.067] -- 0:00:54
36000 -- (-772.628) [-779.236] (-771.409) (-772.525) * (-771.627) [-772.694] (-771.347) (-770.283) -- 0:00:53
36500 -- (-771.519) (-780.477) (-770.355) [-772.193] * (-774.974) (-775.980) [-771.476] (-771.853) -- 0:00:52
37000 -- [-773.179] (-782.237) (-770.383) (-773.628) * (-775.300) (-772.740) [-770.570] (-771.521) -- 0:01:18
37500 -- (-774.150) [-776.243] (-771.388) (-777.631) * [-773.550] (-770.631) (-775.007) (-771.793) -- 0:01:17
38000 -- [-769.863] (-792.691) (-770.204) (-771.152) * [-774.448] (-772.074) (-774.344) (-773.339) -- 0:01:15
38500 -- (-770.267) [-780.382] (-771.570) (-771.086) * (-773.871) (-771.312) [-771.869] (-776.184) -- 0:01:14
39000 -- [-770.645] (-783.127) (-777.165) (-770.402) * (-773.443) (-773.716) [-771.195] (-770.046) -- 0:01:13
39500 -- [-769.801] (-783.114) (-774.125) (-770.459) * (-771.540) (-770.678) [-772.933] (-771.461) -- 0:01:12
40000 -- (-774.086) [-783.415] (-771.127) (-774.442) * (-773.643) [-769.918] (-772.366) (-771.405) -- 0:01:12
Average standard deviation of split frequencies: 0.038833
40500 -- [-772.660] (-781.079) (-772.688) (-773.165) * [-772.698] (-775.541) (-771.092) (-770.905) -- 0:01:11
41000 -- [-770.279] (-779.101) (-776.455) (-771.142) * [-772.421] (-770.590) (-774.320) (-770.193) -- 0:01:10
41500 -- (-770.384) [-783.587] (-770.021) (-771.140) * (-772.748) [-770.940] (-772.489) (-770.750) -- 0:01:09
42000 -- [-771.887] (-789.847) (-770.828) (-772.912) * (-772.655) (-778.013) (-771.067) [-771.274] -- 0:01:08
42500 -- (-772.608) (-784.419) [-770.652] (-772.740) * (-770.042) [-776.239] (-773.265) (-772.378) -- 0:01:07
43000 -- (-772.124) [-776.757] (-770.334) (-772.666) * (-772.378) (-771.322) [-771.981] (-771.570) -- 0:01:06
43500 -- [-773.007] (-785.684) (-772.680) (-773.177) * [-772.729] (-770.777) (-772.438) (-774.903) -- 0:01:05
44000 -- (-771.889) [-781.627] (-769.916) (-771.364) * (-771.054) [-773.443] (-772.992) (-770.566) -- 0:01:05
44500 -- [-771.127] (-788.057) (-771.611) (-771.322) * (-774.484) (-772.194) [-774.843] (-771.527) -- 0:01:04
45000 -- (-770.714) (-782.342) [-772.698] (-770.513) * [-771.124] (-774.394) (-775.699) (-772.351) -- 0:01:03
Average standard deviation of split frequencies: 0.035868
45500 -- [-771.581] (-788.338) (-771.892) (-772.006) * (-771.747) [-773.224] (-772.776) (-772.162) -- 0:01:02
46000 -- [-770.052] (-783.558) (-773.371) (-774.129) * (-770.630) (-771.856) [-772.552] (-774.268) -- 0:01:02
46500 -- [-772.320] (-780.841) (-774.206) (-771.983) * [-771.145] (-771.165) (-770.514) (-773.517) -- 0:01:01
47000 -- (-772.409) (-784.551) [-774.939] (-770.284) * (-771.154) (-771.204) (-771.259) [-771.510] -- 0:01:00
47500 -- (-775.812) (-783.468) (-771.352) [-771.537] * (-771.090) (-771.121) (-775.368) [-770.478] -- 0:01:00
48000 -- (-772.015) [-779.350] (-773.486) (-775.234) * [-772.560] (-772.725) (-770.416) (-770.937) -- 0:00:59
48500 -- (-773.828) [-778.016] (-771.085) (-775.218) * (-773.311) [-774.809] (-771.881) (-772.740) -- 0:00:58
49000 -- (-773.217) (-782.187) (-771.102) [-771.822] * (-771.771) [-772.121] (-773.401) (-770.901) -- 0:00:58
49500 -- (-775.057) [-776.291] (-770.025) (-773.045) * (-776.233) [-770.577] (-771.575) (-772.204) -- 0:00:57
50000 -- (-776.167) [-779.364] (-771.794) (-770.728) * (-773.432) [-770.761] (-770.203) (-771.128) -- 0:00:57
Average standard deviation of split frequencies: 0.039077
50500 -- (-772.677) (-779.102) (-770.756) [-770.921] * [-770.795] (-771.235) (-770.235) (-770.989) -- 0:00:56
51000 -- (-771.141) (-775.551) (-774.916) [-772.469] * (-770.553) (-771.362) (-771.780) [-770.232] -- 0:00:55
51500 -- (-771.788) (-781.006) [-771.648] (-770.689) * (-769.955) (-772.949) (-778.755) [-770.649] -- 0:00:55
52000 -- (-772.107) [-780.946] (-774.312) (-771.621) * (-770.508) (-772.103) [-773.362] (-771.497) -- 0:00:54
52500 -- (-773.791) (-778.006) (-771.165) [-771.345] * [-773.038] (-771.383) (-774.378) (-772.163) -- 0:00:54
53000 -- (-772.732) (-783.057) (-770.640) [-773.260] * [-774.052] (-771.498) (-772.872) (-772.086) -- 0:01:11
53500 -- (-776.510) (-774.587) (-772.051) [-771.130] * [-775.027] (-770.950) (-771.859) (-769.718) -- 0:01:10
54000 -- (-771.353) (-776.594) (-770.883) [-770.720] * (-771.196) (-775.761) [-772.444] (-770.678) -- 0:01:10
54500 -- (-771.074) (-784.535) (-771.549) [-773.323] * (-771.657) [-774.155] (-772.669) (-772.038) -- 0:01:09
55000 -- (-776.650) (-780.494) [-772.490] (-772.737) * (-770.804) [-772.599] (-773.123) (-770.947) -- 0:01:08
Average standard deviation of split frequencies: 0.028355
55500 -- (-771.291) [-783.191] (-772.527) (-771.668) * (-771.110) (-770.231) (-773.833) [-771.028] -- 0:01:08
56000 -- (-770.212) (-787.771) (-771.358) [-771.602] * [-771.321] (-769.666) (-776.140) (-771.619) -- 0:01:07
56500 -- (-772.730) (-779.918) [-772.454] (-773.714) * [-772.206] (-772.093) (-773.181) (-770.963) -- 0:01:06
57000 -- [-773.013] (-776.618) (-771.402) (-774.771) * (-773.186) (-772.049) (-771.601) [-770.851] -- 0:01:06
57500 -- (-771.200) [-776.473] (-772.970) (-769.846) * (-772.666) [-772.734] (-774.452) (-770.482) -- 0:01:05
58000 -- (-771.024) [-785.673] (-774.398) (-773.750) * (-772.743) (-770.413) (-771.597) [-772.209] -- 0:01:04
58500 -- [-770.790] (-783.229) (-774.347) (-772.010) * (-774.239) (-774.771) (-770.668) [-772.017] -- 0:01:04
59000 -- (-772.738) (-785.013) (-771.032) [-776.121] * [-770.683] (-774.305) (-770.184) (-774.195) -- 0:01:03
59500 -- (-771.476) (-782.428) [-771.544] (-771.380) * (-774.009) [-771.206] (-770.534) (-771.351) -- 0:01:03
60000 -- (-770.660) (-784.648) [-771.024] (-771.499) * [-772.905] (-770.885) (-776.077) (-771.161) -- 0:01:02
Average standard deviation of split frequencies: 0.026765
60500 -- (-773.190) (-789.957) (-770.792) [-771.276] * (-773.039) (-777.001) [-773.755] (-772.361) -- 0:01:02
61000 -- (-771.821) [-771.759] (-770.809) (-770.425) * (-772.941) [-770.832] (-773.518) (-770.823) -- 0:01:01
61500 -- [-770.838] (-774.366) (-770.908) (-770.114) * (-774.192) (-771.400) (-770.942) [-772.389] -- 0:01:01
62000 -- [-770.872] (-779.922) (-771.786) (-771.802) * [-774.307] (-771.323) (-772.313) (-775.004) -- 0:01:00
62500 -- (-771.372) (-771.887) (-771.177) [-771.410] * (-775.235) (-772.175) [-772.306] (-772.160) -- 0:01:00
63000 -- [-771.443] (-771.739) (-770.752) (-769.822) * (-772.681) (-770.703) [-775.254] (-771.437) -- 0:00:59
63500 -- (-775.948) (-771.077) [-770.012] (-778.395) * [-772.378] (-770.207) (-770.963) (-769.837) -- 0:00:58
64000 -- (-774.787) (-774.458) [-772.114] (-771.051) * (-773.845) (-771.822) (-773.212) [-772.999] -- 0:00:58
64500 -- [-774.213] (-772.448) (-773.009) (-771.107) * (-772.025) [-773.000] (-773.486) (-771.355) -- 0:00:58
65000 -- (-777.491) (-774.725) [-776.014] (-772.991) * (-771.163) (-771.311) [-771.463] (-771.736) -- 0:00:57
Average standard deviation of split frequencies: 0.020356
65500 -- (-773.830) (-771.740) (-771.394) [-771.847] * (-775.906) (-774.814) (-774.329) [-772.760] -- 0:00:57
66000 -- (-775.073) [-772.747] (-771.101) (-772.085) * (-770.492) (-773.899) (-774.592) [-771.982] -- 0:00:56
66500 -- (-772.448) (-775.789) (-776.430) [-771.540] * [-771.860] (-772.683) (-770.595) (-771.884) -- 0:00:56
67000 -- (-773.132) [-770.721] (-774.079) (-771.010) * (-771.818) (-773.948) (-771.001) [-773.163] -- 0:00:55
67500 -- (-775.766) (-774.100) (-772.178) [-770.993] * (-772.077) (-773.688) (-769.632) [-771.434] -- 0:00:55
68000 -- (-774.210) [-773.109] (-771.753) (-774.217) * [-776.067] (-772.615) (-770.662) (-771.162) -- 0:00:54
68500 -- (-773.567) (-773.978) (-772.373) [-772.205] * (-777.440) (-770.976) [-772.877] (-773.533) -- 0:00:54
69000 -- [-773.226] (-772.206) (-772.889) (-774.021) * (-775.877) (-772.590) (-770.247) [-773.594] -- 0:00:53
69500 -- (-772.211) [-770.631] (-770.760) (-771.970) * (-770.050) (-771.223) (-773.304) [-770.011] -- 0:01:06
70000 -- [-771.365] (-770.554) (-771.119) (-773.509) * (-771.726) (-769.940) (-773.231) [-772.297] -- 0:01:06
Average standard deviation of split frequencies: 0.020680
70500 -- [-771.333] (-771.307) (-772.827) (-771.005) * (-771.728) [-771.632] (-776.214) (-773.289) -- 0:01:05
71000 -- (-770.771) (-771.541) (-770.691) [-770.372] * (-771.309) (-772.270) [-774.025] (-772.877) -- 0:01:05
71500 -- [-772.056] (-771.800) (-771.364) (-772.079) * (-774.984) (-770.141) [-773.469] (-774.397) -- 0:01:04
72000 -- (-770.987) (-774.707) [-770.862] (-771.812) * [-770.402] (-770.372) (-770.447) (-774.329) -- 0:01:04
72500 -- [-771.553] (-774.331) (-770.755) (-771.502) * (-772.489) (-772.727) [-771.126] (-772.408) -- 0:01:03
73000 -- (-770.696) (-776.457) [-772.260] (-774.968) * (-772.678) [-771.626] (-771.267) (-772.130) -- 0:01:03
73500 -- (-771.039) (-775.175) (-771.227) [-770.775] * (-770.660) (-771.979) [-770.169] (-774.209) -- 0:01:03
74000 -- (-771.010) (-770.543) [-771.253] (-773.140) * (-773.997) [-770.210] (-770.168) (-771.701) -- 0:01:02
74500 -- [-772.273] (-773.328) (-772.988) (-775.213) * (-778.154) [-773.698] (-773.575) (-775.137) -- 0:01:02
75000 -- (-773.764) [-770.417] (-771.262) (-772.265) * (-776.473) (-774.395) (-773.223) [-772.357] -- 0:01:01
Average standard deviation of split frequencies: 0.022640
75500 -- (-774.980) [-773.035] (-770.710) (-774.001) * (-770.689) (-773.776) (-773.105) [-771.110] -- 0:01:01
76000 -- (-776.084) (-775.580) [-771.387] (-775.083) * (-771.161) [-774.790] (-772.706) (-769.605) -- 0:01:00
76500 -- (-771.804) (-772.668) [-772.512] (-770.634) * (-771.192) (-777.979) [-772.965] (-770.887) -- 0:01:00
77000 -- (-771.819) (-773.416) (-780.609) [-772.141] * (-772.269) (-774.449) (-770.036) [-770.545] -- 0:00:59
77500 -- (-773.191) (-774.835) (-774.457) [-771.773] * (-774.517) (-772.039) (-774.790) [-769.979] -- 0:00:59
78000 -- (-770.826) (-770.798) (-776.351) [-772.038] * (-771.867) [-770.719] (-771.532) (-769.888) -- 0:00:59
78500 -- [-771.713] (-771.305) (-775.108) (-771.255) * (-771.837) (-771.563) (-771.613) [-770.002] -- 0:00:58
79000 -- (-774.372) [-771.867] (-773.288) (-771.257) * [-771.575] (-771.390) (-774.989) (-770.211) -- 0:00:58
79500 -- (-770.214) (-771.390) (-773.987) [-771.107] * (-773.749) [-771.824] (-770.500) (-772.062) -- 0:00:57
80000 -- [-771.449] (-773.949) (-772.548) (-771.555) * [-773.293] (-772.101) (-773.351) (-771.862) -- 0:00:57
Average standard deviation of split frequencies: 0.019250
80500 -- [-772.458] (-771.714) (-773.464) (-771.510) * (-771.376) (-771.462) (-771.924) [-772.671] -- 0:00:57
81000 -- (-772.428) (-771.980) [-772.998] (-770.020) * (-773.095) (-770.040) (-770.816) [-773.345] -- 0:00:56
81500 -- [-772.414] (-771.365) (-772.956) (-771.280) * (-772.092) (-769.964) [-770.565] (-771.245) -- 0:00:56
82000 -- (-772.856) (-775.853) [-770.420] (-771.452) * [-777.574] (-777.137) (-772.325) (-773.341) -- 0:00:55
82500 -- (-776.889) (-775.187) [-770.479] (-772.433) * (-774.136) (-773.276) [-771.036] (-771.741) -- 0:00:55
83000 -- (-780.758) (-773.880) (-772.286) [-771.923] * [-773.991] (-770.695) (-772.101) (-770.461) -- 0:00:55
83500 -- (-770.967) [-772.855] (-770.052) (-770.430) * (-771.051) (-772.378) (-771.497) [-770.739] -- 0:00:54
84000 -- (-771.917) (-772.481) (-770.226) [-772.042] * [-771.423] (-770.703) (-770.761) (-771.333) -- 0:00:54
84500 -- (-773.743) [-773.742] (-775.712) (-774.959) * [-770.380] (-770.986) (-771.833) (-772.681) -- 0:00:54
85000 -- (-773.221) (-774.056) [-770.910] (-774.678) * [-770.841] (-771.952) (-770.583) (-774.564) -- 0:01:04
Average standard deviation of split frequencies: 0.019490
85500 -- (-772.194) (-774.096) (-770.863) [-771.909] * (-770.107) (-771.061) [-770.383] (-771.949) -- 0:01:04
86000 -- (-770.283) (-771.340) (-770.842) [-771.989] * (-770.630) (-773.326) [-772.133] (-770.795) -- 0:01:03
86500 -- (-773.576) (-771.848) [-773.677] (-774.552) * (-770.453) (-773.094) (-772.480) [-771.007] -- 0:01:03
87000 -- (-771.130) [-771.965] (-773.619) (-774.414) * (-772.234) (-773.107) [-771.193] (-772.317) -- 0:01:02
87500 -- [-771.317] (-771.251) (-771.373) (-775.412) * (-771.030) (-772.386) (-774.248) [-771.751] -- 0:01:02
88000 -- (-770.778) (-772.162) (-773.383) [-770.076] * (-771.141) [-771.255] (-776.227) (-771.774) -- 0:01:02
88500 -- [-771.079] (-771.252) (-772.444) (-770.980) * (-771.169) [-771.146] (-776.980) (-773.582) -- 0:01:01
89000 -- (-771.161) [-774.487] (-772.266) (-772.041) * (-771.752) (-772.234) (-772.323) [-773.990] -- 0:01:01
89500 -- [-770.896] (-771.340) (-771.330) (-772.340) * (-772.317) (-773.606) [-774.077] (-772.838) -- 0:01:01
90000 -- (-771.152) (-775.795) (-778.063) [-771.286] * [-769.907] (-771.314) (-774.397) (-772.156) -- 0:01:00
Average standard deviation of split frequencies: 0.021618
90500 -- (-771.593) [-772.351] (-775.784) (-769.920) * [-772.318] (-770.649) (-771.148) (-771.917) -- 0:01:00
91000 -- (-773.049) (-772.592) [-772.601] (-772.764) * (-772.527) (-777.432) [-771.063] (-773.437) -- 0:00:59
91500 -- (-776.741) (-774.793) (-773.414) [-770.433] * (-769.969) (-775.950) (-771.107) [-771.347] -- 0:00:59
92000 -- (-773.912) [-772.478] (-772.927) (-770.628) * (-770.256) (-771.747) (-769.857) [-770.670] -- 0:00:59
92500 -- [-773.761] (-771.775) (-771.368) (-772.292) * (-773.576) (-774.660) (-778.587) [-774.541] -- 0:00:58
93000 -- (-771.540) (-772.355) (-770.562) [-778.346] * [-770.879] (-770.883) (-774.900) (-776.603) -- 0:00:58
93500 -- (-772.429) (-773.830) [-770.393] (-772.881) * (-770.648) [-772.396] (-772.413) (-772.813) -- 0:00:58
94000 -- (-773.821) (-774.688) [-772.686] (-769.948) * [-773.604] (-771.362) (-772.643) (-771.117) -- 0:00:57
94500 -- (-774.508) (-771.731) (-771.814) [-769.896] * [-774.147] (-773.291) (-773.682) (-771.979) -- 0:00:57
95000 -- (-776.810) [-770.832] (-774.143) (-774.125) * [-774.037] (-771.957) (-771.225) (-774.037) -- 0:00:57
Average standard deviation of split frequencies: 0.020624
95500 -- (-773.855) (-769.803) (-777.280) [-774.484] * (-771.841) (-771.142) (-772.136) [-771.962] -- 0:00:56
96000 -- (-770.008) [-770.952] (-774.241) (-774.704) * [-772.322] (-773.289) (-771.662) (-770.062) -- 0:00:56
96500 -- (-772.392) (-771.702) [-772.564] (-772.366) * [-769.955] (-774.990) (-776.043) (-771.065) -- 0:00:56
97000 -- (-773.926) (-773.804) (-771.699) [-771.669] * [-770.846] (-772.017) (-774.835) (-769.966) -- 0:00:55
97500 -- (-772.704) (-774.657) (-771.390) [-771.993] * (-770.211) (-772.786) [-773.825] (-771.332) -- 0:00:55
98000 -- [-772.731] (-771.418) (-771.587) (-770.571) * (-771.150) [-769.889] (-772.972) (-771.732) -- 0:00:55
98500 -- [-772.618] (-771.554) (-769.979) (-770.868) * (-773.280) (-770.409) [-771.660] (-770.312) -- 0:00:54
99000 -- [-772.228] (-771.863) (-773.440) (-770.403) * (-771.620) (-770.447) (-770.000) [-772.644] -- 0:00:54
99500 -- (-772.645) (-772.405) [-774.462] (-770.292) * [-771.504] (-771.565) (-771.973) (-773.290) -- 0:00:54
100000 -- (-771.036) [-771.601] (-772.645) (-774.406) * (-773.937) (-775.478) [-771.710] (-774.130) -- 0:00:54
Average standard deviation of split frequencies: 0.017691
100500 -- (-771.420) (-772.555) [-770.916] (-776.702) * (-772.211) (-772.397) [-770.887] (-773.162) -- 0:01:02
101000 -- (-771.562) (-774.090) [-770.389] (-773.529) * [-773.490] (-772.498) (-771.550) (-774.090) -- 0:01:02
101500 -- (-770.882) [-774.368] (-773.500) (-771.841) * (-773.846) [-771.646] (-771.510) (-773.221) -- 0:01:01
102000 -- (-771.103) [-770.742] (-771.814) (-771.401) * [-777.220] (-776.296) (-770.450) (-770.555) -- 0:01:01
102500 -- [-771.286] (-770.448) (-771.255) (-770.653) * (-771.261) (-778.203) [-769.882] (-772.500) -- 0:01:01
103000 -- (-771.539) [-775.395] (-772.714) (-770.653) * (-771.196) (-777.844) [-770.302] (-772.396) -- 0:01:00
103500 -- (-778.194) (-772.443) [-769.677] (-770.155) * (-777.022) (-773.796) (-770.918) [-771.287] -- 0:01:00
104000 -- (-779.424) (-770.643) [-772.135] (-769.721) * [-774.053] (-777.714) (-773.996) (-774.763) -- 0:01:00
104500 -- (-772.826) [-770.999] (-774.751) (-770.467) * (-775.843) (-773.350) [-775.713] (-775.665) -- 0:00:59
105000 -- (-775.648) (-770.783) (-771.872) [-773.324] * (-775.635) (-773.924) (-774.406) [-770.214] -- 0:00:59
Average standard deviation of split frequencies: 0.016619
105500 -- (-778.662) (-771.743) (-771.904) [-771.953] * (-770.990) [-770.463] (-773.752) (-773.699) -- 0:00:59
106000 -- (-773.210) (-772.580) (-775.534) [-770.289] * [-771.166] (-771.186) (-775.322) (-775.035) -- 0:00:59
106500 -- [-775.904] (-774.028) (-770.193) (-771.944) * [-770.030] (-772.580) (-773.824) (-772.876) -- 0:00:58
107000 -- (-771.677) (-772.165) [-770.850] (-772.921) * (-770.375) (-772.348) (-771.348) [-771.243] -- 0:00:58
107500 -- (-777.434) (-776.785) (-773.948) [-772.995] * [-770.591] (-774.839) (-772.782) (-770.937) -- 0:00:58
108000 -- (-770.688) (-775.067) [-771.633] (-773.280) * [-771.476] (-772.699) (-771.027) (-769.863) -- 0:00:57
108500 -- (-770.126) [-772.476] (-773.801) (-778.689) * (-772.042) (-773.241) [-773.945] (-772.448) -- 0:00:57
109000 -- (-772.434) [-772.016] (-771.056) (-777.221) * (-777.326) (-771.320) (-773.362) [-771.733] -- 0:00:57
109500 -- [-772.632] (-771.834) (-776.203) (-772.720) * (-773.136) (-777.694) [-770.876] (-776.759) -- 0:00:56
110000 -- (-772.728) (-772.171) (-770.723) [-771.279] * (-773.794) (-771.572) (-771.106) [-771.248] -- 0:00:56
Average standard deviation of split frequencies: 0.019281
110500 -- (-770.416) (-776.701) [-771.556] (-770.869) * (-773.421) [-773.003] (-774.217) (-772.345) -- 0:00:56
111000 -- (-772.273) (-771.316) (-772.143) [-770.721] * (-778.039) [-773.590] (-777.960) (-772.003) -- 0:00:56
111500 -- (-773.683) (-774.294) (-771.257) [-771.751] * [-771.352] (-771.349) (-772.830) (-771.931) -- 0:00:55
112000 -- (-771.045) [-770.725] (-773.129) (-771.002) * [-774.834] (-770.311) (-771.632) (-769.815) -- 0:00:55
112500 -- [-771.736] (-769.706) (-771.403) (-772.688) * [-770.349] (-770.250) (-771.954) (-771.019) -- 0:00:55
113000 -- (-770.948) (-771.451) (-772.245) [-770.028] * (-772.166) (-772.390) [-771.413] (-772.792) -- 0:00:54
113500 -- (-773.534) [-774.432] (-773.833) (-774.782) * (-771.384) (-770.806) [-774.580] (-774.386) -- 0:00:54
114000 -- (-770.892) (-775.096) (-772.169) [-772.343] * (-773.494) (-771.111) [-772.681] (-774.457) -- 0:00:54
114500 -- (-771.710) (-773.628) (-774.312) [-770.317] * (-772.487) [-771.505] (-776.387) (-774.292) -- 0:00:54
115000 -- (-770.187) (-775.202) (-771.322) [-770.083] * [-770.633] (-771.505) (-773.514) (-771.313) -- 0:00:53
Average standard deviation of split frequencies: 0.019250
115500 -- [-769.674] (-771.038) (-771.872) (-769.913) * (-771.038) (-770.257) (-772.392) [-771.046] -- 0:00:53
116000 -- [-770.756] (-774.989) (-774.561) (-769.922) * (-777.814) (-770.978) (-770.697) [-770.707] -- 0:00:53
116500 -- (-773.942) (-773.022) (-778.409) [-770.590] * (-772.653) (-770.192) (-773.714) [-771.247] -- 0:01:00
117000 -- (-775.197) (-771.546) (-772.225) [-775.656] * [-770.800] (-774.230) (-773.022) (-771.783) -- 0:01:00
117500 -- (-777.660) (-773.777) [-771.481] (-773.717) * (-774.708) [-771.868] (-770.761) (-770.485) -- 0:01:00
118000 -- [-772.403] (-771.308) (-772.135) (-774.017) * (-773.328) (-772.034) [-772.093] (-769.803) -- 0:00:59
118500 -- (-770.468) [-771.923] (-771.724) (-770.178) * [-775.388] (-770.253) (-771.953) (-772.113) -- 0:00:59
119000 -- (-769.579) (-773.450) (-773.516) [-770.109] * (-770.817) [-772.393] (-771.243) (-772.329) -- 0:00:59
119500 -- (-769.584) [-772.350] (-774.127) (-771.285) * (-772.053) (-771.116) [-770.596] (-772.751) -- 0:00:58
120000 -- (-771.311) (-774.644) [-771.691] (-770.802) * (-773.649) (-770.929) [-770.665] (-772.236) -- 0:00:58
Average standard deviation of split frequencies: 0.018711
120500 -- (-770.268) (-774.142) (-772.744) [-771.347] * (-772.397) [-771.677] (-771.031) (-775.112) -- 0:00:58
121000 -- [-770.234] (-771.398) (-771.666) (-770.822) * (-772.429) [-774.153] (-771.003) (-773.018) -- 0:00:58
121500 -- (-773.585) (-771.854) (-774.775) [-773.642] * (-770.470) (-773.119) (-773.124) [-771.757] -- 0:00:57
122000 -- (-773.440) (-772.001) [-773.450] (-775.601) * [-770.570] (-773.432) (-773.258) (-774.300) -- 0:00:57
122500 -- (-772.793) [-772.920] (-777.561) (-773.716) * [-770.802] (-774.711) (-772.060) (-770.643) -- 0:00:57
123000 -- [-770.649] (-771.691) (-775.161) (-774.253) * (-771.392) (-770.851) [-770.051] (-771.000) -- 0:00:57
123500 -- (-774.842) [-771.392] (-770.327) (-773.461) * (-770.804) (-773.366) (-770.224) [-771.861] -- 0:00:56
124000 -- (-777.002) [-770.641] (-770.439) (-771.205) * [-773.011] (-771.776) (-771.765) (-773.447) -- 0:00:56
124500 -- (-772.746) [-772.009] (-770.780) (-770.795) * [-773.258] (-770.508) (-776.155) (-774.426) -- 0:00:56
125000 -- (-770.771) [-771.859] (-770.847) (-770.263) * (-773.368) (-772.023) [-771.014] (-771.069) -- 0:00:56
Average standard deviation of split frequencies: 0.019100
125500 -- (-773.043) (-771.965) (-770.729) [-769.548] * [-771.101] (-773.458) (-770.854) (-771.867) -- 0:00:55
126000 -- [-777.022] (-770.831) (-772.265) (-771.418) * (-772.191) (-775.306) (-774.619) [-771.718] -- 0:00:55
126500 -- (-776.806) (-770.586) [-771.062] (-770.615) * (-773.206) (-772.487) (-775.051) [-771.141] -- 0:00:55
127000 -- (-773.705) [-771.053] (-770.127) (-770.686) * (-774.034) [-771.781] (-771.864) (-774.810) -- 0:00:54
127500 -- (-776.091) (-772.221) (-770.039) [-770.177] * (-771.306) (-773.284) (-772.433) [-773.540] -- 0:00:54
128000 -- (-775.106) (-771.466) (-772.026) [-770.895] * (-771.527) [-771.883] (-773.312) (-771.227) -- 0:00:54
128500 -- (-771.985) [-770.992] (-771.044) (-770.208) * (-772.306) [-772.653] (-770.861) (-772.828) -- 0:00:54
129000 -- (-771.988) [-773.695] (-770.706) (-777.094) * [-773.485] (-770.752) (-771.053) (-778.051) -- 0:00:54
129500 -- (-772.074) (-774.611) [-771.158] (-773.229) * (-772.018) (-771.860) [-772.036] (-773.286) -- 0:00:53
130000 -- (-772.313) (-770.879) [-769.747] (-776.075) * (-770.390) [-772.469] (-770.215) (-770.518) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
130500 -- [-773.404] (-774.961) (-770.512) (-772.410) * (-770.075) (-775.334) [-770.892] (-769.845) -- 0:00:53
131000 -- [-771.689] (-770.724) (-771.186) (-771.248) * (-769.704) [-771.791] (-773.656) (-769.844) -- 0:00:53
131500 -- (-772.361) [-770.640] (-772.742) (-770.943) * (-777.669) (-773.912) (-778.039) [-769.991] -- 0:00:52
132000 -- (-774.422) [-771.124] (-772.513) (-771.000) * [-772.310] (-771.794) (-772.343) (-771.513) -- 0:00:52
132500 -- (-775.269) (-772.302) [-769.855] (-770.499) * (-772.738) [-772.248] (-776.784) (-772.035) -- 0:00:52
133000 -- (-777.814) (-770.849) (-770.728) [-771.135] * (-771.475) (-769.735) (-772.336) [-771.408] -- 0:00:58
133500 -- (-771.817) (-770.539) (-769.998) [-772.224] * (-770.306) (-776.233) (-771.438) [-773.164] -- 0:00:58
134000 -- [-774.725] (-771.097) (-773.472) (-771.021) * (-772.518) (-774.481) [-772.911] (-773.251) -- 0:00:58
134500 -- (-771.759) [-771.524] (-771.581) (-771.688) * (-771.996) [-772.784] (-773.555) (-774.456) -- 0:00:57
135000 -- (-771.847) (-773.206) (-772.694) [-771.973] * (-770.659) (-771.291) [-772.065] (-771.011) -- 0:00:57
Average standard deviation of split frequencies: 0.019064
135500 -- (-779.966) (-774.262) (-773.494) [-771.462] * (-772.729) [-774.934] (-771.667) (-771.699) -- 0:00:57
136000 -- (-775.956) (-775.163) (-770.173) [-771.587] * (-772.076) [-770.365] (-773.367) (-771.306) -- 0:00:57
136500 -- (-770.667) (-773.537) [-770.327] (-771.377) * (-772.270) [-769.893] (-776.648) (-773.201) -- 0:00:56
137000 -- (-775.213) [-772.440] (-773.056) (-775.046) * (-771.385) [-769.815] (-775.455) (-772.016) -- 0:00:56
137500 -- (-775.143) [-772.285] (-773.742) (-775.161) * (-772.534) (-771.922) (-772.977) [-771.742] -- 0:00:56
138000 -- (-771.025) [-775.719] (-774.495) (-775.058) * [-773.407] (-773.639) (-770.375) (-772.367) -- 0:00:56
138500 -- (-771.662) (-775.997) (-772.808) [-771.129] * [-770.943] (-770.841) (-770.530) (-773.621) -- 0:00:55
139000 -- (-770.867) (-776.819) (-773.350) [-771.928] * [-772.655] (-774.913) (-773.436) (-771.606) -- 0:00:55
139500 -- (-770.247) (-775.227) (-773.731) [-771.676] * [-771.921] (-771.805) (-770.918) (-773.929) -- 0:00:55
140000 -- [-773.178] (-775.605) (-777.704) (-773.147) * [-771.586] (-772.178) (-772.750) (-773.764) -- 0:00:55
Average standard deviation of split frequencies: 0.020989
140500 -- [-771.960] (-770.734) (-771.694) (-774.313) * (-770.939) [-772.970] (-772.401) (-773.646) -- 0:00:55
141000 -- [-771.048] (-773.324) (-771.677) (-775.385) * (-774.069) (-772.769) [-772.374] (-771.215) -- 0:00:54
141500 -- [-772.226] (-771.258) (-772.652) (-771.698) * [-771.732] (-770.308) (-772.378) (-771.553) -- 0:00:54
142000 -- (-771.704) [-771.320] (-772.145) (-772.008) * (-771.534) [-770.497] (-774.889) (-772.325) -- 0:00:54
142500 -- (-771.059) (-772.752) [-771.874] (-772.283) * (-770.690) [-770.199] (-769.996) (-770.693) -- 0:00:54
143000 -- (-772.752) [-771.647] (-770.692) (-771.553) * (-771.816) (-772.461) (-772.603) [-771.062] -- 0:00:53
143500 -- [-770.528] (-771.839) (-770.709) (-772.202) * [-770.706] (-773.776) (-773.160) (-770.193) -- 0:00:53
144000 -- [-770.852] (-773.954) (-771.219) (-773.796) * (-772.218) (-774.856) (-772.830) [-771.161] -- 0:00:53
144500 -- (-772.851) [-772.801] (-772.755) (-772.473) * (-770.996) (-770.037) [-770.962] (-772.712) -- 0:00:53
145000 -- [-774.131] (-772.110) (-773.826) (-771.810) * (-773.680) [-771.661] (-773.449) (-772.610) -- 0:00:53
Average standard deviation of split frequencies: 0.019713
145500 -- (-772.627) (-770.481) (-772.323) [-770.398] * (-775.181) (-776.289) (-771.011) [-772.887] -- 0:00:52
146000 -- (-771.345) [-771.660] (-773.893) (-773.550) * (-773.908) (-769.970) (-771.755) [-769.712] -- 0:00:52
146500 -- [-771.679] (-772.841) (-772.804) (-770.949) * (-772.493) (-770.302) (-770.567) [-773.130] -- 0:00:52
147000 -- [-770.075] (-770.088) (-774.618) (-774.863) * [-777.913] (-772.065) (-770.364) (-772.157) -- 0:00:52
147500 -- [-770.407] (-772.517) (-770.970) (-775.707) * (-771.478) (-772.775) [-772.013] (-771.640) -- 0:00:52
148000 -- (-772.221) (-773.852) (-770.848) [-778.813] * (-770.599) (-771.825) (-770.916) [-770.209] -- 0:00:51
148500 -- (-772.027) (-777.530) (-771.493) [-774.674] * (-772.064) [-772.319] (-771.058) (-771.547) -- 0:00:51
149000 -- (-775.504) (-772.351) (-771.271) [-771.560] * (-770.896) (-773.920) (-778.538) [-771.192] -- 0:00:51
149500 -- (-770.941) (-770.392) [-771.748] (-771.474) * [-773.530] (-770.297) (-774.345) (-772.205) -- 0:00:56
150000 -- (-772.405) (-771.872) (-772.195) [-771.582] * (-770.727) (-775.053) [-771.033] (-771.865) -- 0:00:56
Average standard deviation of split frequencies: 0.020511
150500 -- [-773.610] (-771.725) (-771.159) (-780.833) * [-770.964] (-773.380) (-775.021) (-771.324) -- 0:00:56
151000 -- (-772.411) [-771.002] (-773.825) (-774.333) * (-770.574) (-773.806) (-772.444) [-771.562] -- 0:00:56
151500 -- (-772.268) [-771.731] (-772.338) (-774.104) * [-771.619] (-770.234) (-772.840) (-770.247) -- 0:00:56
152000 -- (-772.093) (-774.122) [-772.534] (-772.059) * (-772.166) [-770.715] (-770.406) (-771.835) -- 0:00:55
152500 -- [-772.555] (-773.406) (-772.655) (-772.055) * [-772.804] (-770.584) (-770.707) (-770.301) -- 0:00:55
153000 -- [-771.820] (-773.737) (-773.610) (-772.926) * [-772.232] (-772.892) (-773.236) (-772.893) -- 0:00:55
153500 -- (-771.874) (-771.681) (-772.130) [-772.657] * [-771.168] (-770.271) (-771.951) (-774.023) -- 0:00:55
154000 -- (-770.702) [-769.942] (-772.061) (-771.457) * (-770.735) (-774.817) [-773.752] (-771.985) -- 0:00:54
154500 -- (-771.148) (-772.303) [-771.903] (-773.035) * (-779.398) (-770.659) (-771.155) [-772.038] -- 0:00:54
155000 -- (-772.084) (-771.267) (-770.645) [-771.638] * (-772.079) [-773.750] (-772.794) (-772.386) -- 0:00:54
Average standard deviation of split frequencies: 0.020817
155500 -- (-773.478) (-774.367) [-775.321] (-772.080) * (-771.058) (-775.026) (-771.723) [-773.169] -- 0:00:54
156000 -- (-772.489) [-770.598] (-771.726) (-773.900) * (-775.871) (-770.581) (-778.487) [-770.296] -- 0:00:54
156500 -- [-772.666] (-771.963) (-770.661) (-776.717) * [-773.144] (-770.108) (-770.802) (-771.061) -- 0:00:53
157000 -- [-771.709] (-771.949) (-771.039) (-772.266) * (-774.220) (-771.120) (-772.522) [-771.124] -- 0:00:53
157500 -- (-773.050) (-771.047) [-769.825] (-772.939) * (-771.775) [-770.169] (-770.514) (-771.348) -- 0:00:53
158000 -- (-773.328) (-770.921) (-770.818) [-772.529] * [-773.940] (-773.074) (-771.792) (-772.222) -- 0:00:53
158500 -- (-770.372) (-770.303) [-772.491] (-771.278) * (-772.307) [-773.694] (-770.938) (-772.292) -- 0:00:53
159000 -- (-770.762) (-770.471) (-773.228) [-771.359] * (-771.168) (-772.231) [-770.820] (-772.074) -- 0:00:52
159500 -- (-771.562) [-770.646] (-774.032) (-772.229) * (-771.191) (-771.558) [-770.822] (-770.756) -- 0:00:52
160000 -- (-771.159) [-773.968] (-774.071) (-772.326) * [-770.209] (-771.810) (-771.026) (-770.840) -- 0:00:52
Average standard deviation of split frequencies: 0.020193
160500 -- (-770.403) (-775.687) [-776.607] (-772.784) * (-771.785) (-772.247) [-776.796] (-770.351) -- 0:00:52
161000 -- (-771.103) [-773.029] (-771.249) (-772.437) * (-771.277) [-771.480] (-771.398) (-774.452) -- 0:00:52
161500 -- (-774.581) (-773.135) [-773.665] (-773.147) * (-773.193) [-771.206] (-772.078) (-770.404) -- 0:00:51
162000 -- [-769.980] (-773.134) (-771.389) (-771.822) * (-771.660) (-771.210) [-771.922] (-770.195) -- 0:00:51
162500 -- [-771.571] (-773.957) (-771.922) (-771.196) * (-771.926) [-773.210] (-771.363) (-775.454) -- 0:00:51
163000 -- (-771.618) [-770.868] (-772.730) (-772.650) * [-771.644] (-772.181) (-770.939) (-770.398) -- 0:00:51
163500 -- [-771.686] (-774.322) (-771.675) (-772.562) * [-771.918] (-774.316) (-771.552) (-771.559) -- 0:00:51
164000 -- (-771.654) (-771.552) [-772.091] (-772.765) * (-772.171) (-773.651) [-772.938] (-775.058) -- 0:00:50
164500 -- [-772.446] (-772.185) (-770.400) (-770.168) * (-771.127) [-771.910] (-775.744) (-773.720) -- 0:00:50
165000 -- (-774.776) (-775.095) [-770.547] (-770.179) * [-772.486] (-773.259) (-772.919) (-775.603) -- 0:00:50
Average standard deviation of split frequencies: 0.019131
165500 -- (-772.843) (-774.868) (-771.084) [-771.724] * (-771.377) [-770.918] (-776.589) (-772.607) -- 0:00:50
166000 -- (-776.359) (-773.825) (-771.153) [-770.436] * (-772.810) [-772.857] (-774.140) (-771.143) -- 0:00:55
166500 -- (-772.498) (-770.721) [-771.139] (-770.279) * (-773.751) (-776.852) [-772.705] (-773.588) -- 0:00:55
167000 -- [-773.520] (-776.615) (-774.940) (-770.650) * (-773.390) [-776.947] (-775.654) (-771.428) -- 0:00:54
167500 -- (-773.067) (-773.885) [-772.196] (-772.400) * (-771.749) (-769.971) [-772.030] (-770.244) -- 0:00:54
168000 -- (-771.226) (-771.857) (-771.541) [-769.842] * (-773.064) [-771.924] (-773.584) (-771.703) -- 0:00:54
168500 -- [-773.216] (-771.706) (-773.458) (-769.851) * (-773.844) (-772.109) [-772.810] (-770.167) -- 0:00:54
169000 -- [-774.721] (-773.251) (-771.671) (-773.243) * (-771.677) (-772.410) [-769.716] (-770.649) -- 0:00:54
169500 -- [-771.580] (-772.671) (-772.880) (-772.493) * [-773.535] (-771.836) (-772.289) (-769.945) -- 0:00:53
170000 -- (-772.602) (-773.647) [-773.267] (-773.673) * (-771.459) (-771.895) [-770.465] (-770.884) -- 0:00:53
Average standard deviation of split frequencies: 0.020563
170500 -- [-770.877] (-771.707) (-773.143) (-771.316) * (-771.750) (-776.542) [-772.965] (-769.946) -- 0:00:53
171000 -- (-771.212) [-770.665] (-772.126) (-771.387) * (-774.879) (-775.230) (-775.576) [-769.957] -- 0:00:53
171500 -- (-774.449) [-769.915] (-779.961) (-771.467) * (-772.602) (-774.254) (-771.314) [-770.396] -- 0:00:53
172000 -- (-775.212) [-772.244] (-773.089) (-774.098) * (-775.987) (-772.475) (-770.639) [-770.064] -- 0:00:52
172500 -- (-770.741) [-777.475] (-771.825) (-771.241) * [-776.345] (-772.852) (-774.245) (-770.894) -- 0:00:52
173000 -- (-770.467) (-772.243) [-772.438] (-771.266) * (-775.487) (-771.623) [-772.796] (-770.551) -- 0:00:52
173500 -- (-770.820) (-769.997) [-772.491] (-769.842) * (-772.927) (-771.426) [-773.295] (-771.092) -- 0:00:52
174000 -- (-770.892) (-771.121) (-770.685) [-772.478] * [-775.874] (-772.937) (-770.982) (-772.339) -- 0:00:52
174500 -- [-771.884] (-773.446) (-770.890) (-771.939) * (-772.280) [-770.929] (-771.035) (-772.268) -- 0:00:52
175000 -- [-770.164] (-774.279) (-773.139) (-769.998) * (-775.328) (-770.795) (-772.154) [-776.955] -- 0:00:51
Average standard deviation of split frequencies: 0.021743
175500 -- (-774.259) [-774.552] (-772.286) (-771.727) * (-771.495) [-771.112] (-771.683) (-776.427) -- 0:00:51
176000 -- (-773.779) (-770.118) (-771.222) [-772.100] * (-770.765) (-773.578) [-771.256] (-774.834) -- 0:00:51
176500 -- (-770.024) (-772.607) [-774.067] (-773.232) * [-771.192] (-773.917) (-770.416) (-770.966) -- 0:00:51
177000 -- (-771.154) (-774.795) (-771.769) [-771.070] * (-772.571) (-772.084) (-770.633) [-769.986] -- 0:00:51
177500 -- [-772.849] (-770.797) (-772.050) (-776.799) * (-776.432) (-771.050) (-771.288) [-770.894] -- 0:00:50
178000 -- (-773.776) [-774.055] (-776.569) (-771.105) * (-773.455) [-769.995] (-771.956) (-774.077) -- 0:00:50
178500 -- [-772.685] (-771.091) (-774.986) (-771.131) * (-773.139) (-772.128) (-772.640) [-771.602] -- 0:00:50
179000 -- (-771.687) (-770.089) [-773.561] (-770.786) * (-772.374) (-771.797) (-773.630) [-771.712] -- 0:00:50
179500 -- (-771.076) (-770.064) [-772.246] (-771.725) * [-772.730] (-771.276) (-773.361) (-773.354) -- 0:00:50
180000 -- (-774.713) (-773.259) (-771.257) [-771.196] * (-773.823) (-770.564) (-773.664) [-770.187] -- 0:00:50
Average standard deviation of split frequencies: 0.022179
180500 -- (-771.060) (-769.608) (-770.720) [-771.672] * (-773.080) (-770.381) (-774.103) [-771.997] -- 0:00:49
181000 -- (-770.527) (-771.111) (-772.228) [-771.095] * (-770.098) (-770.776) [-772.127] (-774.461) -- 0:00:49
181500 -- (-771.586) (-771.327) (-770.501) [-772.835] * [-770.166] (-771.823) (-771.504) (-771.430) -- 0:00:49
182000 -- (-771.524) (-771.053) (-774.898) [-771.970] * (-774.257) (-771.545) [-772.115] (-771.580) -- 0:00:49
182500 -- (-772.886) [-772.192] (-775.184) (-771.373) * (-769.981) (-771.649) (-774.544) [-772.304] -- 0:00:53
183000 -- (-771.340) (-777.496) [-773.665] (-770.277) * (-769.946) (-771.938) (-773.016) [-772.336] -- 0:00:53
183500 -- (-774.892) (-773.513) [-774.990] (-770.133) * (-770.490) (-776.355) (-771.184) [-770.211] -- 0:00:53
184000 -- (-770.291) (-770.712) (-770.745) [-771.160] * (-771.654) (-775.778) (-770.861) [-772.536] -- 0:00:53
184500 -- (-773.575) [-771.011] (-770.690) (-771.454) * [-771.601] (-770.948) (-774.822) (-771.430) -- 0:00:53
185000 -- (-772.822) (-773.806) [-770.583] (-772.736) * (-769.999) (-773.071) (-771.890) [-770.221] -- 0:00:52
Average standard deviation of split frequencies: 0.022410
185500 -- (-770.839) (-771.786) (-775.171) [-771.717] * (-771.594) [-775.329] (-776.122) (-772.365) -- 0:00:52
186000 -- (-771.474) (-771.507) (-772.315) [-773.798] * (-773.993) (-771.681) (-772.049) [-769.850] -- 0:00:52
186500 -- (-771.677) (-774.102) [-772.995] (-771.106) * (-775.834) [-772.466] (-772.072) (-775.836) -- 0:00:52
187000 -- [-771.308] (-771.141) (-772.091) (-769.816) * [-772.893] (-773.340) (-771.808) (-771.170) -- 0:00:52
187500 -- [-772.767] (-770.877) (-770.504) (-770.387) * (-772.270) (-775.250) (-773.209) [-774.334] -- 0:00:52
188000 -- (-777.393) (-770.909) (-771.843) [-770.509] * (-770.268) (-774.147) (-775.557) [-772.381] -- 0:00:51
188500 -- [-773.419] (-774.464) (-772.641) (-771.063) * [-770.644] (-773.091) (-771.751) (-771.466) -- 0:00:51
189000 -- [-772.560] (-775.423) (-770.146) (-771.861) * (-776.298) (-773.281) (-770.761) [-770.229] -- 0:00:51
189500 -- (-773.576) (-777.723) [-774.794] (-770.376) * (-776.812) (-773.885) [-770.274] (-772.689) -- 0:00:51
190000 -- (-776.823) [-770.615] (-772.762) (-771.786) * (-776.944) (-772.320) [-770.897] (-773.008) -- 0:00:51
Average standard deviation of split frequencies: 0.023293
190500 -- (-771.411) (-772.161) (-771.164) [-771.602] * (-777.545) [-773.775] (-771.044) (-771.618) -- 0:00:50
191000 -- [-774.471] (-771.992) (-770.925) (-773.244) * (-779.029) [-771.432] (-772.662) (-774.309) -- 0:00:50
191500 -- [-773.019] (-773.672) (-770.548) (-770.922) * (-771.652) (-773.099) [-775.292] (-775.330) -- 0:00:50
192000 -- (-775.689) (-770.912) (-770.550) [-770.496] * (-770.110) (-770.192) (-772.034) [-775.295] -- 0:00:50
192500 -- (-775.429) [-773.343] (-770.864) (-771.286) * [-770.752] (-770.733) (-771.592) (-773.246) -- 0:00:50
193000 -- (-772.092) (-774.259) [-771.902] (-771.738) * (-772.512) (-771.203) [-771.792] (-772.403) -- 0:00:50
193500 -- [-770.345] (-770.642) (-775.357) (-773.061) * [-771.088] (-773.955) (-773.667) (-773.974) -- 0:00:50
194000 -- (-772.384) [-773.175] (-772.018) (-770.815) * (-773.672) (-773.713) [-771.418] (-774.438) -- 0:00:49
194500 -- (-775.461) (-775.893) (-770.101) [-770.763] * (-772.356) (-772.217) [-770.250] (-779.947) -- 0:00:49
195000 -- (-770.425) [-773.065] (-771.553) (-771.980) * (-772.115) (-771.893) [-770.257] (-773.223) -- 0:00:49
Average standard deviation of split frequencies: 0.021188
195500 -- (-770.497) (-769.866) (-771.379) [-771.996] * (-775.093) (-770.882) [-771.116] (-771.299) -- 0:00:49
196000 -- (-769.864) (-769.756) (-771.956) [-772.717] * (-771.620) [-772.687] (-773.838) (-775.341) -- 0:00:49
196500 -- [-771.639] (-770.756) (-771.157) (-770.778) * (-774.809) (-773.642) [-771.371] (-772.352) -- 0:00:49
197000 -- [-770.408] (-772.673) (-771.729) (-777.613) * (-778.651) (-778.038) [-773.360] (-770.816) -- 0:00:48
197500 -- (-770.510) [-772.534] (-772.304) (-774.502) * (-776.483) (-774.874) [-770.036] (-769.991) -- 0:00:48
198000 -- (-770.261) [-772.293] (-773.729) (-772.262) * (-775.810) (-775.669) (-771.477) [-771.121] -- 0:00:48
198500 -- (-772.716) (-773.047) (-770.569) [-775.504] * (-770.612) (-774.637) (-772.374) [-771.205] -- 0:00:48
199000 -- (-773.588) (-770.301) [-772.558] (-772.509) * (-774.511) (-770.535) (-772.175) [-770.737] -- 0:00:52
199500 -- [-772.623] (-770.576) (-771.837) (-770.950) * (-772.791) (-771.253) (-771.614) [-770.284] -- 0:00:52
200000 -- (-773.611) (-772.230) (-772.873) [-775.312] * (-771.261) (-772.521) (-770.555) [-770.527] -- 0:00:51
Average standard deviation of split frequencies: 0.022256
200500 -- (-771.834) [-772.470] (-771.692) (-774.217) * [-772.018] (-770.397) (-777.376) (-770.642) -- 0:00:51
201000 -- (-772.242) (-775.804) (-771.746) [-771.859] * [-772.129] (-769.759) (-774.122) (-772.997) -- 0:00:51
201500 -- (-772.529) [-771.781] (-772.569) (-772.605) * [-773.315] (-770.759) (-775.487) (-774.308) -- 0:00:51
202000 -- (-773.976) (-772.082) [-771.180] (-771.549) * (-771.598) [-771.645] (-771.114) (-775.153) -- 0:00:51
202500 -- [-770.602] (-771.773) (-770.729) (-774.721) * (-772.853) (-771.501) [-771.421] (-770.452) -- 0:00:51
203000 -- [-772.473] (-775.014) (-771.855) (-775.230) * (-774.966) (-772.439) [-771.156] (-770.743) -- 0:00:51
203500 -- (-770.617) (-773.586) [-772.215] (-773.292) * (-772.166) (-771.129) [-771.982] (-769.984) -- 0:00:50
204000 -- (-769.932) [-776.674] (-771.600) (-771.008) * [-772.329] (-772.292) (-775.089) (-772.428) -- 0:00:50
204500 -- (-772.348) (-770.755) (-772.290) [-775.675] * (-774.379) (-772.461) (-771.475) [-771.996] -- 0:00:50
205000 -- [-770.049] (-777.558) (-770.873) (-775.140) * [-771.337] (-770.654) (-772.883) (-771.722) -- 0:00:50
Average standard deviation of split frequencies: 0.021358
205500 -- (-770.022) (-771.180) (-772.337) [-774.837] * [-770.413] (-771.694) (-773.239) (-772.221) -- 0:00:50
206000 -- (-770.431) [-771.089] (-778.222) (-772.649) * [-773.269] (-773.602) (-774.544) (-770.737) -- 0:00:50
206500 -- (-769.669) (-771.566) (-775.542) [-771.847] * (-770.691) [-770.659] (-771.680) (-770.922) -- 0:00:49
207000 -- (-771.004) [-770.958] (-774.192) (-774.188) * [-770.279] (-773.650) (-770.730) (-773.237) -- 0:00:49
207500 -- (-771.027) [-772.232] (-773.287) (-770.525) * (-771.425) (-777.279) [-770.922] (-771.438) -- 0:00:49
208000 -- (-771.361) (-771.196) [-771.971] (-773.543) * [-772.611] (-772.966) (-770.295) (-775.524) -- 0:00:49
208500 -- (-769.886) (-771.255) [-771.164] (-770.945) * [-772.703] (-770.015) (-770.847) (-775.147) -- 0:00:49
209000 -- [-771.245] (-771.745) (-770.656) (-772.821) * (-775.011) (-770.973) [-771.469] (-770.891) -- 0:00:49
209500 -- [-772.364] (-771.358) (-775.512) (-771.665) * [-772.819] (-770.483) (-771.973) (-770.201) -- 0:00:49
210000 -- [-770.693] (-774.417) (-774.628) (-772.921) * [-774.329] (-771.213) (-772.612) (-770.286) -- 0:00:48
Average standard deviation of split frequencies: 0.023201
210500 -- (-771.464) [-776.442] (-771.896) (-773.978) * (-775.808) [-773.310] (-773.935) (-774.629) -- 0:00:48
211000 -- (-770.441) (-771.060) [-775.254] (-772.907) * (-771.725) (-771.391) (-773.688) [-774.537] -- 0:00:48
211500 -- (-773.824) [-772.027] (-781.915) (-773.764) * (-770.367) [-770.310] (-771.627) (-771.767) -- 0:00:48
212000 -- (-773.993) (-771.257) [-776.210] (-770.423) * (-771.204) [-770.648] (-775.882) (-770.531) -- 0:00:48
212500 -- (-772.376) (-770.962) [-771.420] (-770.297) * (-771.721) [-770.180] (-773.570) (-770.965) -- 0:00:48
213000 -- [-773.093] (-770.792) (-769.781) (-770.396) * (-769.795) (-770.247) (-775.130) [-773.225] -- 0:00:48
213500 -- (-771.540) (-779.191) [-772.581] (-776.681) * [-773.553] (-770.631) (-774.668) (-773.263) -- 0:00:47
214000 -- (-773.200) (-773.937) [-770.913] (-772.079) * (-771.622) (-771.401) [-776.664] (-773.792) -- 0:00:47
214500 -- (-772.423) [-774.178] (-772.664) (-774.883) * (-772.389) [-770.191] (-774.958) (-773.712) -- 0:00:47
215000 -- (-772.587) [-773.855] (-771.612) (-771.571) * [-771.278] (-777.676) (-770.368) (-772.379) -- 0:00:47
Average standard deviation of split frequencies: 0.021279
215500 -- (-773.689) (-770.309) [-771.763] (-775.846) * (-770.440) (-771.572) [-775.148] (-774.359) -- 0:00:50
216000 -- (-773.814) [-771.019] (-772.932) (-772.562) * (-771.169) (-772.634) [-773.303] (-774.672) -- 0:00:50
216500 -- (-772.410) (-773.812) [-770.190] (-771.255) * (-773.430) (-771.600) (-770.435) [-771.233] -- 0:00:50
217000 -- [-771.049] (-774.119) (-771.098) (-774.375) * (-770.889) [-770.387] (-772.286) (-773.807) -- 0:00:50
217500 -- [-770.504] (-774.489) (-772.884) (-773.706) * (-770.658) (-771.117) (-772.370) [-772.949] -- 0:00:50
218000 -- (-771.742) [-774.213] (-773.064) (-772.574) * (-771.877) (-772.008) (-770.810) [-771.184] -- 0:00:50
218500 -- (-773.089) (-770.910) (-772.523) [-771.884] * (-771.267) (-770.754) (-771.748) [-771.329] -- 0:00:50
219000 -- [-770.201] (-775.245) (-771.799) (-771.777) * (-771.666) (-774.093) (-770.681) [-770.378] -- 0:00:49
219500 -- (-774.621) [-777.510] (-773.668) (-772.975) * (-776.382) [-771.222] (-771.777) (-772.194) -- 0:00:49
220000 -- (-773.011) (-772.057) [-774.018] (-770.343) * [-771.758] (-772.555) (-771.219) (-770.799) -- 0:00:49
Average standard deviation of split frequencies: 0.022368
220500 -- (-773.452) (-772.453) (-771.916) [-773.950] * (-771.970) (-770.230) [-770.065] (-774.288) -- 0:00:49
221000 -- (-772.290) (-775.129) [-772.942] (-775.721) * (-771.381) (-773.571) (-772.616) [-774.768] -- 0:00:49
221500 -- (-774.176) (-770.563) (-771.332) [-771.534] * (-771.450) (-771.501) [-771.303] (-773.411) -- 0:00:49
222000 -- (-776.146) (-771.123) [-771.166] (-775.978) * (-777.054) (-773.920) (-771.347) [-775.094] -- 0:00:49
222500 -- (-771.610) (-770.308) [-770.641] (-775.638) * [-775.381] (-775.288) (-771.149) (-772.225) -- 0:00:48
223000 -- (-770.346) (-771.571) (-770.726) [-774.557] * (-781.724) (-772.195) (-773.193) [-772.390] -- 0:00:48
223500 -- (-771.117) [-771.474] (-772.354) (-770.702) * (-780.265) (-772.191) (-774.510) [-771.926] -- 0:00:48
224000 -- (-769.965) (-772.936) [-772.390] (-775.207) * (-775.779) (-771.944) [-771.932] (-770.559) -- 0:00:48
224500 -- [-772.206] (-771.507) (-772.831) (-771.497) * [-771.077] (-770.880) (-772.248) (-770.460) -- 0:00:48
225000 -- (-771.638) (-773.517) [-771.290] (-771.275) * (-772.576) [-769.700] (-771.263) (-770.030) -- 0:00:48
Average standard deviation of split frequencies: 0.020163
225500 -- [-769.782] (-772.479) (-774.005) (-771.588) * (-770.313) (-773.293) [-771.667] (-771.132) -- 0:00:48
226000 -- (-769.714) (-771.608) (-770.078) [-773.858] * [-772.780] (-777.795) (-777.718) (-772.983) -- 0:00:47
226500 -- (-771.294) (-772.690) [-772.169] (-771.358) * (-773.330) [-772.221] (-770.374) (-773.216) -- 0:00:47
227000 -- (-771.787) (-771.170) (-774.758) [-771.267] * (-771.354) [-775.350] (-773.448) (-772.721) -- 0:00:47
227500 -- (-771.388) [-772.321] (-772.151) (-770.054) * (-771.076) (-778.805) (-770.557) [-771.172] -- 0:00:47
228000 -- (-773.533) [-770.992] (-771.231) (-771.646) * (-771.809) [-772.285] (-770.591) (-773.846) -- 0:00:47
228500 -- (-771.366) (-770.943) [-771.985] (-771.821) * (-772.070) (-774.183) (-772.420) [-771.035] -- 0:00:47
229000 -- (-771.520) (-770.597) [-772.748] (-772.967) * (-774.013) [-772.184] (-771.801) (-770.042) -- 0:00:47
229500 -- (-769.903) (-772.208) [-770.927] (-774.268) * (-771.526) (-774.493) [-773.112] (-771.313) -- 0:00:47
230000 -- (-772.393) (-770.437) [-772.752] (-776.059) * (-770.042) [-770.343] (-773.745) (-769.880) -- 0:00:50
Average standard deviation of split frequencies: 0.019982
230500 -- [-772.363] (-773.244) (-772.632) (-772.986) * (-773.000) (-772.384) [-772.054] (-770.154) -- 0:00:50
231000 -- [-772.232] (-771.232) (-772.511) (-770.352) * [-771.483] (-776.930) (-774.403) (-773.478) -- 0:00:49
231500 -- (-771.085) (-772.595) (-772.127) [-771.807] * (-770.885) (-774.751) (-776.951) [-771.823] -- 0:00:49
232000 -- (-772.695) (-771.178) (-774.991) [-771.253] * (-772.294) (-776.246) (-773.215) [-770.411] -- 0:00:49
232500 -- [-771.860] (-777.438) (-771.783) (-771.908) * (-774.621) [-770.856] (-775.608) (-771.819) -- 0:00:49
233000 -- [-771.086] (-771.421) (-772.130) (-772.453) * (-773.369) (-771.288) [-771.175] (-771.910) -- 0:00:49
233500 -- [-771.561] (-769.875) (-779.930) (-772.343) * (-772.633) (-770.775) [-771.584] (-772.317) -- 0:00:49
234000 -- [-775.660] (-771.282) (-774.776) (-769.992) * (-771.773) (-771.927) [-770.071] (-774.251) -- 0:00:49
234500 -- (-773.662) (-771.880) [-770.659] (-771.696) * (-775.135) [-773.760] (-770.120) (-774.416) -- 0:00:48
235000 -- [-772.440] (-776.448) (-773.835) (-772.550) * [-770.952] (-771.004) (-773.435) (-771.037) -- 0:00:48
Average standard deviation of split frequencies: 0.020308
235500 -- (-771.470) [-773.729] (-773.279) (-771.127) * (-772.803) (-773.918) [-770.841] (-770.871) -- 0:00:48
236000 -- (-770.702) (-772.721) (-773.254) [-770.577] * (-772.217) [-774.468] (-770.776) (-772.135) -- 0:00:48
236500 -- (-774.969) (-774.398) [-771.283] (-772.407) * (-771.600) (-772.247) [-771.558] (-772.582) -- 0:00:48
237000 -- [-771.313] (-770.948) (-772.327) (-777.794) * (-770.826) [-772.958] (-773.277) (-774.041) -- 0:00:48
237500 -- (-771.095) [-770.619] (-771.394) (-774.675) * (-774.525) [-772.704] (-777.475) (-772.786) -- 0:00:48
238000 -- (-775.536) (-771.255) [-772.497] (-773.907) * [-772.988] (-777.385) (-772.836) (-773.237) -- 0:00:48
238500 -- (-771.088) (-771.382) [-770.430] (-774.443) * (-774.386) (-775.302) [-771.533] (-773.209) -- 0:00:47
239000 -- (-769.957) (-771.555) [-771.575] (-775.065) * (-770.265) (-776.413) (-774.121) [-771.775] -- 0:00:47
239500 -- (-773.570) [-770.734] (-774.685) (-776.520) * [-772.306] (-771.193) (-774.160) (-773.328) -- 0:00:47
240000 -- (-772.639) (-770.631) [-772.833] (-774.379) * (-769.651) (-770.603) (-773.664) [-771.290] -- 0:00:47
Average standard deviation of split frequencies: 0.018499
240500 -- (-771.618) (-771.847) [-771.297] (-772.382) * (-775.363) [-773.143] (-774.834) (-770.814) -- 0:00:47
241000 -- (-773.885) [-771.270] (-773.468) (-775.156) * (-772.750) (-772.501) (-770.825) [-773.704] -- 0:00:47
241500 -- (-770.788) (-770.512) (-770.201) [-771.199] * (-769.631) (-773.597) (-771.423) [-771.535] -- 0:00:47
242000 -- [-773.013] (-772.451) (-771.575) (-773.518) * (-771.713) (-776.487) [-773.821] (-775.597) -- 0:00:46
242500 -- (-776.192) [-771.655] (-780.484) (-772.224) * (-770.011) [-771.247] (-772.687) (-774.664) -- 0:00:46
243000 -- (-778.118) (-770.862) [-774.241] (-774.291) * (-769.917) (-773.239) [-774.267] (-775.394) -- 0:00:46
243500 -- (-774.915) (-770.574) [-772.659] (-770.782) * (-771.754) (-771.154) [-771.572] (-773.155) -- 0:00:46
244000 -- [-772.845] (-770.670) (-771.386) (-770.466) * (-770.407) (-773.003) (-774.721) [-770.462] -- 0:00:46
244500 -- (-777.386) (-771.400) [-772.254] (-771.161) * [-772.439] (-772.059) (-772.377) (-771.058) -- 0:00:46
245000 -- [-771.238] (-770.789) (-771.852) (-772.051) * (-770.919) (-774.724) (-773.081) [-771.427] -- 0:00:46
Average standard deviation of split frequencies: 0.019163
245500 -- [-772.775] (-770.022) (-771.950) (-772.998) * [-772.117] (-770.454) (-777.001) (-771.834) -- 0:00:46
246000 -- (-773.486) (-770.229) [-772.851] (-771.947) * (-778.131) [-772.737] (-770.467) (-772.740) -- 0:00:49
246500 -- (-770.767) (-771.178) [-776.273] (-771.028) * (-772.658) [-770.981] (-770.732) (-771.304) -- 0:00:48
247000 -- (-772.483) (-771.946) [-771.306] (-770.913) * (-772.484) (-770.667) [-770.136] (-771.038) -- 0:00:48
247500 -- (-772.068) [-770.983] (-772.361) (-771.595) * (-770.833) (-771.337) [-771.484] (-770.432) -- 0:00:48
248000 -- (-770.880) (-772.766) [-772.738] (-771.003) * (-770.919) [-773.107] (-771.028) (-771.482) -- 0:00:48
248500 -- (-773.901) [-771.383] (-771.750) (-770.592) * (-770.461) (-770.618) [-772.248] (-773.053) -- 0:00:48
249000 -- (-772.333) [-772.523] (-774.429) (-772.149) * (-772.931) [-770.419] (-771.757) (-772.134) -- 0:00:48
249500 -- [-771.357] (-775.694) (-772.574) (-773.576) * (-772.422) (-771.860) [-771.632] (-772.859) -- 0:00:48
250000 -- [-772.490] (-771.513) (-778.471) (-772.177) * (-771.347) [-771.241] (-774.889) (-772.369) -- 0:00:48
Average standard deviation of split frequencies: 0.017239
250500 -- (-773.938) (-770.889) [-770.740] (-771.786) * (-771.956) (-772.411) [-773.705] (-770.669) -- 0:00:47
251000 -- (-773.155) (-770.926) [-772.653] (-770.891) * [-771.472] (-771.261) (-774.210) (-773.160) -- 0:00:47
251500 -- (-774.815) (-772.005) (-772.707) [-772.495] * (-772.593) (-777.044) (-773.366) [-770.489] -- 0:00:47
252000 -- [-772.614] (-770.951) (-771.711) (-770.506) * [-774.724] (-773.442) (-773.733) (-770.671) -- 0:00:47
252500 -- (-774.180) [-770.736] (-772.007) (-771.709) * [-771.075] (-770.502) (-771.625) (-771.413) -- 0:00:47
253000 -- [-772.821] (-773.530) (-774.532) (-772.327) * (-770.745) [-772.175] (-770.109) (-775.490) -- 0:00:47
253500 -- (-773.467) [-772.214] (-778.921) (-773.351) * [-772.603] (-771.575) (-777.130) (-771.651) -- 0:00:47
254000 -- (-771.923) (-770.248) [-775.440] (-770.905) * (-771.078) (-776.788) [-772.700] (-776.096) -- 0:00:46
254500 -- (-772.432) (-770.788) [-775.849] (-771.789) * (-772.812) (-772.116) (-771.240) [-773.158] -- 0:00:46
255000 -- (-771.912) [-770.762] (-772.938) (-771.430) * (-774.656) [-770.981] (-770.778) (-772.654) -- 0:00:46
Average standard deviation of split frequencies: 0.016368
255500 -- (-771.023) [-771.391] (-773.636) (-774.380) * (-772.984) [-771.518] (-773.019) (-776.872) -- 0:00:46
256000 -- (-771.290) (-771.735) (-772.609) [-771.515] * (-773.101) [-772.184] (-774.938) (-770.844) -- 0:00:46
256500 -- (-773.589) (-774.899) [-774.122] (-772.140) * (-772.157) [-772.190] (-781.467) (-775.198) -- 0:00:46
257000 -- (-771.846) (-773.407) (-774.041) [-771.831] * (-771.201) (-774.015) (-774.827) [-770.774] -- 0:00:46
257500 -- [-770.501] (-772.128) (-775.196) (-771.188) * (-770.966) (-772.894) (-773.646) [-773.593] -- 0:00:46
258000 -- [-774.235] (-771.135) (-775.284) (-771.521) * (-773.109) [-769.883] (-772.300) (-776.858) -- 0:00:46
258500 -- (-772.112) (-772.821) (-771.235) [-770.341] * (-770.783) (-771.985) (-773.298) [-770.503] -- 0:00:45
259000 -- (-773.542) (-774.297) [-771.132] (-775.506) * (-776.402) [-772.916] (-774.361) (-780.646) -- 0:00:45
259500 -- (-773.579) (-773.100) [-770.649] (-778.827) * (-772.708) [-772.483] (-773.169) (-773.483) -- 0:00:45
260000 -- (-773.343) [-772.053] (-770.834) (-777.745) * (-774.798) (-770.722) (-774.162) [-771.114] -- 0:00:45
Average standard deviation of split frequencies: 0.016489
260500 -- [-771.665] (-771.018) (-772.806) (-773.352) * [-772.506] (-772.115) (-769.850) (-773.657) -- 0:00:45
261000 -- (-771.320) (-774.257) [-772.553] (-777.105) * (-772.019) [-774.013] (-771.066) (-774.755) -- 0:00:45
261500 -- (-770.937) (-771.853) [-770.239] (-770.423) * (-770.584) (-773.007) (-772.457) [-773.244] -- 0:00:45
262000 -- (-771.630) (-772.656) (-771.941) [-769.745] * (-772.001) (-771.485) (-771.316) [-770.966] -- 0:00:45
262500 -- (-771.295) (-773.764) (-774.692) [-773.919] * (-773.814) (-774.167) (-774.072) [-769.772] -- 0:00:47
263000 -- (-771.944) (-770.144) (-771.430) [-774.729] * (-773.905) [-774.867] (-771.330) (-772.830) -- 0:00:47
263500 -- (-770.901) (-772.680) [-770.656] (-770.927) * (-772.279) [-770.810] (-770.724) (-772.778) -- 0:00:47
264000 -- (-770.724) (-771.519) [-770.615] (-771.769) * (-771.435) (-773.094) (-774.190) [-774.278] -- 0:00:47
264500 -- (-770.347) (-773.912) [-770.018] (-774.473) * (-770.257) (-771.435) [-771.565] (-772.038) -- 0:00:47
265000 -- (-772.511) (-775.079) (-776.456) [-772.146] * (-770.303) [-771.623] (-771.327) (-775.593) -- 0:00:47
Average standard deviation of split frequencies: 0.015753
265500 -- (-771.940) (-776.103) (-770.666) [-772.040] * (-769.577) (-772.551) [-775.229] (-771.258) -- 0:00:47
266000 -- (-774.283) (-770.796) (-772.891) [-772.921] * (-770.288) (-773.032) (-774.100) [-771.955] -- 0:00:46
266500 -- (-771.326) [-772.448] (-770.243) (-774.523) * [-772.772] (-771.769) (-773.036) (-774.874) -- 0:00:46
267000 -- (-771.466) (-770.309) (-779.765) [-770.958] * (-771.961) (-770.931) (-775.297) [-771.782] -- 0:00:46
267500 -- [-770.981] (-775.062) (-772.315) (-771.784) * (-775.860) [-771.939] (-774.930) (-777.238) -- 0:00:46
268000 -- (-770.672) [-773.100] (-770.202) (-771.963) * (-772.177) [-772.066] (-771.983) (-772.090) -- 0:00:46
268500 -- (-770.652) [-773.837] (-773.257) (-772.083) * (-771.550) (-771.513) [-771.022] (-774.204) -- 0:00:46
269000 -- [-773.703] (-773.877) (-771.813) (-770.687) * (-773.954) (-771.102) [-771.616] (-778.183) -- 0:00:46
269500 -- (-772.624) (-771.967) (-772.255) [-772.547] * (-772.424) [-770.522] (-772.701) (-771.131) -- 0:00:46
270000 -- [-770.691] (-773.976) (-775.204) (-773.980) * (-774.897) (-770.530) (-773.044) [-770.201] -- 0:00:45
Average standard deviation of split frequencies: 0.016392
270500 -- [-770.497] (-772.889) (-772.169) (-773.531) * (-770.886) (-772.177) (-771.987) [-770.185] -- 0:00:45
271000 -- (-770.196) [-773.341] (-771.039) (-770.377) * (-769.953) (-772.800) (-770.833) [-775.104] -- 0:00:45
271500 -- [-775.359] (-771.464) (-769.713) (-770.519) * [-771.598] (-773.571) (-774.467) (-772.506) -- 0:00:45
272000 -- (-773.554) (-769.986) [-770.009] (-771.641) * (-772.186) (-771.855) [-772.490] (-770.924) -- 0:00:45
272500 -- (-770.908) (-771.308) [-770.197] (-773.279) * (-772.643) (-770.997) (-772.020) [-771.739] -- 0:00:45
273000 -- (-772.043) [-770.509] (-770.475) (-774.510) * (-772.450) (-771.186) [-772.756] (-770.477) -- 0:00:45
273500 -- (-771.763) [-770.904] (-770.170) (-775.842) * (-774.227) [-770.635] (-773.258) (-770.273) -- 0:00:45
274000 -- [-772.546] (-770.613) (-770.176) (-772.706) * (-771.844) [-770.288] (-769.817) (-770.181) -- 0:00:45
274500 -- [-772.879] (-770.896) (-770.183) (-771.075) * (-771.765) (-771.540) (-771.231) [-771.962] -- 0:00:44
275000 -- (-778.668) (-771.495) [-769.637] (-771.170) * (-771.761) [-772.078] (-770.413) (-775.404) -- 0:00:44
Average standard deviation of split frequencies: 0.015372
275500 -- (-771.461) (-771.284) (-770.812) [-771.008] * (-772.187) (-774.791) (-770.725) [-771.878] -- 0:00:44
276000 -- (-771.362) (-773.393) [-770.457] (-771.911) * (-772.543) [-771.799] (-771.238) (-772.322) -- 0:00:44
276500 -- (-775.050) (-770.689) (-771.361) [-770.736] * (-772.232) [-771.526] (-770.214) (-776.448) -- 0:00:44
277000 -- (-779.866) [-771.028] (-775.582) (-770.001) * (-771.314) [-773.452] (-771.921) (-771.002) -- 0:00:44
277500 -- [-772.489] (-772.169) (-772.168) (-771.289) * [-771.586] (-771.759) (-770.043) (-774.378) -- 0:00:44
278000 -- [-772.596] (-772.715) (-772.094) (-771.674) * (-771.118) (-773.491) [-770.162] (-776.537) -- 0:00:44
278500 -- [-771.938] (-770.289) (-770.990) (-773.328) * (-772.036) (-771.544) (-770.825) [-773.102] -- 0:00:44
279000 -- (-779.369) (-770.905) (-771.538) [-772.977] * (-770.187) (-774.419) [-770.151] (-770.392) -- 0:00:46
279500 -- (-776.239) (-769.880) [-771.522] (-770.378) * (-769.821) [-773.173] (-770.007) (-772.288) -- 0:00:46
280000 -- (-772.789) [-776.628] (-771.784) (-771.395) * [-770.218] (-770.195) (-770.835) (-773.983) -- 0:00:46
Average standard deviation of split frequencies: 0.013140
280500 -- [-771.027] (-774.093) (-773.658) (-771.615) * [-771.186] (-771.501) (-770.340) (-772.028) -- 0:00:46
281000 -- (-774.575) (-770.037) [-772.336] (-773.423) * (-769.836) (-771.724) (-773.698) [-772.132] -- 0:00:46
281500 -- (-773.311) (-774.769) [-771.476] (-772.082) * (-773.564) [-770.530] (-771.317) (-770.439) -- 0:00:45
282000 -- (-771.557) (-775.736) (-773.353) [-772.878] * (-770.190) (-774.456) [-770.647] (-772.396) -- 0:00:45
282500 -- (-772.436) (-770.598) (-775.126) [-769.864] * (-771.953) (-775.966) [-770.710] (-772.598) -- 0:00:45
283000 -- (-771.230) [-770.372] (-771.243) (-772.662) * (-771.244) (-772.188) (-771.156) [-771.376] -- 0:00:45
283500 -- (-771.942) [-769.866] (-770.881) (-772.040) * (-772.953) (-769.989) (-772.044) [-771.395] -- 0:00:45
284000 -- (-770.699) [-769.835] (-771.857) (-772.833) * (-770.432) (-770.620) [-771.762] (-771.756) -- 0:00:45
284500 -- [-770.100] (-771.814) (-771.989) (-771.635) * (-771.229) [-772.212] (-772.522) (-772.822) -- 0:00:45
285000 -- (-772.118) [-772.544] (-772.615) (-771.437) * [-770.009] (-772.085) (-772.072) (-771.640) -- 0:00:45
Average standard deviation of split frequencies: 0.014059
285500 -- (-774.228) (-771.726) [-776.245] (-772.136) * (-771.532) (-772.317) (-771.779) [-771.774] -- 0:00:45
286000 -- (-777.454) [-770.826] (-771.862) (-769.942) * (-773.163) (-775.690) [-771.140] (-770.065) -- 0:00:44
286500 -- (-773.580) (-770.864) (-771.677) [-773.597] * (-777.518) (-772.517) (-773.627) [-771.243] -- 0:00:44
287000 -- (-770.621) (-772.731) (-770.341) [-775.266] * (-778.977) (-770.445) [-770.242] (-772.727) -- 0:00:44
287500 -- (-772.589) [-772.790] (-769.863) (-775.335) * (-771.951) (-770.295) [-771.825] (-771.126) -- 0:00:44
288000 -- (-771.002) (-772.354) (-772.191) [-771.171] * (-776.965) (-771.563) (-771.601) [-771.080] -- 0:00:44
288500 -- (-771.574) (-772.755) [-771.411] (-772.745) * (-772.152) (-772.639) [-774.348] (-773.439) -- 0:00:44
289000 -- (-771.429) (-771.243) [-770.770] (-773.702) * (-774.696) (-772.815) (-777.361) [-770.600] -- 0:00:44
289500 -- [-773.448] (-776.294) (-774.948) (-772.975) * (-771.894) (-770.948) (-773.052) [-770.593] -- 0:00:44
290000 -- (-770.229) [-770.870] (-770.652) (-770.174) * (-778.025) [-771.006] (-771.419) (-774.897) -- 0:00:44
Average standard deviation of split frequencies: 0.012784
290500 -- (-774.156) (-771.294) (-775.003) [-770.950] * (-777.560) [-772.128] (-771.146) (-773.683) -- 0:00:43
291000 -- [-770.358] (-772.948) (-773.861) (-771.468) * (-772.682) [-770.922] (-770.241) (-775.335) -- 0:00:43
291500 -- (-773.815) [-774.230] (-772.355) (-772.964) * (-772.651) [-771.383] (-770.359) (-773.040) -- 0:00:43
292000 -- (-771.667) (-774.839) [-775.130] (-770.363) * (-773.282) (-770.668) (-772.036) [-770.564] -- 0:00:43
292500 -- (-776.661) (-771.426) (-773.498) [-772.108] * (-772.432) (-771.065) [-771.684] (-772.577) -- 0:00:43
293000 -- (-772.057) [-772.735] (-772.310) (-771.307) * (-770.677) (-772.164) [-772.036] (-772.667) -- 0:00:43
293500 -- [-771.358] (-770.506) (-772.361) (-771.534) * (-770.440) (-770.096) [-770.493] (-772.507) -- 0:00:43
294000 -- (-772.940) [-770.645] (-773.293) (-771.531) * [-770.753] (-773.143) (-773.725) (-770.222) -- 0:00:43
294500 -- (-772.792) [-772.091] (-770.759) (-771.830) * (-771.075) (-774.750) [-773.024] (-770.393) -- 0:00:43
295000 -- (-774.595) (-770.953) (-773.815) [-771.261] * [-770.983] (-773.804) (-771.904) (-772.213) -- 0:00:43
Average standard deviation of split frequencies: 0.013022
295500 -- [-771.105] (-772.570) (-772.027) (-773.742) * (-771.070) (-771.096) [-771.552] (-772.061) -- 0:00:45
296000 -- (-770.194) [-771.617] (-771.243) (-778.578) * (-772.196) (-770.898) (-773.976) [-769.828] -- 0:00:45
296500 -- (-770.311) [-777.914] (-770.917) (-774.005) * (-775.094) (-770.360) (-770.725) [-770.375] -- 0:00:45
297000 -- (-771.011) [-772.033] (-771.545) (-773.053) * (-773.521) [-772.760] (-771.519) (-772.547) -- 0:00:44
297500 -- [-771.442] (-771.018) (-771.203) (-770.648) * [-774.056] (-772.478) (-772.606) (-772.112) -- 0:00:44
298000 -- (-770.405) (-771.307) [-771.366] (-770.899) * (-770.444) (-772.368) [-773.078] (-772.437) -- 0:00:44
298500 -- (-771.821) (-773.023) (-774.441) [-770.450] * [-770.270] (-776.281) (-774.221) (-772.415) -- 0:00:44
299000 -- (-772.712) (-771.062) [-770.914] (-771.585) * [-776.801] (-775.335) (-774.166) (-777.566) -- 0:00:44
299500 -- (-776.973) (-770.179) (-771.274) [-770.047] * [-771.768] (-771.513) (-771.088) (-773.080) -- 0:00:44
300000 -- (-771.427) [-771.069] (-770.882) (-770.864) * (-775.391) (-770.926) [-771.933] (-773.394) -- 0:00:44
Average standard deviation of split frequencies: 0.012635
300500 -- (-773.939) [-769.815] (-773.133) (-770.689) * (-775.968) (-771.203) [-770.606] (-781.153) -- 0:00:44
301000 -- [-772.622] (-770.983) (-771.171) (-769.968) * (-776.263) (-771.141) (-770.843) [-776.126] -- 0:00:44
301500 -- [-772.997] (-774.348) (-776.066) (-770.514) * (-773.461) (-774.469) (-775.063) [-775.096] -- 0:00:44
302000 -- [-772.173] (-771.540) (-772.644) (-770.676) * (-773.202) (-776.196) [-771.667] (-773.308) -- 0:00:43
302500 -- (-772.509) (-772.148) [-771.016] (-770.466) * (-775.930) (-775.840) [-770.912] (-772.313) -- 0:00:43
303000 -- (-772.575) (-772.851) (-771.788) [-771.667] * (-771.441) (-772.451) [-770.166] (-771.113) -- 0:00:43
303500 -- (-771.034) [-772.737] (-771.952) (-771.474) * (-770.757) (-773.894) (-770.618) [-770.763] -- 0:00:43
304000 -- (-771.360) (-770.969) [-774.000] (-771.215) * (-777.567) (-770.808) (-771.066) [-771.240] -- 0:00:43
304500 -- (-771.106) (-772.470) [-771.551] (-774.928) * (-769.834) [-772.319] (-773.640) (-770.580) -- 0:00:43
305000 -- (-772.307) [-770.428] (-774.455) (-772.872) * (-769.882) (-770.559) (-770.476) [-771.673] -- 0:00:43
Average standard deviation of split frequencies: 0.012415
305500 -- (-770.605) (-771.391) (-775.657) [-771.123] * (-769.557) (-771.377) (-774.749) [-770.740] -- 0:00:43
306000 -- [-771.147] (-770.281) (-773.378) (-771.044) * (-770.634) (-771.924) [-773.109] (-770.254) -- 0:00:43
306500 -- [-772.088] (-772.027) (-772.451) (-773.206) * (-773.203) (-770.608) (-772.601) [-772.423] -- 0:00:42
307000 -- [-772.082] (-775.300) (-773.745) (-771.541) * (-771.341) (-772.470) (-770.087) [-771.307] -- 0:00:42
307500 -- [-770.285] (-772.725) (-773.016) (-775.200) * (-770.625) (-771.151) (-770.571) [-771.205] -- 0:00:42
308000 -- [-770.398] (-773.086) (-778.119) (-772.302) * (-774.243) (-775.842) (-770.640) [-770.059] -- 0:00:42
308500 -- (-770.671) (-774.985) (-770.927) [-772.059] * [-771.687] (-774.762) (-773.565) (-773.621) -- 0:00:42
309000 -- (-770.348) (-772.230) [-771.558] (-770.841) * [-772.912] (-771.559) (-775.032) (-778.306) -- 0:00:42
309500 -- (-771.069) [-772.718] (-777.345) (-770.994) * (-774.841) [-771.046] (-773.488) (-773.658) -- 0:00:42
310000 -- [-772.809] (-773.719) (-775.383) (-771.156) * [-771.117] (-770.666) (-771.127) (-772.311) -- 0:00:42
Average standard deviation of split frequencies: 0.012585
310500 -- (-773.769) [-772.376] (-775.330) (-775.036) * (-771.171) (-771.573) [-771.665] (-770.792) -- 0:00:42
311000 -- (-772.529) [-770.621] (-777.511) (-773.425) * [-771.439] (-771.982) (-773.561) (-769.909) -- 0:00:44
311500 -- (-773.300) (-772.068) (-774.445) [-773.523] * (-772.207) (-777.703) (-770.244) [-769.647] -- 0:00:44
312000 -- (-773.797) (-770.521) [-778.635] (-771.352) * (-771.713) (-773.073) [-770.422] (-770.998) -- 0:00:44
312500 -- (-773.500) (-773.806) [-773.007] (-771.855) * [-774.977] (-774.579) (-771.808) (-773.819) -- 0:00:44
313000 -- (-772.830) (-772.039) [-771.822] (-772.499) * (-772.071) (-774.914) [-772.448] (-771.084) -- 0:00:43
313500 -- (-773.545) (-773.846) [-771.577] (-771.811) * [-771.654] (-772.649) (-769.983) (-774.742) -- 0:00:43
314000 -- (-774.518) [-770.582] (-770.546) (-774.787) * (-773.956) (-771.184) (-771.780) [-772.617] -- 0:00:43
314500 -- (-774.781) [-771.569] (-772.205) (-772.493) * (-770.988) [-772.655] (-772.794) (-773.289) -- 0:00:43
315000 -- [-770.488] (-772.447) (-774.488) (-771.252) * [-770.350] (-771.274) (-772.352) (-772.567) -- 0:00:43
Average standard deviation of split frequencies: 0.013163
315500 -- (-776.945) (-772.875) [-773.739] (-771.141) * (-771.168) [-771.062] (-773.538) (-770.153) -- 0:00:43
316000 -- (-775.449) (-771.539) [-777.134] (-772.046) * (-770.562) (-770.562) [-771.743] (-775.797) -- 0:00:43
316500 -- (-772.827) [-772.018] (-773.631) (-772.801) * (-770.266) [-772.611] (-773.062) (-774.116) -- 0:00:43
317000 -- (-770.594) [-771.670] (-773.821) (-773.970) * [-773.596] (-771.318) (-774.005) (-773.230) -- 0:00:43
317500 -- (-775.539) (-769.673) [-770.793] (-770.933) * (-771.064) [-770.688] (-770.115) (-773.187) -- 0:00:42
318000 -- (-772.614) [-771.525] (-771.660) (-773.839) * (-772.825) (-770.628) (-772.681) [-772.612] -- 0:00:42
318500 -- (-772.269) (-773.347) (-770.507) [-770.902] * [-770.897] (-771.379) (-772.307) (-771.748) -- 0:00:42
319000 -- (-772.400) (-773.911) [-772.422] (-772.579) * [-771.075] (-773.616) (-773.586) (-772.856) -- 0:00:42
319500 -- (-772.586) (-773.940) [-771.581] (-773.910) * (-774.805) (-771.912) [-773.845] (-773.556) -- 0:00:42
320000 -- (-772.854) [-771.218] (-770.868) (-772.830) * (-774.571) (-770.999) (-769.830) [-771.317] -- 0:00:42
Average standard deviation of split frequencies: 0.011934
320500 -- (-774.541) (-774.192) (-772.741) [-772.365] * (-771.528) (-773.927) (-770.483) [-772.716] -- 0:00:42
321000 -- (-772.467) (-775.650) [-772.586] (-773.216) * [-771.350] (-775.151) (-771.489) (-772.322) -- 0:00:42
321500 -- [-772.188] (-776.400) (-772.867) (-773.244) * (-770.718) [-770.122] (-771.637) (-774.873) -- 0:00:42
322000 -- (-770.571) (-774.176) [-777.481] (-773.107) * (-771.297) (-774.913) (-773.401) [-770.729] -- 0:00:42
322500 -- (-770.769) (-771.240) [-772.688] (-773.821) * (-770.988) (-774.719) (-772.229) [-770.611] -- 0:00:42
323000 -- (-776.760) (-772.201) [-775.424] (-772.808) * (-772.358) (-776.673) (-777.320) [-770.990] -- 0:00:41
323500 -- (-771.422) [-771.464] (-772.635) (-774.053) * (-771.538) (-773.490) [-772.096] (-771.140) -- 0:00:41
324000 -- [-770.372] (-771.824) (-773.294) (-772.788) * (-771.938) [-771.799] (-772.319) (-771.613) -- 0:00:41
324500 -- (-771.369) (-773.657) (-771.742) [-774.985] * (-772.772) [-770.475] (-774.202) (-772.187) -- 0:00:41
325000 -- (-771.657) (-780.801) (-776.415) [-771.139] * (-771.155) (-770.305) (-775.499) [-772.383] -- 0:00:41
Average standard deviation of split frequencies: 0.012674
325500 -- (-772.171) (-771.713) [-772.787] (-773.005) * [-769.990] (-771.010) (-774.228) (-774.356) -- 0:00:41
326000 -- (-770.151) (-771.758) [-772.064] (-772.153) * (-771.037) (-771.336) [-771.738] (-772.755) -- 0:00:41
326500 -- [-772.065] (-775.500) (-777.414) (-771.591) * [-774.252] (-771.652) (-771.552) (-772.949) -- 0:00:41
327000 -- [-771.290] (-770.811) (-775.282) (-770.733) * [-771.130] (-772.405) (-774.225) (-771.251) -- 0:00:43
327500 -- [-770.838] (-770.811) (-770.915) (-772.652) * (-771.511) (-771.439) [-772.153] (-771.067) -- 0:00:43
328000 -- [-773.507] (-770.335) (-771.046) (-771.689) * (-773.280) (-771.386) (-770.391) [-771.748] -- 0:00:43
328500 -- (-772.259) [-773.968] (-771.059) (-771.649) * (-770.637) [-771.881] (-773.298) (-772.843) -- 0:00:42
329000 -- (-771.944) (-774.143) [-770.900] (-775.012) * (-773.069) [-771.798] (-773.663) (-771.498) -- 0:00:42
329500 -- (-771.633) (-769.941) (-772.325) [-771.816] * (-772.757) [-770.921] (-771.180) (-771.225) -- 0:00:42
330000 -- (-772.487) (-770.823) (-773.432) [-772.588] * (-771.962) [-769.903] (-772.738) (-770.665) -- 0:00:42
Average standard deviation of split frequencies: 0.011321
330500 -- (-772.012) (-770.316) [-772.287] (-770.311) * (-771.493) (-775.061) [-769.600] (-772.629) -- 0:00:42
331000 -- (-772.031) (-773.726) (-769.978) [-771.575] * (-771.246) (-775.411) [-770.097] (-771.475) -- 0:00:42
331500 -- [-770.288] (-778.172) (-769.979) (-774.175) * (-770.498) [-775.849] (-770.365) (-771.493) -- 0:00:42
332000 -- (-770.914) (-772.392) (-771.516) [-771.382] * (-772.963) (-771.122) (-771.779) [-772.129] -- 0:00:42
332500 -- (-773.493) [-771.614] (-770.817) (-769.897) * (-770.145) (-774.105) (-773.555) [-773.040] -- 0:00:42
333000 -- (-773.225) (-772.433) [-773.442] (-772.621) * (-773.746) (-770.734) [-775.638] (-776.177) -- 0:00:42
333500 -- (-771.364) (-770.108) [-772.540] (-771.383) * (-773.875) (-772.816) (-776.519) [-773.359] -- 0:00:41
334000 -- (-770.216) (-770.488) (-772.107) [-774.604] * (-772.278) [-772.712] (-772.343) (-771.911) -- 0:00:41
334500 -- [-772.843] (-772.731) (-770.648) (-771.632) * (-774.898) (-770.496) [-772.457] (-770.339) -- 0:00:41
335000 -- (-774.582) (-774.020) (-777.072) [-774.532] * (-772.004) [-771.019] (-769.916) (-773.627) -- 0:00:41
Average standard deviation of split frequencies: 0.010729
335500 -- (-770.156) [-771.254] (-773.852) (-770.833) * (-775.132) [-772.745] (-773.121) (-773.625) -- 0:00:41
336000 -- (-770.302) [-772.811] (-770.683) (-770.433) * (-770.167) (-771.461) [-772.775] (-773.809) -- 0:00:41
336500 -- (-770.280) (-772.607) [-771.726] (-773.088) * (-769.834) (-772.348) [-770.447] (-775.666) -- 0:00:41
337000 -- [-772.290] (-772.162) (-773.241) (-775.712) * (-769.859) [-770.473] (-770.055) (-775.198) -- 0:00:41
337500 -- (-772.031) [-771.866] (-777.816) (-772.330) * [-772.542] (-769.972) (-771.913) (-773.457) -- 0:00:41
338000 -- (-771.716) (-773.718) (-778.129) [-775.872] * [-772.405] (-770.915) (-770.524) (-772.807) -- 0:00:41
338500 -- (-772.949) [-771.758] (-771.189) (-770.367) * (-772.675) (-771.769) [-771.701] (-772.880) -- 0:00:41
339000 -- (-770.564) (-771.662) [-770.641] (-772.597) * (-776.792) [-770.640] (-771.757) (-771.053) -- 0:00:40
339500 -- (-771.521) (-772.069) [-771.172] (-772.211) * (-774.019) [-773.488] (-771.583) (-771.323) -- 0:00:40
340000 -- (-774.669) (-772.663) (-771.815) [-773.717] * (-775.973) (-770.621) [-771.814] (-775.311) -- 0:00:40
Average standard deviation of split frequencies: 0.010093
340500 -- (-775.365) (-770.905) [-770.953] (-770.683) * (-773.365) [-770.621] (-770.887) (-776.055) -- 0:00:40
341000 -- (-770.389) (-771.459) [-773.804] (-774.423) * (-770.310) [-772.249] (-770.072) (-773.544) -- 0:00:40
341500 -- (-770.947) (-770.417) (-774.564) [-772.011] * (-773.049) [-770.969] (-770.558) (-776.305) -- 0:00:40
342000 -- (-771.938) [-773.644] (-781.167) (-773.817) * (-770.466) (-774.020) [-771.764] (-771.995) -- 0:00:40
342500 -- (-770.724) [-775.175] (-776.844) (-773.082) * [-772.043] (-771.839) (-772.547) (-773.754) -- 0:00:40
343000 -- (-771.187) (-770.964) (-771.862) [-770.118] * [-770.001] (-772.143) (-771.880) (-774.888) -- 0:00:40
343500 -- (-778.790) (-774.993) (-770.613) [-772.710] * (-772.142) (-772.297) [-771.874] (-770.811) -- 0:00:40
344000 -- (-773.177) [-772.866] (-773.539) (-771.326) * (-773.002) [-771.616] (-772.287) (-770.642) -- 0:00:41
344500 -- (-773.393) (-773.616) [-772.639] (-774.129) * [-771.125] (-775.183) (-772.082) (-770.416) -- 0:00:41
345000 -- (-770.831) (-772.171) [-770.618] (-771.681) * [-770.717] (-773.927) (-770.339) (-771.297) -- 0:00:41
Average standard deviation of split frequencies: 0.010659
345500 -- [-772.869] (-771.529) (-773.199) (-771.863) * [-770.458] (-773.991) (-773.035) (-772.203) -- 0:00:41
346000 -- (-771.695) [-772.652] (-775.012) (-773.336) * (-770.922) (-770.711) (-772.613) [-772.397] -- 0:00:41
346500 -- (-769.995) (-772.245) (-770.856) [-775.888] * (-771.880) (-774.448) (-771.762) [-773.739] -- 0:00:41
347000 -- (-770.111) (-773.267) (-770.616) [-771.076] * [-770.114] (-771.102) (-770.591) (-771.638) -- 0:00:41
347500 -- (-770.960) (-775.383) [-770.529] (-772.259) * [-770.814] (-773.349) (-771.387) (-770.241) -- 0:00:41
348000 -- [-775.802] (-772.489) (-770.244) (-771.009) * (-770.792) (-773.828) [-772.463] (-771.224) -- 0:00:41
348500 -- (-771.239) (-772.668) (-769.866) [-773.475] * (-770.890) [-776.401] (-771.385) (-771.635) -- 0:00:41
349000 -- (-771.233) [-772.114] (-770.457) (-772.189) * (-773.433) (-775.534) [-773.118] (-771.651) -- 0:00:41
349500 -- [-770.644] (-772.688) (-770.451) (-771.702) * (-771.470) (-773.621) [-774.452] (-777.822) -- 0:00:40
350000 -- (-770.477) [-771.407] (-771.184) (-776.421) * (-771.430) (-774.299) [-774.693] (-779.043) -- 0:00:40
Average standard deviation of split frequencies: 0.010122
350500 -- (-772.774) (-771.605) (-769.735) [-770.753] * (-772.770) [-770.063] (-774.394) (-770.677) -- 0:00:40
351000 -- [-771.955] (-770.425) (-770.465) (-774.706) * (-772.532) (-774.483) (-772.026) [-774.029] -- 0:00:40
351500 -- (-770.510) (-770.421) [-769.741] (-771.257) * (-774.791) (-770.499) (-770.075) [-770.287] -- 0:00:40
352000 -- [-771.866] (-770.901) (-771.033) (-776.562) * (-773.953) [-770.908] (-771.199) (-772.987) -- 0:00:40
352500 -- (-771.326) (-774.226) [-770.626] (-772.962) * (-772.185) [-772.092] (-772.702) (-775.172) -- 0:00:40
353000 -- (-771.043) (-773.693) [-771.765] (-776.007) * [-770.522] (-771.250) (-771.535) (-774.088) -- 0:00:40
353500 -- (-771.767) (-769.896) [-771.125] (-770.802) * (-772.984) [-770.664] (-771.695) (-774.194) -- 0:00:40
354000 -- [-770.837] (-770.687) (-769.714) (-770.639) * (-770.439) [-771.503] (-774.187) (-773.772) -- 0:00:40
354500 -- (-771.218) (-772.016) [-772.046] (-770.908) * (-777.888) (-772.034) (-771.206) [-771.013] -- 0:00:40
355000 -- (-772.353) (-771.942) (-771.832) [-771.935] * (-770.764) [-772.948] (-771.462) (-771.355) -- 0:00:39
Average standard deviation of split frequencies: 0.009970
355500 -- [-771.235] (-773.113) (-773.599) (-774.551) * [-770.853] (-773.280) (-773.557) (-771.361) -- 0:00:39
356000 -- (-774.129) (-776.167) (-771.170) [-771.390] * (-772.403) (-770.930) (-771.451) [-771.862] -- 0:00:39
356500 -- (-772.053) (-771.968) [-770.343] (-771.698) * (-773.267) (-769.679) (-770.250) [-772.951] -- 0:00:39
357000 -- (-771.138) (-770.952) [-772.427] (-770.634) * (-773.101) (-770.321) [-772.133] (-771.849) -- 0:00:39
357500 -- (-770.195) (-770.296) (-771.108) [-771.342] * [-773.887] (-773.281) (-770.647) (-771.001) -- 0:00:39
358000 -- (-769.924) (-771.900) [-771.876] (-773.260) * (-771.044) (-773.377) (-769.683) [-774.488] -- 0:00:39
358500 -- (-770.326) (-770.611) [-770.934] (-777.387) * [-769.832] (-772.388) (-770.672) (-775.872) -- 0:00:39
359000 -- (-771.177) [-771.225] (-771.217) (-773.824) * (-771.524) [-771.807] (-773.045) (-773.216) -- 0:00:39
359500 -- (-770.158) (-770.536) [-771.209] (-771.385) * (-771.077) [-771.483] (-771.261) (-773.847) -- 0:00:39
360000 -- (-775.180) (-770.442) [-770.918] (-771.947) * (-772.064) (-773.338) [-771.269] (-773.832) -- 0:00:39
Average standard deviation of split frequencies: 0.010687
360500 -- (-772.733) (-772.924) [-769.891] (-772.277) * (-772.472) [-776.060] (-770.377) (-771.727) -- 0:00:40
361000 -- [-774.653] (-775.369) (-770.299) (-771.678) * (-772.278) (-773.486) (-771.218) [-771.614] -- 0:00:40
361500 -- [-773.004] (-772.299) (-776.723) (-780.252) * (-769.905) (-772.694) (-770.342) [-773.562] -- 0:00:40
362000 -- (-772.582) (-771.728) [-771.161] (-778.004) * (-773.237) (-772.684) [-771.058] (-771.347) -- 0:00:40
362500 -- (-772.094) (-773.777) (-771.710) [-770.951] * [-772.516] (-771.532) (-771.007) (-773.902) -- 0:00:40
363000 -- (-772.777) (-776.873) [-772.274] (-770.519) * (-774.135) (-770.059) (-770.395) [-771.921] -- 0:00:40
363500 -- (-776.690) [-770.111] (-769.953) (-773.944) * (-770.369) [-770.103] (-769.824) (-771.260) -- 0:00:40
364000 -- (-771.521) (-770.342) [-771.352] (-777.618) * [-770.453] (-773.173) (-770.418) (-773.018) -- 0:00:40
364500 -- [-770.463] (-772.555) (-771.956) (-771.431) * (-770.479) (-772.418) [-771.177] (-771.521) -- 0:00:40
365000 -- (-771.227) (-772.557) (-770.608) [-776.620] * (-771.485) [-772.281] (-770.475) (-770.623) -- 0:00:40
Average standard deviation of split frequencies: 0.010759
365500 -- (-771.153) (-772.124) (-774.020) [-772.994] * [-774.937] (-771.884) (-773.323) (-770.255) -- 0:00:39
366000 -- (-773.902) [-771.186] (-771.081) (-774.411) * [-771.304] (-770.860) (-775.514) (-770.776) -- 0:00:39
366500 -- (-772.022) [-772.490] (-772.053) (-771.345) * (-773.866) (-771.767) (-770.105) [-773.120] -- 0:00:39
367000 -- (-772.937) (-771.659) (-770.373) [-771.060] * (-770.764) (-771.697) [-770.510] (-775.198) -- 0:00:39
367500 -- (-772.419) (-774.371) (-769.912) [-772.480] * (-771.047) (-770.530) [-771.014] (-771.862) -- 0:00:39
368000 -- (-778.697) [-773.739] (-769.846) (-779.138) * (-773.588) [-771.339] (-770.132) (-774.580) -- 0:00:39
368500 -- (-772.923) (-772.315) [-771.477] (-779.288) * (-770.953) [-772.261] (-771.257) (-773.283) -- 0:00:39
369000 -- (-771.265) (-771.151) [-771.288] (-777.067) * (-773.697) (-773.123) [-776.000] (-771.790) -- 0:00:39
369500 -- (-775.733) (-774.121) [-773.666] (-776.564) * (-771.266) [-775.009] (-775.755) (-772.929) -- 0:00:39
370000 -- (-776.983) (-771.682) (-769.867) [-771.059] * (-770.080) (-770.778) [-771.480] (-772.690) -- 0:00:39
Average standard deviation of split frequencies: 0.010572
370500 -- [-772.511] (-772.698) (-771.408) (-770.487) * (-772.633) [-770.641] (-771.708) (-771.831) -- 0:00:39
371000 -- (-773.605) (-771.735) (-770.416) [-774.753] * (-771.153) [-770.012] (-772.542) (-771.548) -- 0:00:38
371500 -- [-776.877] (-771.933) (-772.468) (-772.436) * (-770.868) [-771.268] (-770.473) (-771.089) -- 0:00:38
372000 -- [-772.484] (-777.315) (-773.418) (-771.357) * (-770.458) (-780.589) [-770.802] (-770.389) -- 0:00:38
372500 -- (-771.002) (-773.308) (-771.985) [-771.571] * (-770.866) [-771.523] (-772.821) (-771.155) -- 0:00:38
373000 -- (-772.561) (-775.639) [-771.501] (-778.877) * (-771.662) (-774.173) (-771.587) [-771.584] -- 0:00:38
373500 -- (-770.239) (-777.809) (-773.203) [-771.174] * [-771.182] (-770.110) (-771.555) (-770.972) -- 0:00:38
374000 -- (-772.087) (-771.252) [-773.961] (-770.751) * (-776.509) (-770.598) [-769.924] (-770.242) -- 0:00:38
374500 -- (-772.269) [-770.950] (-773.868) (-770.480) * (-771.786) [-770.763] (-773.731) (-771.133) -- 0:00:38
375000 -- [-769.888] (-773.052) (-773.998) (-773.121) * (-770.348) (-773.127) [-770.423] (-770.407) -- 0:00:38
Average standard deviation of split frequencies: 0.011049
375500 -- (-772.123) (-773.554) [-772.767] (-772.505) * (-770.673) (-772.471) [-770.383] (-771.303) -- 0:00:38
376000 -- (-774.536) (-775.861) [-770.269] (-773.966) * (-772.663) (-770.177) (-770.343) [-772.988] -- 0:00:38
376500 -- [-771.636] (-773.450) (-770.946) (-772.107) * (-771.828) [-770.491] (-772.556) (-772.768) -- 0:00:38
377000 -- (-771.758) [-773.514] (-772.104) (-772.051) * (-770.654) (-769.984) (-770.958) [-771.863] -- 0:00:39
377500 -- (-772.326) (-772.385) (-770.053) [-771.346] * [-773.367] (-771.797) (-771.401) (-771.708) -- 0:00:39
378000 -- (-774.824) (-772.204) [-771.402] (-772.604) * (-772.339) (-772.292) (-772.551) [-770.479] -- 0:00:39
378500 -- (-770.973) [-770.484] (-769.640) (-773.795) * [-770.301] (-773.126) (-777.127) (-770.608) -- 0:00:39
379000 -- (-772.058) [-773.840] (-770.275) (-770.409) * [-773.345] (-771.150) (-775.687) (-771.934) -- 0:00:39
379500 -- (-771.970) (-774.555) (-770.721) [-771.556] * (-775.910) (-772.279) (-772.384) [-771.721] -- 0:00:39
380000 -- (-771.117) (-773.199) [-769.944] (-772.054) * (-770.267) [-771.292] (-771.168) (-772.337) -- 0:00:39
Average standard deviation of split frequencies: 0.011919
380500 -- (-772.541) (-771.789) [-774.119] (-772.962) * (-772.508) (-774.057) [-771.148] (-776.198) -- 0:00:39
381000 -- [-772.880] (-771.929) (-773.732) (-773.157) * (-774.459) (-772.609) [-771.583] (-772.435) -- 0:00:38
381500 -- [-770.909] (-773.740) (-772.642) (-775.517) * (-773.844) [-773.023] (-770.764) (-770.045) -- 0:00:38
382000 -- (-770.991) [-771.737] (-772.184) (-771.175) * (-775.363) [-770.539] (-771.711) (-771.736) -- 0:00:38
382500 -- (-769.775) (-771.012) (-773.982) [-771.060] * (-773.266) [-776.991] (-771.167) (-770.234) -- 0:00:38
383000 -- (-773.389) [-771.669] (-770.238) (-772.001) * (-774.497) (-778.555) (-773.111) [-771.783] -- 0:00:38
383500 -- (-770.082) [-775.144] (-774.028) (-772.541) * (-771.316) (-770.633) (-774.628) [-771.957] -- 0:00:38
384000 -- [-772.405] (-774.949) (-774.924) (-771.671) * [-771.245] (-771.989) (-770.656) (-775.040) -- 0:00:38
384500 -- (-770.569) (-779.608) (-771.873) [-771.155] * [-771.650] (-772.404) (-771.448) (-772.840) -- 0:00:38
385000 -- (-778.375) [-771.453] (-772.519) (-771.068) * (-771.769) (-771.574) (-771.218) [-771.464] -- 0:00:38
Average standard deviation of split frequencies: 0.011997
385500 -- [-773.613] (-770.915) (-775.495) (-774.106) * (-772.446) [-771.383] (-772.420) (-770.149) -- 0:00:38
386000 -- [-772.091] (-773.902) (-773.871) (-777.250) * (-772.224) (-769.821) [-772.067] (-774.505) -- 0:00:38
386500 -- (-773.931) (-771.384) [-771.731] (-771.175) * (-774.344) (-770.064) (-773.886) [-773.401] -- 0:00:38
387000 -- [-770.634] (-772.123) (-774.938) (-772.579) * [-771.742] (-771.660) (-773.395) (-774.709) -- 0:00:38
387500 -- [-772.759] (-771.928) (-772.596) (-774.763) * (-776.422) (-775.609) (-773.860) [-772.954] -- 0:00:37
388000 -- (-772.840) (-770.857) (-775.211) [-775.556] * (-778.867) [-773.678] (-772.883) (-771.503) -- 0:00:37
388500 -- [-770.588] (-772.793) (-771.154) (-774.834) * (-771.781) (-772.977) [-772.379] (-773.919) -- 0:00:37
389000 -- [-772.849] (-774.140) (-772.529) (-771.468) * (-771.598) (-781.300) [-770.651] (-778.400) -- 0:00:37
389500 -- (-773.919) (-770.842) (-770.507) [-771.269] * (-770.159) [-773.067] (-772.081) (-770.709) -- 0:00:37
390000 -- [-773.484] (-770.996) (-772.282) (-770.959) * (-771.450) (-771.378) [-770.820] (-771.819) -- 0:00:37
Average standard deviation of split frequencies: 0.011996
390500 -- [-773.628] (-772.129) (-772.291) (-770.640) * [-771.335] (-773.003) (-775.969) (-771.201) -- 0:00:37
391000 -- (-771.431) (-772.453) (-773.259) [-771.106] * (-771.260) (-771.014) (-769.931) [-770.412] -- 0:00:37
391500 -- [-771.964] (-770.877) (-771.178) (-771.256) * [-770.775] (-771.088) (-770.411) (-776.264) -- 0:00:37
392000 -- (-771.156) [-770.796] (-771.118) (-770.701) * (-773.961) (-771.013) (-772.441) [-772.464] -- 0:00:37
392500 -- (-771.309) (-770.380) (-771.672) [-775.796] * (-774.062) [-771.137] (-771.529) (-773.893) -- 0:00:37
393000 -- (-771.461) [-774.419] (-771.555) (-772.348) * (-772.526) (-772.377) [-770.189] (-773.265) -- 0:00:37
393500 -- (-770.675) [-771.438] (-772.688) (-773.524) * (-771.317) [-772.748] (-771.548) (-770.224) -- 0:00:38
394000 -- (-770.894) (-774.030) [-769.847] (-770.159) * [-772.522] (-773.709) (-771.588) (-771.778) -- 0:00:38
394500 -- (-771.111) [-771.612] (-769.831) (-770.717) * (-772.760) (-773.503) (-770.221) [-772.096] -- 0:00:38
395000 -- (-773.829) (-770.752) (-771.414) [-771.580] * [-770.231] (-771.274) (-773.888) (-773.465) -- 0:00:38
Average standard deviation of split frequencies: 0.011484
395500 -- (-772.023) (-771.287) (-771.094) [-773.711] * [-773.097] (-771.844) (-775.987) (-775.609) -- 0:00:38
396000 -- (-772.917) (-771.858) (-772.043) [-773.911] * (-772.886) (-772.083) [-777.193] (-770.142) -- 0:00:38
396500 -- [-775.222] (-773.402) (-770.467) (-773.953) * (-775.283) (-770.409) (-770.131) [-771.238] -- 0:00:38
397000 -- (-773.318) (-772.927) (-772.911) [-775.440] * (-773.536) [-770.473] (-770.947) (-771.653) -- 0:00:37
397500 -- (-775.211) [-773.561] (-774.696) (-774.083) * (-773.477) (-770.946) [-771.410] (-771.128) -- 0:00:37
398000 -- [-770.612] (-771.201) (-771.054) (-771.750) * (-772.075) [-772.015] (-773.508) (-771.933) -- 0:00:37
398500 -- [-772.388] (-773.286) (-778.383) (-771.715) * [-772.890] (-771.617) (-777.316) (-770.440) -- 0:00:37
399000 -- [-772.685] (-773.657) (-772.237) (-769.914) * (-770.515) (-772.287) (-775.322) [-772.905] -- 0:00:37
399500 -- [-773.567] (-775.702) (-772.236) (-770.018) * (-772.168) (-773.634) (-772.374) [-773.948] -- 0:00:37
400000 -- (-772.964) (-772.269) [-771.147] (-771.000) * (-772.029) (-770.223) [-770.593] (-772.491) -- 0:00:37
Average standard deviation of split frequencies: 0.010866
400500 -- [-772.687] (-774.682) (-772.899) (-769.833) * (-769.880) [-772.079] (-772.724) (-770.686) -- 0:00:37
401000 -- [-777.468] (-771.815) (-773.974) (-770.712) * (-771.895) (-772.615) [-776.069] (-774.660) -- 0:00:37
401500 -- (-772.229) [-770.303] (-770.274) (-773.587) * [-774.863] (-772.507) (-780.391) (-771.068) -- 0:00:37
402000 -- (-776.102) (-771.790) [-770.474] (-777.382) * (-772.522) (-770.528) (-778.139) [-771.094] -- 0:00:37
402500 -- (-770.441) (-773.271) (-770.971) [-772.312] * (-771.533) (-773.712) (-773.171) [-774.274] -- 0:00:37
403000 -- (-774.775) (-773.175) (-771.278) [-771.568] * (-774.219) [-771.336] (-771.708) (-771.136) -- 0:00:37
403500 -- [-770.333] (-773.504) (-773.334) (-771.585) * (-774.626) (-771.246) [-772.068] (-771.728) -- 0:00:36
404000 -- (-770.625) (-775.024) [-774.461] (-772.194) * (-776.256) (-770.693) (-775.767) [-777.657] -- 0:00:36
404500 -- (-770.242) (-770.436) [-773.002] (-773.481) * [-773.045] (-772.758) (-771.485) (-771.064) -- 0:00:36
405000 -- (-774.500) (-769.687) (-775.061) [-771.930] * (-771.768) (-775.080) [-770.272] (-771.136) -- 0:00:36
Average standard deviation of split frequencies: 0.010108
405500 -- (-773.824) (-770.369) (-775.343) [-770.544] * (-771.067) [-771.629] (-772.217) (-773.711) -- 0:00:36
406000 -- (-771.918) (-772.355) (-772.454) [-771.532] * (-773.404) [-773.165] (-771.559) (-773.576) -- 0:00:36
406500 -- [-771.887] (-774.874) (-770.442) (-771.125) * [-772.250] (-772.165) (-774.462) (-775.280) -- 0:00:36
407000 -- (-773.370) (-772.420) (-771.052) [-770.819] * [-771.855] (-772.071) (-772.245) (-778.567) -- 0:00:36
407500 -- [-770.053] (-769.854) (-771.265) (-771.785) * (-770.979) (-772.318) [-772.513] (-771.140) -- 0:00:36
408000 -- [-772.418] (-771.720) (-773.457) (-771.631) * (-771.501) (-772.763) [-771.466] (-771.994) -- 0:00:36
408500 -- [-771.763] (-779.704) (-771.004) (-773.061) * (-771.886) (-771.753) [-772.160] (-771.010) -- 0:00:36
409000 -- (-773.365) (-772.874) (-770.637) [-772.481] * (-771.160) (-771.617) (-771.859) [-772.348] -- 0:00:36
409500 -- (-773.737) (-773.472) (-770.480) [-772.506] * (-771.037) (-770.534) (-772.857) [-773.026] -- 0:00:37
410000 -- (-770.739) (-771.458) (-770.902) [-771.213] * (-770.195) (-776.573) (-773.309) [-770.232] -- 0:00:37
Average standard deviation of split frequencies: 0.010259
410500 -- [-772.433] (-771.075) (-770.583) (-775.442) * [-769.873] (-773.278) (-772.789) (-770.693) -- 0:00:37
411000 -- (-773.445) (-771.986) [-771.274] (-775.337) * [-769.935] (-772.595) (-772.897) (-778.663) -- 0:00:37
411500 -- [-770.616] (-773.392) (-770.702) (-775.234) * (-775.419) [-770.415] (-771.778) (-776.667) -- 0:00:37
412000 -- [-769.946] (-774.046) (-771.973) (-771.780) * (-772.322) (-769.967) [-771.425] (-772.216) -- 0:00:37
412500 -- (-770.211) [-771.542] (-770.801) (-773.933) * (-771.673) (-769.981) [-770.102] (-772.543) -- 0:00:37
413000 -- [-770.596] (-774.431) (-770.197) (-773.697) * (-771.648) [-769.981] (-771.459) (-772.486) -- 0:00:36
413500 -- (-772.656) [-772.677] (-770.120) (-772.358) * (-772.995) [-772.383] (-772.896) (-773.106) -- 0:00:36
414000 -- (-773.534) [-774.157] (-770.973) (-771.980) * [-773.720] (-772.654) (-772.913) (-770.171) -- 0:00:36
414500 -- (-772.490) (-772.258) [-770.538] (-772.315) * (-772.541) (-769.948) (-771.211) [-770.854] -- 0:00:36
415000 -- (-772.276) [-772.392] (-772.751) (-770.278) * [-771.521] (-771.082) (-772.378) (-770.818) -- 0:00:36
Average standard deviation of split frequencies: 0.011190
415500 -- (-771.641) [-774.802] (-771.297) (-774.321) * (-771.582) (-770.369) (-770.380) [-772.125] -- 0:00:36
416000 -- (-772.774) (-773.199) (-771.103) [-771.475] * [-772.089] (-769.692) (-771.690) (-770.395) -- 0:00:36
416500 -- (-774.271) [-771.300] (-773.014) (-772.275) * (-774.145) (-771.851) (-771.902) [-770.332] -- 0:00:36
417000 -- [-770.464] (-771.277) (-773.884) (-772.834) * (-775.178) (-771.033) [-772.575] (-770.852) -- 0:00:36
417500 -- [-769.719] (-771.401) (-770.944) (-776.074) * (-770.011) [-770.425] (-772.698) (-771.630) -- 0:00:36
418000 -- (-774.237) [-771.213] (-769.893) (-773.424) * [-770.085] (-770.523) (-771.638) (-771.065) -- 0:00:36
418500 -- (-771.943) (-770.673) [-770.451] (-771.579) * (-772.159) [-773.425] (-772.684) (-771.391) -- 0:00:36
419000 -- (-776.805) [-769.740] (-771.583) (-771.338) * [-775.760] (-775.334) (-774.411) (-779.586) -- 0:00:36
419500 -- (-773.447) (-770.582) (-770.033) [-770.595] * (-771.252) (-773.737) [-770.989] (-772.139) -- 0:00:35
420000 -- (-772.966) (-770.907) (-771.083) [-772.453] * (-770.263) [-773.415] (-771.246) (-771.485) -- 0:00:35
Average standard deviation of split frequencies: 0.010296
420500 -- (-772.473) (-772.253) [-772.953] (-770.297) * (-770.286) [-774.294] (-773.435) (-769.725) -- 0:00:35
421000 -- (-771.981) (-772.335) (-772.343) [-770.749] * (-770.307) (-772.327) [-772.038] (-770.700) -- 0:00:35
421500 -- (-770.621) (-775.079) (-772.919) [-772.498] * (-770.550) (-773.217) (-774.001) [-771.168] -- 0:00:35
422000 -- (-770.052) (-773.168) [-770.724] (-772.032) * [-770.761] (-773.709) (-772.335) (-771.168) -- 0:00:35
422500 -- [-777.114] (-771.500) (-773.295) (-771.693) * (-770.833) (-773.773) [-769.855] (-771.940) -- 0:00:35
423000 -- (-772.816) [-772.221] (-775.871) (-771.528) * [-770.115] (-769.726) (-770.136) (-772.325) -- 0:00:35
423500 -- (-772.779) [-772.166] (-777.336) (-773.828) * (-771.443) [-771.707] (-773.241) (-770.336) -- 0:00:35
424000 -- (-771.804) [-772.981] (-772.292) (-774.611) * [-771.040] (-771.599) (-771.609) (-770.525) -- 0:00:35
424500 -- (-770.683) (-771.755) [-772.055] (-771.855) * (-774.068) [-770.344] (-772.735) (-771.540) -- 0:00:35
425000 -- (-770.620) [-772.396] (-773.019) (-772.133) * (-770.778) (-772.401) (-772.869) [-770.370] -- 0:00:35
Average standard deviation of split frequencies: 0.010374
425500 -- [-774.387] (-774.437) (-773.683) (-772.303) * [-771.465] (-774.840) (-775.879) (-770.485) -- 0:00:36
426000 -- (-770.908) (-774.313) [-773.812] (-770.416) * [-770.715] (-773.963) (-772.306) (-771.155) -- 0:00:36
426500 -- (-774.800) (-770.104) [-772.673] (-772.476) * (-770.892) (-772.046) [-771.968] (-772.712) -- 0:00:36
427000 -- (-774.700) [-770.374] (-775.170) (-770.339) * (-775.766) (-778.639) [-770.987] (-772.042) -- 0:00:36
427500 -- (-773.120) (-771.105) [-770.125] (-771.347) * (-771.156) (-772.949) [-772.355] (-775.064) -- 0:00:36
428000 -- (-772.976) (-771.283) (-769.620) [-771.028] * (-771.019) (-771.683) (-771.515) [-773.560] -- 0:00:36
428500 -- (-771.520) (-771.530) [-770.270] (-771.573) * (-774.006) [-770.162] (-769.789) (-774.019) -- 0:00:36
429000 -- (-772.250) (-770.290) [-770.100] (-770.869) * (-772.302) (-770.918) [-770.645] (-773.532) -- 0:00:35
429500 -- (-772.994) [-772.786] (-770.783) (-770.311) * [-770.598] (-773.117) (-770.455) (-771.558) -- 0:00:35
430000 -- (-769.923) [-773.383] (-771.302) (-770.501) * [-772.540] (-773.696) (-771.499) (-772.538) -- 0:00:35
Average standard deviation of split frequencies: 0.009715
430500 -- [-771.518] (-772.089) (-771.085) (-770.096) * (-774.171) (-773.901) [-773.618] (-773.209) -- 0:00:35
431000 -- (-770.211) (-770.763) (-771.900) [-771.027] * (-771.014) (-773.471) (-770.791) [-776.082] -- 0:00:35
431500 -- (-772.627) (-771.209) (-771.881) [-771.573] * (-772.252) (-775.587) (-774.674) [-772.472] -- 0:00:35
432000 -- [-772.308] (-771.901) (-773.292) (-771.196) * (-771.693) (-771.019) (-774.288) [-773.091] -- 0:00:35
432500 -- [-770.807] (-773.739) (-773.637) (-773.959) * [-772.487] (-774.946) (-771.942) (-771.576) -- 0:00:35
433000 -- (-770.441) [-771.087] (-770.759) (-771.849) * (-770.240) (-774.886) (-772.996) [-769.935] -- 0:00:35
433500 -- (-769.956) [-771.652] (-770.081) (-771.162) * (-771.610) (-771.994) [-772.293] (-772.150) -- 0:00:35
434000 -- (-774.036) (-772.053) (-770.955) [-770.228] * [-771.778] (-771.352) (-772.774) (-770.590) -- 0:00:35
434500 -- (-774.039) (-772.310) [-771.952] (-772.983) * (-771.948) (-771.338) (-775.571) [-770.252] -- 0:00:35
435000 -- (-770.848) (-773.882) [-770.111] (-770.791) * [-773.177] (-770.720) (-773.951) (-770.418) -- 0:00:35
Average standard deviation of split frequencies: 0.010884
435500 -- (-770.680) (-772.348) [-771.242] (-773.669) * (-772.336) (-770.974) (-771.575) [-772.221] -- 0:00:34
436000 -- (-772.905) [-770.404] (-770.694) (-771.141) * [-771.110] (-771.285) (-770.382) (-772.639) -- 0:00:34
436500 -- (-772.297) (-771.938) (-770.945) [-777.252] * [-771.969] (-771.275) (-770.413) (-772.812) -- 0:00:34
437000 -- (-771.993) (-771.144) [-770.482] (-769.719) * (-773.615) [-772.114] (-771.812) (-772.107) -- 0:00:34
437500 -- (-771.767) [-771.585] (-770.593) (-770.312) * [-771.709] (-776.984) (-770.256) (-773.002) -- 0:00:34
438000 -- [-770.018] (-774.836) (-773.882) (-770.630) * [-772.163] (-772.341) (-772.656) (-773.283) -- 0:00:34
438500 -- (-772.541) [-770.752] (-771.791) (-770.733) * (-770.678) (-770.457) (-770.768) [-770.586] -- 0:00:34
439000 -- (-772.232) (-770.846) (-772.361) [-770.927] * (-775.266) (-771.879) (-784.524) [-770.752] -- 0:00:34
439500 -- (-771.099) (-772.790) (-774.070) [-769.975] * [-770.628] (-772.588) (-777.769) (-772.412) -- 0:00:34
440000 -- (-771.566) [-771.577] (-772.289) (-771.354) * (-769.961) (-772.413) [-772.233] (-772.589) -- 0:00:34
Average standard deviation of split frequencies: 0.010430
440500 -- (-772.092) [-773.298] (-773.320) (-770.965) * (-770.392) [-771.809] (-771.718) (-771.866) -- 0:00:34
441000 -- (-770.670) (-772.061) [-770.732] (-770.770) * (-771.356) (-774.067) (-773.310) [-775.789] -- 0:00:34
441500 -- (-775.970) (-772.594) (-771.460) [-771.107] * [-771.971] (-769.844) (-770.590) (-775.201) -- 0:00:34
442000 -- [-772.348] (-773.582) (-774.214) (-774.462) * (-771.930) (-771.063) [-771.957] (-771.306) -- 0:00:34
442500 -- (-771.341) (-772.859) [-774.935] (-772.859) * (-770.630) [-770.496] (-770.971) (-773.575) -- 0:00:35
443000 -- (-770.447) (-770.138) [-772.043] (-772.519) * (-771.039) (-770.823) (-773.747) [-770.763] -- 0:00:35
443500 -- (-773.098) (-769.985) [-772.720] (-773.143) * (-770.136) (-771.184) [-773.681] (-774.388) -- 0:00:35
444000 -- (-772.197) (-769.835) (-771.945) [-771.049] * (-773.625) [-770.125] (-772.697) (-773.114) -- 0:00:35
444500 -- (-770.814) [-770.905] (-773.991) (-772.670) * (-770.643) (-770.105) (-772.232) [-774.492] -- 0:00:34
445000 -- (-771.370) (-770.023) (-770.316) [-771.350] * (-774.031) [-770.864] (-770.584) (-770.623) -- 0:00:34
Average standard deviation of split frequencies: 0.009975
445500 -- (-774.175) (-772.298) (-770.316) [-772.092] * [-771.203] (-771.178) (-770.503) (-770.964) -- 0:00:34
446000 -- (-772.354) (-770.340) (-770.587) [-771.841] * (-771.654) (-770.104) [-770.602] (-771.537) -- 0:00:34
446500 -- (-771.516) (-771.123) [-771.512] (-771.151) * (-773.631) [-771.562] (-772.671) (-770.534) -- 0:00:34
447000 -- (-771.306) (-773.895) [-772.352] (-771.237) * [-770.347] (-771.519) (-773.890) (-771.422) -- 0:00:34
447500 -- (-772.892) (-774.415) [-771.822] (-771.042) * (-773.430) [-772.069] (-769.784) (-773.889) -- 0:00:34
448000 -- [-771.418] (-774.767) (-770.309) (-770.383) * [-770.380] (-773.709) (-769.976) (-772.198) -- 0:00:34
448500 -- (-775.537) (-772.868) [-770.897] (-769.983) * [-770.948] (-770.130) (-773.776) (-771.270) -- 0:00:34
449000 -- (-770.145) (-774.345) [-769.914] (-772.034) * (-770.419) [-770.882] (-771.442) (-771.730) -- 0:00:34
449500 -- (-772.251) (-773.904) [-770.756] (-774.096) * (-770.121) (-770.077) (-771.718) [-770.626] -- 0:00:34
450000 -- (-774.395) [-772.934] (-770.528) (-772.832) * [-770.891] (-770.707) (-771.899) (-774.498) -- 0:00:34
Average standard deviation of split frequencies: 0.009480
450500 -- [-771.621] (-771.116) (-771.702) (-772.963) * (-773.549) (-769.970) [-771.230] (-775.948) -- 0:00:34
451000 -- (-771.138) (-770.812) (-772.709) [-772.693] * (-773.849) [-771.157] (-774.916) (-771.955) -- 0:00:34
451500 -- (-770.006) [-770.626] (-771.507) (-773.621) * (-772.772) (-772.658) (-772.882) [-773.080] -- 0:00:34
452000 -- [-770.330] (-772.880) (-772.163) (-773.199) * (-769.852) (-772.051) [-771.429] (-771.035) -- 0:00:33
452500 -- (-773.183) [-771.990] (-771.289) (-773.203) * [-771.643] (-772.093) (-771.042) (-770.748) -- 0:00:33
453000 -- (-773.426) [-770.722] (-771.149) (-773.401) * (-774.499) [-772.130] (-770.359) (-772.679) -- 0:00:33
453500 -- (-772.855) (-771.756) (-771.093) [-772.624] * (-774.539) (-776.579) [-771.246] (-770.287) -- 0:00:33
454000 -- (-772.570) [-774.257] (-772.017) (-773.641) * (-774.691) (-773.794) (-772.205) [-770.145] -- 0:00:33
454500 -- (-775.593) (-771.962) (-771.143) [-774.220] * (-776.948) (-772.578) (-771.723) [-773.450] -- 0:00:33
455000 -- (-772.914) (-771.379) (-771.442) [-773.545] * (-772.643) (-770.062) [-772.368] (-777.682) -- 0:00:33
Average standard deviation of split frequencies: 0.009786
455500 -- (-773.545) (-772.939) (-772.529) [-771.681] * (-770.940) (-769.836) [-771.269] (-773.183) -- 0:00:33
456000 -- (-771.051) (-774.233) [-772.253] (-770.006) * (-771.462) [-769.760] (-771.694) (-777.112) -- 0:00:33
456500 -- (-771.220) (-770.341) (-772.535) [-769.787] * [-771.698] (-770.299) (-771.415) (-771.407) -- 0:00:33
457000 -- (-771.284) [-770.633] (-770.344) (-771.997) * (-772.151) (-771.080) [-769.974] (-770.619) -- 0:00:33
457500 -- (-771.376) (-771.408) (-772.807) [-772.663] * (-771.570) (-770.170) (-769.758) [-772.722] -- 0:00:33
458000 -- (-771.997) (-770.988) [-771.139] (-771.710) * (-772.253) (-770.329) (-774.880) [-770.704] -- 0:00:33
458500 -- [-771.901] (-770.941) (-777.529) (-772.023) * (-770.847) (-769.520) (-771.402) [-770.581] -- 0:00:33
459000 -- (-771.966) (-770.914) [-773.356] (-771.495) * (-772.272) [-770.562] (-773.036) (-773.268) -- 0:00:34
459500 -- (-772.697) [-770.749] (-770.387) (-770.703) * (-770.928) (-774.220) [-777.580] (-770.992) -- 0:00:34
460000 -- [-775.016] (-772.539) (-772.896) (-771.582) * (-773.319) [-772.791] (-770.739) (-770.403) -- 0:00:34
Average standard deviation of split frequencies: 0.008664
460500 -- (-772.026) (-771.454) (-772.844) [-771.081] * (-770.431) [-772.624] (-771.577) (-770.100) -- 0:00:33
461000 -- [-771.397] (-773.751) (-770.875) (-773.444) * (-770.018) [-772.326] (-772.578) (-771.139) -- 0:00:33
461500 -- (-770.384) (-774.182) (-772.880) [-773.628] * [-776.922] (-772.347) (-776.019) (-770.568) -- 0:00:33
462000 -- [-770.231] (-774.301) (-771.487) (-775.610) * (-771.425) (-771.496) [-770.443] (-772.814) -- 0:00:33
462500 -- (-773.837) [-770.978] (-771.660) (-770.161) * [-770.607] (-773.562) (-771.456) (-770.846) -- 0:00:33
463000 -- (-771.861) (-771.061) (-772.504) [-772.759] * (-770.584) [-770.310] (-772.138) (-772.153) -- 0:00:33
463500 -- [-772.717] (-770.865) (-773.137) (-770.716) * (-773.466) [-770.057] (-770.063) (-772.688) -- 0:00:33
464000 -- [-773.788] (-772.694) (-771.861) (-773.950) * (-770.606) (-771.699) (-770.088) [-773.196] -- 0:00:33
464500 -- (-773.083) [-773.390] (-775.611) (-771.462) * (-775.826) [-771.401] (-774.205) (-772.317) -- 0:00:33
465000 -- [-770.643] (-773.544) (-773.001) (-773.444) * (-772.509) [-772.703] (-773.217) (-772.575) -- 0:00:33
Average standard deviation of split frequencies: 0.008219
465500 -- (-772.455) (-773.562) (-772.043) [-771.536] * (-771.790) (-774.120) [-771.010] (-771.983) -- 0:00:33
466000 -- (-770.156) (-771.688) [-771.173] (-772.347) * [-773.104] (-772.918) (-771.035) (-773.600) -- 0:00:33
466500 -- (-775.110) (-772.108) [-770.886] (-772.219) * (-771.921) (-774.039) (-770.263) [-772.405] -- 0:00:33
467000 -- (-774.040) (-770.670) (-770.483) [-771.554] * (-772.976) (-774.459) [-770.614] (-773.970) -- 0:00:33
467500 -- [-775.810] (-773.114) (-771.498) (-776.508) * (-774.260) (-771.683) [-770.729] (-771.562) -- 0:00:33
468000 -- (-774.834) [-772.286] (-772.950) (-772.847) * (-770.463) (-771.855) [-770.591] (-778.099) -- 0:00:32
468500 -- (-772.388) [-775.766] (-771.072) (-774.288) * (-773.167) (-772.097) (-773.333) [-772.139] -- 0:00:32
469000 -- (-771.089) [-771.456] (-770.667) (-774.928) * [-770.448] (-773.549) (-770.807) (-772.563) -- 0:00:32
469500 -- (-771.777) [-771.022] (-776.403) (-771.548) * [-772.951] (-774.283) (-774.260) (-772.108) -- 0:00:32
470000 -- (-771.753) (-771.115) (-776.679) [-771.194] * (-772.925) (-776.612) (-771.800) [-770.375] -- 0:00:32
Average standard deviation of split frequencies: 0.008947
470500 -- [-775.916] (-772.683) (-773.725) (-773.024) * [-770.634] (-769.628) (-770.892) (-775.104) -- 0:00:32
471000 -- (-774.235) [-773.004] (-772.696) (-771.963) * [-771.765] (-771.174) (-773.127) (-772.640) -- 0:00:32
471500 -- (-772.403) (-770.357) (-775.393) [-770.566] * (-774.472) (-772.823) (-773.188) [-770.120] -- 0:00:32
472000 -- (-771.851) (-772.098) [-771.169] (-770.836) * (-772.923) (-775.461) [-772.542] (-771.532) -- 0:00:32
472500 -- (-771.002) (-773.085) [-773.720] (-775.347) * (-770.018) (-770.399) [-772.077] (-770.579) -- 0:00:32
473000 -- (-772.796) (-775.261) (-777.102) [-771.163] * [-775.048] (-771.010) (-774.490) (-773.121) -- 0:00:32
473500 -- [-771.949] (-771.649) (-771.527) (-771.958) * [-770.234] (-770.705) (-774.285) (-775.071) -- 0:00:32
474000 -- (-776.836) [-770.527] (-773.385) (-770.723) * [-771.880] (-774.066) (-775.788) (-775.322) -- 0:00:32
474500 -- (-771.696) (-771.041) (-773.630) [-773.394] * (-772.771) [-770.482] (-777.229) (-773.615) -- 0:00:32
475000 -- (-777.248) (-771.436) (-772.416) [-771.379] * [-771.133] (-770.455) (-770.132) (-775.499) -- 0:00:32
Average standard deviation of split frequencies: 0.008451
475500 -- [-773.982] (-773.460) (-772.537) (-771.172) * (-772.508) [-778.152] (-771.345) (-772.650) -- 0:00:33
476000 -- [-770.349] (-772.418) (-770.196) (-774.836) * (-772.069) (-774.429) (-772.020) [-770.570] -- 0:00:33
476500 -- (-771.889) [-774.598] (-773.277) (-771.249) * (-776.680) [-773.404] (-771.798) (-771.115) -- 0:00:32
477000 -- (-772.144) (-771.294) [-770.421] (-772.551) * (-773.021) [-770.982] (-774.917) (-771.054) -- 0:00:32
477500 -- (-773.054) [-773.019] (-773.246) (-772.498) * [-775.132] (-773.622) (-770.953) (-771.400) -- 0:00:32
478000 -- (-771.683) [-771.430] (-771.913) (-775.037) * (-772.126) (-774.123) (-775.409) [-773.154] -- 0:00:32
478500 -- [-769.733] (-774.176) (-771.971) (-773.518) * (-774.118) (-774.246) (-777.645) [-770.965] -- 0:00:32
479000 -- [-769.665] (-771.432) (-770.701) (-771.113) * (-773.569) (-772.297) (-774.029) [-771.037] -- 0:00:32
479500 -- (-776.139) (-771.937) [-769.923] (-772.865) * (-770.483) (-774.349) (-772.354) [-771.382] -- 0:00:32
480000 -- (-773.089) (-772.054) [-772.264] (-771.153) * (-772.371) [-770.618] (-770.544) (-772.401) -- 0:00:32
Average standard deviation of split frequencies: 0.008565
480500 -- [-773.245] (-770.491) (-772.930) (-781.655) * (-770.821) (-771.366) [-771.605] (-771.447) -- 0:00:32
481000 -- (-773.187) (-771.826) [-778.593] (-778.823) * (-772.616) (-770.718) [-771.547] (-777.065) -- 0:00:32
481500 -- [-771.331] (-771.859) (-772.609) (-774.585) * (-770.401) [-773.132] (-771.994) (-771.706) -- 0:00:32
482000 -- (-771.874) (-771.867) (-772.912) [-771.977] * (-771.307) [-770.436] (-771.141) (-773.326) -- 0:00:32
482500 -- (-770.736) [-770.467] (-771.841) (-770.005) * [-770.188] (-771.536) (-773.466) (-775.807) -- 0:00:32
483000 -- [-773.111] (-770.465) (-774.230) (-770.363) * (-772.365) (-770.123) (-775.099) [-773.063] -- 0:00:32
483500 -- [-769.717] (-770.935) (-772.192) (-772.739) * (-773.990) (-771.283) (-771.627) [-771.153] -- 0:00:32
484000 -- (-775.125) (-773.006) [-773.056] (-772.004) * (-773.014) (-770.710) (-771.795) [-772.627] -- 0:00:31
484500 -- (-770.603) (-772.631) [-770.211] (-771.901) * (-773.018) (-776.185) [-771.860] (-773.816) -- 0:00:31
485000 -- (-773.377) (-773.469) (-772.070) [-772.654] * [-772.286] (-775.622) (-774.524) (-771.535) -- 0:00:31
Average standard deviation of split frequencies: 0.008406
485500 -- (-772.408) (-775.239) [-771.609] (-773.419) * [-770.128] (-769.878) (-771.439) (-770.259) -- 0:00:31
486000 -- [-775.375] (-771.771) (-771.961) (-772.818) * (-770.863) [-772.383] (-773.521) (-771.789) -- 0:00:31
486500 -- [-773.350] (-770.998) (-771.274) (-776.345) * (-772.464) (-770.424) (-771.360) [-774.134] -- 0:00:31
487000 -- [-771.678] (-771.433) (-771.150) (-774.766) * [-772.027] (-771.473) (-770.459) (-772.243) -- 0:00:31
487500 -- (-775.439) (-772.820) (-771.201) [-771.441] * (-776.089) (-771.604) (-770.353) [-773.995] -- 0:00:31
488000 -- (-771.337) [-770.282] (-771.748) (-771.015) * (-771.008) (-771.526) [-770.918] (-773.275) -- 0:00:31
488500 -- [-775.453] (-773.243) (-770.564) (-772.131) * [-772.997] (-770.884) (-773.284) (-772.574) -- 0:00:31
489000 -- (-772.556) (-775.400) [-770.418] (-775.758) * (-771.285) [-771.294] (-772.958) (-772.987) -- 0:00:31
489500 -- [-771.655] (-776.454) (-770.335) (-773.089) * (-771.021) [-771.137] (-771.740) (-771.869) -- 0:00:31
490000 -- (-773.713) [-771.597] (-771.460) (-770.797) * (-770.256) (-770.901) [-770.820] (-772.648) -- 0:00:31
Average standard deviation of split frequencies: 0.008326
490500 -- [-772.881] (-770.615) (-772.444) (-772.335) * [-772.741] (-771.965) (-770.706) (-773.882) -- 0:00:31
491000 -- (-771.995) (-769.715) [-772.428] (-775.153) * (-771.365) (-771.041) (-771.247) [-772.438] -- 0:00:32
491500 -- [-772.373] (-773.590) (-771.902) (-773.883) * (-776.138) (-770.919) (-770.881) [-772.578] -- 0:00:32
492000 -- (-771.206) [-775.449] (-773.639) (-771.646) * (-772.183) (-773.588) (-774.127) [-770.949] -- 0:00:32
492500 -- (-770.234) (-773.064) [-769.988] (-776.630) * (-771.734) [-772.133] (-772.441) (-771.703) -- 0:00:31
493000 -- (-770.549) (-769.937) (-774.378) [-772.093] * (-773.577) [-771.388] (-771.206) (-772.283) -- 0:00:31
493500 -- (-772.052) (-774.145) (-779.462) [-771.731] * (-773.295) [-772.882] (-774.429) (-773.854) -- 0:00:31
494000 -- (-771.432) (-775.732) [-771.686] (-771.238) * (-769.755) [-772.265] (-774.653) (-772.351) -- 0:00:31
494500 -- [-771.615] (-774.120) (-770.760) (-770.243) * (-771.865) (-770.949) [-777.275] (-772.418) -- 0:00:31
495000 -- (-770.372) [-774.684] (-771.796) (-774.475) * (-772.244) (-770.111) (-774.991) [-773.826] -- 0:00:31
Average standard deviation of split frequencies: 0.008364
495500 -- (-771.497) (-773.869) (-770.214) [-771.426] * (-771.920) [-771.113] (-773.350) (-771.107) -- 0:00:31
496000 -- (-772.003) (-777.850) (-774.546) [-773.243] * [-776.539] (-769.791) (-771.481) (-770.745) -- 0:00:31
496500 -- (-773.715) (-772.581) (-773.162) [-770.680] * (-777.034) [-771.470] (-771.378) (-773.271) -- 0:00:31
497000 -- (-774.020) (-771.906) (-773.913) [-773.940] * (-773.351) [-771.905] (-771.690) (-775.769) -- 0:00:31
497500 -- (-770.362) (-772.529) (-771.008) [-771.164] * (-771.234) (-773.104) (-770.716) [-774.617] -- 0:00:31
498000 -- [-771.536] (-774.133) (-770.140) (-771.174) * (-770.938) (-770.553) [-769.936] (-775.615) -- 0:00:31
498500 -- (-772.756) (-771.517) (-770.677) [-771.176] * (-774.932) (-773.488) [-771.385] (-772.080) -- 0:00:31
499000 -- (-775.416) (-773.729) [-771.603] (-770.441) * (-772.178) [-771.084] (-770.892) (-776.949) -- 0:00:31
499500 -- (-774.887) [-773.743] (-770.094) (-771.066) * [-771.498] (-773.627) (-771.265) (-774.166) -- 0:00:31
500000 -- (-773.440) [-775.629] (-770.094) (-772.077) * (-771.619) (-771.609) (-771.580) [-772.146] -- 0:00:31
Average standard deviation of split frequencies: 0.007784
500500 -- [-770.246] (-774.720) (-772.416) (-770.208) * (-772.470) [-772.380] (-775.360) (-771.732) -- 0:00:30
501000 -- (-772.066) (-772.774) [-771.876] (-773.572) * (-771.106) (-771.880) [-774.757] (-773.817) -- 0:00:30
501500 -- (-773.685) (-771.827) (-770.121) [-770.552] * (-774.244) (-769.945) (-771.760) [-774.060] -- 0:00:30
502000 -- (-774.836) (-771.536) (-770.575) [-770.347] * [-772.955] (-771.092) (-774.670) (-772.764) -- 0:00:30
502500 -- (-772.070) (-775.457) [-772.764] (-770.985) * (-774.166) (-773.621) [-772.931] (-770.760) -- 0:00:30
503000 -- (-771.019) (-777.879) [-770.215] (-771.684) * (-773.059) [-772.653] (-770.605) (-771.483) -- 0:00:30
503500 -- (-773.357) (-773.952) (-775.610) [-772.465] * [-770.917] (-770.434) (-772.606) (-770.595) -- 0:00:30
504000 -- (-772.100) (-774.408) [-772.236] (-771.385) * (-773.119) [-773.202] (-777.863) (-773.291) -- 0:00:30
504500 -- (-772.593) [-770.750] (-772.637) (-771.849) * (-773.424) [-773.949] (-776.295) (-772.922) -- 0:00:30
505000 -- (-772.768) (-773.066) (-772.763) [-770.107] * (-770.019) [-772.297] (-770.754) (-770.102) -- 0:00:30
Average standard deviation of split frequencies: 0.007278
505500 -- (-777.072) [-770.349] (-771.032) (-770.262) * (-771.632) [-772.555] (-771.011) (-773.634) -- 0:00:30
506000 -- [-771.423] (-772.705) (-772.910) (-770.205) * (-770.814) (-774.802) [-769.623] (-773.379) -- 0:00:30
506500 -- (-770.452) (-771.401) [-772.779] (-774.987) * [-772.387] (-772.612) (-770.231) (-775.029) -- 0:00:30
507000 -- [-771.986] (-772.888) (-771.452) (-772.948) * (-772.052) (-776.947) (-773.010) [-770.808] -- 0:00:30
507500 -- (-771.984) (-771.647) [-771.814] (-772.395) * (-770.468) (-771.762) [-770.709] (-771.739) -- 0:00:31
508000 -- (-770.403) (-771.820) (-775.132) [-770.786] * (-772.325) [-770.246] (-771.026) (-771.972) -- 0:00:30
508500 -- (-769.789) (-771.111) [-773.870] (-770.250) * (-772.823) [-770.932] (-774.188) (-773.048) -- 0:00:30
509000 -- (-772.526) (-776.648) (-775.145) [-772.782] * (-772.812) (-771.995) (-772.163) [-771.040] -- 0:00:30
509500 -- (-770.527) (-772.993) (-773.171) [-770.286] * (-775.507) (-777.900) [-770.410] (-773.466) -- 0:00:30
510000 -- (-775.368) (-770.476) (-772.845) [-772.134] * (-774.160) [-774.916] (-772.236) (-770.878) -- 0:00:30
Average standard deviation of split frequencies: 0.007631
510500 -- (-771.930) (-771.380) [-771.905] (-774.530) * (-773.100) (-774.281) [-773.695] (-776.009) -- 0:00:30
511000 -- (-771.921) [-771.017] (-771.206) (-776.370) * (-770.763) (-773.379) (-770.911) [-772.102] -- 0:00:30
511500 -- (-770.733) [-774.885] (-770.413) (-770.234) * [-770.858] (-770.568) (-771.487) (-771.431) -- 0:00:30
512000 -- (-770.054) (-770.861) [-771.754] (-773.072) * (-773.160) (-770.885) [-773.409] (-773.934) -- 0:00:30
512500 -- (-771.185) [-771.738] (-774.687) (-770.270) * (-771.864) (-776.261) (-773.967) [-772.229] -- 0:00:30
513000 -- [-771.703] (-771.961) (-774.593) (-770.804) * (-772.853) (-773.897) [-772.160] (-775.074) -- 0:00:30
513500 -- (-770.561) [-771.595] (-770.793) (-770.866) * [-770.941] (-771.135) (-772.310) (-776.981) -- 0:00:30
514000 -- [-770.264] (-773.346) (-770.351) (-770.765) * [-771.334] (-770.404) (-774.311) (-777.121) -- 0:00:30
514500 -- (-769.835) [-771.467] (-771.250) (-773.771) * (-773.657) [-777.306] (-774.237) (-776.915) -- 0:00:30
515000 -- (-770.198) (-774.288) [-777.547] (-774.184) * (-774.621) (-771.948) (-773.888) [-777.405] -- 0:00:30
Average standard deviation of split frequencies: 0.007023
515500 -- (-771.422) (-773.192) (-772.468) [-770.141] * (-776.087) (-771.560) (-770.367) [-775.950] -- 0:00:30
516000 -- (-771.691) (-772.333) [-770.744] (-772.521) * [-770.406] (-771.154) (-771.808) (-773.786) -- 0:00:30
516500 -- (-771.987) (-773.114) (-775.110) [-771.311] * (-769.969) (-770.848) (-770.390) [-771.633] -- 0:00:29
517000 -- (-770.073) (-773.251) [-772.821] (-774.204) * (-771.944) (-772.372) [-771.134] (-772.170) -- 0:00:29
517500 -- (-771.463) (-773.150) [-772.244] (-771.895) * (-770.368) (-772.662) [-770.947] (-773.140) -- 0:00:29
518000 -- [-771.102] (-774.664) (-770.217) (-775.227) * (-770.900) (-772.686) (-771.163) [-772.547] -- 0:00:29
518500 -- (-770.895) [-770.903] (-772.656) (-773.190) * (-772.717) (-771.606) [-773.557] (-770.447) -- 0:00:29
519000 -- (-771.040) (-772.043) (-774.664) [-771.136] * (-773.562) (-772.641) (-770.601) [-770.366] -- 0:00:29
519500 -- (-771.646) (-771.112) (-770.992) [-770.148] * (-776.144) (-771.238) (-770.042) [-771.423] -- 0:00:29
520000 -- [-771.061] (-771.901) (-769.591) (-769.987) * [-772.674] (-773.297) (-772.733) (-774.359) -- 0:00:29
Average standard deviation of split frequencies: 0.007073
520500 -- (-770.113) (-775.390) [-772.906] (-770.395) * (-772.504) [-770.478] (-771.793) (-771.558) -- 0:00:29
521000 -- [-770.709] (-777.448) (-771.524) (-772.570) * (-772.035) [-770.221] (-772.451) (-777.450) -- 0:00:29
521500 -- (-773.208) (-770.420) (-770.063) [-774.714] * [-771.206] (-770.670) (-772.420) (-772.379) -- 0:00:29
522000 -- (-771.470) [-772.179] (-769.762) (-773.091) * (-771.808) (-772.804) (-772.919) [-770.255] -- 0:00:29
522500 -- [-770.780] (-771.782) (-774.895) (-771.437) * (-771.507) (-772.182) (-771.677) [-771.300] -- 0:00:29
523000 -- (-770.372) (-779.602) (-772.972) [-770.580] * (-772.753) [-773.209] (-772.979) (-774.341) -- 0:00:29
523500 -- (-770.877) (-772.699) [-771.626] (-771.071) * [-771.927] (-774.495) (-773.043) (-771.588) -- 0:00:30
524000 -- (-771.430) [-770.228] (-774.767) (-770.678) * (-775.029) (-772.974) [-774.812] (-770.996) -- 0:00:29
524500 -- [-771.910] (-771.440) (-770.639) (-772.267) * (-772.538) [-773.162] (-773.161) (-773.402) -- 0:00:29
525000 -- [-771.375] (-771.686) (-772.359) (-771.762) * (-771.973) (-770.197) [-774.818] (-774.463) -- 0:00:29
Average standard deviation of split frequencies: 0.007450
525500 -- (-773.555) [-771.256] (-771.276) (-771.565) * (-771.933) (-771.019) [-774.433] (-771.621) -- 0:00:29
526000 -- (-774.581) (-769.874) (-773.361) [-774.216] * (-776.367) (-771.733) (-772.368) [-770.146] -- 0:00:29
526500 -- (-772.755) (-770.982) [-772.971] (-771.640) * (-775.117) (-770.938) (-772.347) [-770.241] -- 0:00:29
527000 -- (-770.856) (-772.676) [-770.613] (-772.867) * [-772.275] (-771.024) (-773.929) (-770.654) -- 0:00:29
527500 -- (-772.085) (-773.308) [-771.356] (-771.053) * (-774.524) (-771.775) [-769.952] (-772.371) -- 0:00:29
528000 -- [-773.688] (-772.640) (-770.628) (-770.330) * (-774.590) [-773.359] (-770.068) (-774.910) -- 0:00:29
528500 -- (-769.621) (-773.766) (-773.244) [-770.733] * (-776.987) (-774.720) [-772.782] (-774.904) -- 0:00:29
529000 -- (-778.541) (-775.145) [-770.308] (-771.785) * (-780.071) (-773.037) [-773.006] (-774.205) -- 0:00:29
529500 -- (-778.374) (-770.576) [-770.631] (-770.054) * (-772.709) [-772.543] (-772.732) (-771.872) -- 0:00:29
530000 -- [-771.282] (-771.010) (-774.097) (-770.606) * (-770.704) (-776.525) [-771.654] (-772.159) -- 0:00:29
Average standard deviation of split frequencies: 0.007525
530500 -- (-774.069) (-770.541) (-773.119) [-772.895] * [-772.915] (-776.819) (-773.437) (-770.427) -- 0:00:29
531000 -- (-770.313) [-773.490] (-772.364) (-773.375) * (-773.748) (-775.288) [-773.344] (-772.324) -- 0:00:29
531500 -- (-772.926) (-776.460) (-771.810) [-773.990] * (-777.732) (-772.677) [-771.364] (-773.008) -- 0:00:29
532000 -- (-774.833) (-774.485) [-773.715] (-770.803) * (-769.967) (-771.392) [-773.357] (-771.969) -- 0:00:29
532500 -- (-776.301) (-771.868) [-771.324] (-772.527) * (-770.563) [-772.520] (-774.742) (-772.868) -- 0:00:28
533000 -- [-770.779] (-770.181) (-770.228) (-772.501) * (-772.261) [-772.598] (-772.104) (-773.748) -- 0:00:28
533500 -- (-772.751) (-770.250) (-771.066) [-771.956] * (-770.763) (-770.944) (-770.314) [-773.886] -- 0:00:28
534000 -- (-773.390) (-771.340) (-771.480) [-771.439] * (-769.906) (-772.714) [-771.166] (-770.790) -- 0:00:28
534500 -- [-771.032] (-770.762) (-772.324) (-773.823) * (-772.066) (-771.550) (-773.060) [-773.198] -- 0:00:28
535000 -- (-771.005) [-770.291] (-773.574) (-774.048) * (-773.506) [-770.871] (-771.394) (-770.852) -- 0:00:28
Average standard deviation of split frequencies: 0.007450
535500 -- [-771.299] (-773.763) (-771.133) (-772.562) * (-774.525) [-771.412] (-774.044) (-770.823) -- 0:00:28
536000 -- (-772.534) (-773.732) [-769.941] (-773.482) * (-774.421) (-770.821) (-771.729) [-771.902] -- 0:00:28
536500 -- [-772.905] (-774.389) (-772.667) (-771.764) * [-776.960] (-771.879) (-776.235) (-771.652) -- 0:00:28
537000 -- (-773.230) [-770.217] (-770.851) (-772.925) * (-771.894) (-773.797) [-775.292] (-772.265) -- 0:00:28
537500 -- (-770.950) [-770.471] (-773.941) (-771.337) * [-772.183] (-772.517) (-778.801) (-775.872) -- 0:00:28
538000 -- (-774.814) [-770.360] (-775.342) (-773.026) * (-772.267) (-771.457) (-770.637) [-774.790] -- 0:00:28
538500 -- (-777.363) (-770.039) [-773.934] (-774.363) * [-769.642] (-772.389) (-770.663) (-774.399) -- 0:00:28
539000 -- (-779.761) (-771.854) (-772.628) [-771.316] * (-770.888) (-773.034) (-771.283) [-770.776] -- 0:00:28
539500 -- (-774.204) [-772.689] (-773.005) (-773.362) * (-776.686) (-771.661) (-771.553) [-773.549] -- 0:00:28
540000 -- [-771.000] (-773.968) (-773.015) (-771.739) * (-771.362) (-772.040) (-770.531) [-769.997] -- 0:00:28
Average standard deviation of split frequencies: 0.007796
540500 -- (-772.847) (-772.205) (-772.978) [-771.565] * (-773.239) (-771.390) [-770.592] (-771.454) -- 0:00:28
541000 -- (-771.225) [-774.442] (-772.424) (-770.433) * [-772.923] (-770.966) (-774.682) (-771.317) -- 0:00:28
541500 -- [-771.525] (-774.240) (-771.357) (-769.867) * [-772.141] (-771.494) (-770.960) (-771.560) -- 0:00:28
542000 -- [-771.520] (-776.337) (-774.641) (-772.921) * (-772.180) (-772.085) (-773.365) [-774.225] -- 0:00:28
542500 -- [-771.220] (-770.362) (-771.674) (-770.819) * (-771.392) [-774.548] (-770.928) (-770.718) -- 0:00:28
543000 -- [-773.103] (-771.686) (-771.390) (-771.805) * [-771.457] (-773.952) (-770.978) (-775.373) -- 0:00:28
543500 -- (-775.582) (-775.135) (-771.877) [-771.445] * [-774.529] (-770.337) (-775.921) (-770.515) -- 0:00:28
544000 -- (-776.028) (-772.433) [-772.583] (-773.609) * [-771.348] (-771.630) (-772.875) (-769.640) -- 0:00:28
544500 -- (-770.438) [-776.205] (-773.386) (-771.720) * [-771.306] (-774.351) (-775.087) (-775.019) -- 0:00:28
545000 -- (-772.492) (-775.894) (-771.238) [-771.881] * (-770.109) (-771.882) [-775.413] (-769.885) -- 0:00:28
Average standard deviation of split frequencies: 0.008442
545500 -- (-773.357) [-771.140] (-773.877) (-772.906) * (-772.389) [-771.364] (-774.789) (-770.156) -- 0:00:28
546000 -- (-771.944) (-770.083) (-773.092) [-772.224] * (-773.583) (-770.048) (-771.946) [-770.219] -- 0:00:28
546500 -- (-774.194) (-770.364) [-770.789] (-772.451) * (-771.186) [-770.450] (-771.053) (-772.700) -- 0:00:28
547000 -- (-771.221) (-776.413) [-772.244] (-771.245) * (-772.704) [-772.233] (-772.320) (-771.755) -- 0:00:28
547500 -- [-771.080] (-773.283) (-774.436) (-769.850) * (-772.181) (-774.706) [-771.008] (-771.274) -- 0:00:28
548000 -- [-774.645] (-770.282) (-771.783) (-772.036) * (-771.991) (-770.230) [-772.710] (-770.858) -- 0:00:28
548500 -- [-772.819] (-771.619) (-769.843) (-771.494) * (-771.345) [-770.991] (-773.173) (-770.548) -- 0:00:27
549000 -- (-771.600) [-772.858] (-774.270) (-776.074) * (-772.033) (-769.953) [-775.014] (-770.496) -- 0:00:27
549500 -- (-773.954) (-771.912) (-772.708) [-773.127] * [-770.070] (-773.866) (-770.592) (-770.436) -- 0:00:27
550000 -- [-773.150] (-778.519) (-774.743) (-770.564) * (-769.865) (-772.247) (-770.663) [-772.400] -- 0:00:27
Average standard deviation of split frequencies: 0.008513
550500 -- (-772.758) (-774.196) [-772.495] (-771.404) * (-773.346) (-772.198) [-771.278] (-775.439) -- 0:00:27
551000 -- (-772.499) [-775.248] (-773.023) (-774.963) * [-771.029] (-772.818) (-772.112) (-774.018) -- 0:00:27
551500 -- (-772.700) (-770.720) [-771.195] (-773.497) * (-774.035) [-772.438] (-770.694) (-773.418) -- 0:00:27
552000 -- (-772.504) (-774.171) [-770.689] (-773.397) * (-771.048) (-770.774) [-770.533] (-771.662) -- 0:00:27
552500 -- (-773.051) [-771.381] (-773.150) (-771.880) * (-770.752) (-771.138) [-770.311] (-773.184) -- 0:00:27
553000 -- (-773.973) (-771.551) (-774.498) [-772.233] * (-771.078) (-774.236) (-769.601) [-770.776] -- 0:00:27
553500 -- (-772.957) (-773.300) (-772.023) [-772.662] * (-769.750) (-774.459) [-772.021] (-770.688) -- 0:00:27
554000 -- (-772.983) (-773.532) [-771.508] (-770.860) * [-774.869] (-771.518) (-772.178) (-770.638) -- 0:00:27
554500 -- (-771.308) [-771.662] (-770.941) (-771.413) * (-772.103) (-772.342) (-771.192) [-770.260] -- 0:00:27
555000 -- (-770.564) [-772.826] (-770.672) (-771.962) * (-772.473) (-771.334) [-772.187] (-775.428) -- 0:00:27
Average standard deviation of split frequencies: 0.008526
555500 -- (-771.561) (-773.278) [-770.616] (-770.043) * (-771.888) (-772.465) (-772.709) [-773.179] -- 0:00:27
556000 -- (-771.918) [-772.067] (-769.785) (-773.863) * (-771.187) [-770.775] (-770.416) (-775.674) -- 0:00:27
556500 -- [-773.091] (-771.307) (-769.519) (-772.106) * (-775.572) [-773.026] (-770.170) (-774.338) -- 0:00:27
557000 -- (-770.578) (-773.728) (-769.575) [-770.917] * (-773.157) [-772.263] (-772.724) (-774.673) -- 0:00:27
557500 -- [-771.808] (-770.556) (-771.556) (-774.059) * [-770.240] (-773.258) (-776.118) (-770.517) -- 0:00:27
558000 -- (-771.037) (-771.716) (-771.715) [-772.926] * (-772.408) (-773.976) [-770.610] (-771.761) -- 0:00:27
558500 -- [-770.110] (-771.427) (-773.149) (-769.658) * [-774.374] (-772.710) (-770.098) (-772.252) -- 0:00:27
559000 -- (-769.986) [-772.612] (-773.495) (-771.401) * (-771.273) (-772.564) [-770.070] (-774.459) -- 0:00:27
559500 -- [-769.810] (-771.296) (-773.525) (-773.039) * [-770.225] (-775.175) (-771.577) (-774.293) -- 0:00:27
560000 -- (-772.034) [-771.993] (-770.377) (-771.673) * (-770.371) (-772.182) [-770.868] (-771.968) -- 0:00:27
Average standard deviation of split frequencies: 0.008804
560500 -- [-771.403] (-770.282) (-770.225) (-770.460) * (-771.732) (-770.056) [-770.935] (-773.083) -- 0:00:27
561000 -- (-773.124) (-772.653) (-770.721) [-773.653] * (-780.288) (-772.162) (-771.092) [-771.201] -- 0:00:27
561500 -- (-771.738) [-773.017] (-772.737) (-771.410) * (-775.230) (-775.511) [-771.090] (-772.046) -- 0:00:27
562000 -- (-772.236) (-770.647) (-771.952) [-770.905] * (-774.820) (-771.085) [-773.138] (-773.041) -- 0:00:27
562500 -- (-770.539) (-776.041) (-771.786) [-772.118] * (-771.285) (-771.688) (-771.225) [-774.370] -- 0:00:27
563000 -- (-771.751) [-771.119] (-771.814) (-771.329) * (-775.097) [-772.289] (-775.877) (-771.563) -- 0:00:27
563500 -- (-771.106) [-770.789] (-771.881) (-772.567) * (-770.342) [-771.166] (-776.101) (-770.495) -- 0:00:27
564000 -- (-772.941) (-773.669) (-772.010) [-770.816] * (-771.690) (-774.067) [-772.787] (-770.861) -- 0:00:27
564500 -- (-779.641) (-774.003) [-771.766] (-769.985) * (-770.975) [-771.465] (-770.537) (-772.756) -- 0:00:27
565000 -- (-772.276) (-773.542) (-771.588) [-770.379] * (-770.405) [-771.277] (-770.637) (-770.946) -- 0:00:26
Average standard deviation of split frequencies: 0.008574
565500 -- (-773.110) (-772.040) (-774.362) [-770.836] * (-771.259) [-770.599] (-773.590) (-770.592) -- 0:00:26
566000 -- [-770.929] (-776.436) (-770.830) (-770.519) * (-771.278) (-769.783) (-770.851) [-772.373] -- 0:00:26
566500 -- (-771.413) (-771.067) (-772.052) [-775.559] * [-771.597] (-771.280) (-770.768) (-769.951) -- 0:00:26
567000 -- [-774.098] (-772.599) (-772.811) (-772.107) * (-773.730) (-771.841) [-769.943] (-772.026) -- 0:00:26
567500 -- (-770.986) [-772.086] (-777.639) (-770.563) * [-771.827] (-771.751) (-771.950) (-769.856) -- 0:00:26
568000 -- (-771.853) [-772.362] (-771.469) (-771.746) * [-771.826] (-771.760) (-773.139) (-771.695) -- 0:00:26
568500 -- (-770.237) (-772.270) [-772.066] (-772.135) * (-771.617) (-770.059) [-771.953] (-770.623) -- 0:00:26
569000 -- [-772.888] (-775.799) (-774.354) (-771.090) * (-772.291) (-770.736) [-771.453] (-771.140) -- 0:00:26
569500 -- [-773.598] (-772.627) (-775.839) (-772.553) * (-772.315) (-770.404) (-769.911) [-772.595] -- 0:00:26
570000 -- (-772.744) (-771.109) [-775.062] (-779.697) * (-773.972) (-771.550) [-771.166] (-771.591) -- 0:00:26
Average standard deviation of split frequencies: 0.009138
570500 -- [-771.679] (-769.938) (-775.666) (-770.532) * (-772.804) (-772.062) [-772.721] (-772.667) -- 0:00:26
571000 -- [-773.650] (-771.153) (-773.652) (-770.829) * (-772.106) (-770.299) [-771.836] (-771.646) -- 0:00:26
571500 -- (-774.047) (-770.666) [-770.706] (-774.182) * (-772.162) [-771.454] (-776.098) (-777.265) -- 0:00:26
572000 -- (-770.824) [-770.296] (-772.705) (-776.957) * (-770.760) (-770.203) [-771.529] (-775.457) -- 0:00:26
572500 -- (-773.981) (-773.023) (-771.953) [-776.148] * [-770.349] (-772.679) (-773.016) (-773.473) -- 0:00:26
573000 -- [-772.339] (-776.074) (-772.286) (-770.435) * (-770.892) (-772.145) [-772.381] (-771.953) -- 0:00:26
573500 -- [-772.272] (-773.283) (-773.063) (-771.725) * (-770.634) (-772.464) (-771.989) [-773.232] -- 0:00:26
574000 -- (-770.672) [-770.502] (-770.800) (-772.558) * (-772.797) (-771.778) (-776.005) [-770.251] -- 0:00:26
574500 -- (-771.002) (-770.987) (-770.250) [-773.391] * (-773.876) (-772.929) [-775.149] (-770.203) -- 0:00:26
575000 -- [-776.430] (-770.684) (-776.171) (-772.799) * (-774.822) (-771.980) (-769.825) [-770.728] -- 0:00:26
Average standard deviation of split frequencies: 0.008389
575500 -- (-770.683) [-770.725] (-771.042) (-771.397) * [-775.600] (-773.330) (-772.261) (-770.379) -- 0:00:26
576000 -- (-770.797) (-772.541) (-771.599) [-771.339] * (-774.463) (-770.618) [-770.898] (-769.886) -- 0:00:26
576500 -- (-773.211) [-771.526] (-772.805) (-771.446) * (-771.327) [-770.913] (-770.778) (-770.492) -- 0:00:26
577000 -- (-773.506) (-770.426) (-771.052) [-771.314] * (-773.720) (-779.399) (-773.514) [-773.630] -- 0:00:26
577500 -- (-771.402) [-774.184] (-771.635) (-770.159) * (-775.874) [-773.385] (-773.750) (-775.133) -- 0:00:26
578000 -- [-771.762] (-773.283) (-772.417) (-769.939) * (-773.965) [-770.404] (-771.842) (-777.226) -- 0:00:26
578500 -- (-774.061) [-775.687] (-776.708) (-770.881) * (-774.611) (-771.041) [-772.569] (-771.158) -- 0:00:26
579000 -- (-772.996) (-772.375) (-772.749) [-770.914] * [-771.367] (-773.746) (-770.346) (-773.688) -- 0:00:26
579500 -- (-772.194) [-771.662] (-770.030) (-770.878) * [-772.020] (-774.044) (-771.209) (-771.859) -- 0:00:26
580000 -- (-773.498) (-772.750) (-770.033) [-770.327] * (-771.257) (-772.381) [-771.333] (-772.384) -- 0:00:26
Average standard deviation of split frequencies: 0.008169
580500 -- [-770.120] (-775.954) (-780.479) (-771.581) * (-770.887) (-772.523) (-773.378) [-772.039] -- 0:00:26
581000 -- (-770.785) [-770.346] (-771.369) (-773.855) * [-773.299] (-777.554) (-774.250) (-772.244) -- 0:00:25
581500 -- (-779.046) [-771.168] (-774.885) (-771.339) * (-774.068) (-770.419) (-771.001) [-772.350] -- 0:00:25
582000 -- (-774.219) (-771.365) (-772.153) [-772.491] * (-773.312) (-770.108) (-771.569) [-774.591] -- 0:00:25
582500 -- (-770.872) (-769.668) (-771.338) [-773.410] * (-771.420) (-772.317) (-770.965) [-771.628] -- 0:00:25
583000 -- [-770.612] (-771.705) (-772.072) (-775.399) * (-772.690) (-772.502) [-771.194] (-771.849) -- 0:00:25
583500 -- (-771.833) [-772.481] (-773.950) (-771.490) * (-773.889) (-772.295) [-769.987] (-772.329) -- 0:00:25
584000 -- (-772.562) (-775.864) [-772.067] (-773.402) * (-770.300) (-770.625) [-772.232] (-772.276) -- 0:00:25
584500 -- (-770.828) (-773.627) [-771.697] (-777.805) * [-771.840] (-770.899) (-770.167) (-776.681) -- 0:00:25
585000 -- (-772.415) (-771.803) (-771.533) [-772.376] * (-771.486) (-774.276) [-772.680] (-772.160) -- 0:00:25
Average standard deviation of split frequencies: 0.007843
585500 -- (-770.778) [-772.580] (-779.476) (-772.031) * (-772.724) (-771.725) (-771.358) [-771.628] -- 0:00:25
586000 -- [-771.289] (-770.140) (-770.793) (-771.780) * (-773.494) (-772.671) [-770.064] (-776.678) -- 0:00:25
586500 -- (-771.174) (-773.583) [-770.759] (-771.214) * (-774.820) (-772.675) (-772.359) [-771.062] -- 0:00:25
587000 -- [-770.665] (-774.088) (-774.357) (-770.607) * (-774.256) (-775.252) [-770.946] (-771.709) -- 0:00:25
587500 -- [-773.597] (-771.632) (-770.931) (-772.591) * (-773.243) [-770.149] (-772.570) (-778.674) -- 0:00:25
588000 -- (-771.316) [-773.448] (-769.621) (-774.160) * [-774.779] (-771.320) (-772.971) (-771.026) -- 0:00:25
588500 -- (-772.163) (-774.124) [-771.700] (-772.573) * [-775.817] (-771.031) (-772.099) (-771.878) -- 0:00:25
589000 -- (-772.136) (-773.824) [-773.076] (-771.671) * (-771.831) (-774.410) [-771.042] (-778.481) -- 0:00:25
589500 -- (-773.552) [-770.861] (-772.637) (-773.015) * (-769.970) (-769.887) (-773.585) [-774.085] -- 0:00:25
590000 -- [-772.268] (-772.127) (-776.393) (-772.301) * (-772.901) (-774.590) [-771.589] (-777.774) -- 0:00:25
Average standard deviation of split frequencies: 0.008430
590500 -- (-772.003) (-771.085) (-774.251) [-771.585] * (-772.488) [-773.738] (-770.638) (-773.589) -- 0:00:25
591000 -- (-774.891) (-773.017) [-770.582] (-771.177) * (-770.882) [-771.059] (-771.846) (-775.860) -- 0:00:25
591500 -- (-772.707) (-770.221) (-772.684) [-771.169] * (-773.234) (-772.393) [-769.945] (-774.613) -- 0:00:25
592000 -- (-770.545) (-772.143) (-770.893) [-771.602] * (-774.571) (-774.757) [-771.872] (-774.295) -- 0:00:25
592500 -- (-772.744) [-772.912] (-771.375) (-773.716) * (-771.304) (-771.660) [-769.796] (-775.856) -- 0:00:25
593000 -- [-774.210] (-771.391) (-770.446) (-772.479) * (-770.985) (-770.884) [-772.316] (-772.607) -- 0:00:25
593500 -- (-771.684) (-771.922) (-772.701) [-770.726] * (-771.503) [-771.177] (-770.287) (-773.729) -- 0:00:25
594000 -- (-772.771) (-771.356) (-775.412) [-770.546] * (-770.683) [-771.154] (-770.510) (-770.462) -- 0:00:25
594500 -- (-772.162) [-771.167] (-774.894) (-772.946) * (-770.170) (-771.866) (-777.006) [-770.641] -- 0:00:25
595000 -- (-775.620) [-771.113] (-770.594) (-770.963) * (-770.240) (-771.693) (-773.166) [-774.842] -- 0:00:25
Average standard deviation of split frequencies: 0.008700
595500 -- [-771.741] (-769.802) (-776.574) (-773.428) * (-773.529) [-771.391] (-771.389) (-772.476) -- 0:00:25
596000 -- (-770.658) (-769.593) [-772.330] (-775.396) * (-773.714) (-772.981) [-772.355] (-772.345) -- 0:00:25
596500 -- (-770.989) (-769.984) (-777.454) [-772.828] * (-774.090) (-774.231) (-771.612) [-771.007] -- 0:00:25
597000 -- (-774.160) (-771.370) (-773.496) [-772.706] * (-770.359) (-772.614) [-770.842] (-771.557) -- 0:00:24
597500 -- [-775.248] (-771.725) (-772.892) (-770.799) * (-770.754) (-772.761) (-771.504) [-769.872] -- 0:00:24
598000 -- [-773.016] (-771.896) (-774.944) (-772.205) * (-771.081) (-773.322) [-772.729] (-773.361) -- 0:00:24
598500 -- (-772.255) (-771.811) [-775.757] (-773.920) * (-771.509) (-772.790) [-771.188] (-771.887) -- 0:00:24
599000 -- (-769.894) (-770.892) [-770.690] (-773.301) * (-770.326) (-772.471) (-772.203) [-773.522] -- 0:00:24
599500 -- (-770.363) (-771.383) [-770.854] (-774.946) * (-773.516) [-771.599] (-771.564) (-774.358) -- 0:00:24
600000 -- (-772.562) [-770.757] (-772.909) (-772.881) * [-770.617] (-776.204) (-773.564) (-774.071) -- 0:00:24
Average standard deviation of split frequencies: 0.008731
600500 -- (-780.273) (-771.973) [-770.308] (-772.286) * (-770.530) (-772.086) [-777.883] (-772.105) -- 0:00:24
601000 -- (-774.985) (-770.794) (-770.829) [-770.416] * (-772.148) (-772.033) (-773.321) [-772.420] -- 0:00:24
601500 -- [-773.279] (-771.145) (-770.919) (-773.643) * (-770.215) (-774.375) (-771.438) [-774.441] -- 0:00:24
602000 -- (-771.937) (-771.331) (-771.880) [-771.299] * [-771.731] (-773.431) (-773.397) (-773.886) -- 0:00:24
602500 -- (-772.971) (-773.836) [-771.073] (-772.304) * [-773.440] (-773.362) (-770.265) (-778.460) -- 0:00:24
603000 -- (-772.428) [-771.193] (-770.236) (-770.512) * (-772.601) (-770.414) [-771.044] (-784.564) -- 0:00:24
603500 -- (-772.644) (-771.259) [-771.274] (-773.374) * (-774.508) (-770.898) (-771.235) [-773.945] -- 0:00:24
604000 -- (-771.035) (-770.473) (-770.921) [-772.933] * (-776.303) (-772.897) (-771.657) [-773.420] -- 0:00:24
604500 -- (-775.962) [-774.574] (-771.203) (-776.445) * (-772.292) [-772.285] (-770.711) (-770.791) -- 0:00:24
605000 -- (-772.649) (-771.922) (-771.354) [-772.015] * (-770.659) (-775.044) [-771.899] (-770.042) -- 0:00:24
Average standard deviation of split frequencies: 0.008119
605500 -- (-775.841) [-771.921] (-770.549) (-779.004) * [-769.994] (-774.605) (-776.476) (-773.398) -- 0:00:24
606000 -- (-769.929) (-772.425) [-772.512] (-776.044) * (-771.631) (-774.534) [-773.197] (-774.260) -- 0:00:24
606500 -- (-772.251) [-771.872] (-771.482) (-778.238) * (-775.443) [-771.189] (-771.151) (-772.947) -- 0:00:24
607000 -- (-771.138) (-772.131) [-771.027] (-775.522) * (-773.789) (-774.835) (-770.088) [-770.367] -- 0:00:24
607500 -- (-774.410) (-770.777) [-775.673] (-771.924) * (-773.418) (-775.244) [-773.915] (-770.866) -- 0:00:24
608000 -- (-773.841) (-772.867) (-772.723) [-771.405] * (-770.106) (-772.649) [-771.096] (-771.610) -- 0:00:24
608500 -- [-771.321] (-771.719) (-772.271) (-770.549) * (-772.202) [-770.673] (-772.874) (-771.309) -- 0:00:24
609000 -- (-770.676) (-771.562) (-772.499) [-770.145] * (-772.723) (-772.218) (-770.282) [-771.937] -- 0:00:24
609500 -- (-770.684) (-771.492) [-770.802] (-773.828) * (-776.134) (-771.851) [-771.296] (-774.028) -- 0:00:24
610000 -- (-772.716) (-771.973) [-771.916] (-771.794) * (-777.786) (-771.179) [-769.843] (-774.351) -- 0:00:24
Average standard deviation of split frequencies: 0.008684
610500 -- (-774.761) [-772.971] (-770.274) (-770.661) * (-773.774) (-773.451) [-772.432] (-772.695) -- 0:00:24
611000 -- (-771.621) (-775.786) [-774.355] (-771.865) * (-771.829) (-771.405) (-771.859) [-771.995] -- 0:00:24
611500 -- (-770.920) (-772.321) [-775.238] (-771.456) * (-770.838) [-770.198] (-771.244) (-771.192) -- 0:00:24
612000 -- (-769.794) [-775.943] (-775.648) (-770.569) * (-770.653) (-770.904) (-774.586) [-771.842] -- 0:00:24
612500 -- [-774.101] (-771.543) (-774.233) (-771.337) * [-774.064] (-770.585) (-774.577) (-780.867) -- 0:00:24
613000 -- (-771.305) [-770.092] (-771.799) (-770.899) * (-773.285) [-770.204] (-772.100) (-772.332) -- 0:00:23
613500 -- (-770.462) [-771.235] (-771.241) (-771.551) * [-771.941] (-771.416) (-771.421) (-770.129) -- 0:00:23
614000 -- (-772.630) (-770.371) (-776.180) [-771.669] * (-774.659) (-773.632) [-771.289] (-771.345) -- 0:00:23
614500 -- (-771.952) (-770.573) (-770.538) [-774.818] * [-771.891] (-772.446) (-771.242) (-771.659) -- 0:00:23
615000 -- (-773.257) [-770.852] (-771.582) (-772.592) * (-771.457) (-774.746) [-771.650] (-776.604) -- 0:00:23
Average standard deviation of split frequencies: 0.008848
615500 -- (-771.768) (-770.222) (-770.986) [-775.611] * (-772.498) (-780.390) [-773.228] (-772.144) -- 0:00:23
616000 -- (-771.561) [-770.937] (-770.526) (-772.202) * [-771.862] (-774.574) (-771.188) (-771.030) -- 0:00:23
616500 -- [-772.222] (-771.621) (-770.965) (-771.543) * (-770.592) (-772.497) [-770.481] (-772.489) -- 0:00:23
617000 -- (-773.211) (-773.977) (-770.873) [-772.721] * (-772.638) (-771.803) (-773.382) [-770.359] -- 0:00:23
617500 -- [-770.218] (-771.936) (-779.128) (-770.607) * [-771.604] (-771.688) (-771.430) (-772.153) -- 0:00:23
618000 -- [-773.591] (-772.374) (-771.370) (-771.368) * [-773.539] (-769.827) (-772.104) (-769.813) -- 0:00:23
618500 -- [-771.598] (-770.506) (-772.065) (-772.175) * (-777.864) (-770.325) [-770.354] (-770.032) -- 0:00:23
619000 -- (-776.093) (-771.317) (-771.874) [-772.899] * [-770.310] (-770.131) (-770.394) (-772.995) -- 0:00:23
619500 -- (-770.851) (-772.498) [-771.180] (-778.748) * (-770.017) (-772.419) (-773.355) [-772.395] -- 0:00:23
620000 -- (-770.589) (-772.041) (-770.874) [-772.369] * [-771.188] (-779.539) (-773.023) (-774.202) -- 0:00:23
Average standard deviation of split frequencies: 0.008687
620500 -- (-776.129) (-771.633) [-771.536] (-772.327) * (-771.994) (-770.780) [-772.783] (-773.198) -- 0:00:23
621000 -- (-779.889) (-774.628) [-770.278] (-772.641) * (-772.041) (-769.902) [-771.598] (-774.185) -- 0:00:23
621500 -- (-775.083) [-771.334] (-771.437) (-773.183) * [-771.401] (-771.236) (-770.990) (-774.971) -- 0:00:23
622000 -- [-770.391] (-773.549) (-771.826) (-771.651) * (-771.063) [-770.275] (-770.114) (-770.643) -- 0:00:23
622500 -- (-772.656) (-774.837) (-771.855) [-770.038] * (-771.700) [-771.958] (-770.932) (-771.740) -- 0:00:23
623000 -- (-774.404) [-773.369] (-770.219) (-771.413) * (-771.139) (-775.825) [-770.018] (-773.335) -- 0:00:22
623500 -- (-772.670) (-774.445) (-770.473) [-770.586] * (-772.028) (-774.837) [-770.874] (-771.313) -- 0:00:23
624000 -- (-772.975) (-771.186) [-771.725] (-770.395) * (-772.639) (-776.345) (-769.996) [-771.323] -- 0:00:23
624500 -- (-769.963) (-771.221) [-771.203] (-770.458) * [-770.671] (-773.767) (-771.653) (-771.657) -- 0:00:23
625000 -- (-771.310) (-773.972) [-773.458] (-776.514) * (-770.755) (-773.305) [-773.114] (-773.288) -- 0:00:23
Average standard deviation of split frequencies: 0.008331
625500 -- [-771.919] (-774.514) (-771.985) (-770.003) * [-770.129] (-775.071) (-772.198) (-772.673) -- 0:00:23
626000 -- (-772.104) [-774.175] (-771.522) (-771.837) * [-771.581] (-770.435) (-772.481) (-774.994) -- 0:00:23
626500 -- (-773.365) (-772.953) (-769.793) [-769.790] * (-771.204) (-770.507) [-772.004] (-771.148) -- 0:00:23
627000 -- (-777.237) (-772.519) [-771.807] (-770.129) * (-771.438) (-773.651) [-771.415] (-770.769) -- 0:00:23
627500 -- (-773.467) (-773.243) [-773.119] (-771.645) * (-771.791) (-776.211) [-770.383] (-771.750) -- 0:00:23
628000 -- (-774.608) (-771.181) (-772.517) [-771.858] * (-771.851) [-770.920] (-770.655) (-770.208) -- 0:00:23
628500 -- (-772.972) (-770.182) [-771.657] (-770.504) * (-770.055) (-773.535) [-771.994] (-772.152) -- 0:00:23
629000 -- (-771.114) (-771.111) (-773.337) [-771.966] * (-772.832) (-773.040) [-773.837] (-773.915) -- 0:00:23
629500 -- (-771.462) [-773.443] (-770.297) (-770.353) * (-771.784) (-772.840) (-770.915) [-775.219] -- 0:00:22
630000 -- (-770.005) [-771.016] (-776.087) (-770.408) * (-772.607) [-779.539] (-773.203) (-773.942) -- 0:00:22
Average standard deviation of split frequencies: 0.008129
630500 -- [-770.252] (-771.671) (-772.695) (-772.763) * (-771.990) (-772.483) (-772.649) [-772.272] -- 0:00:22
631000 -- (-770.763) (-770.772) [-770.216] (-775.187) * (-774.017) (-772.798) [-770.273] (-770.501) -- 0:00:22
631500 -- (-771.127) (-771.864) (-770.129) [-773.560] * (-772.055) (-771.600) (-770.884) [-770.988] -- 0:00:22
632000 -- (-772.101) [-772.923] (-770.949) (-770.274) * (-771.627) [-773.400] (-770.194) (-771.410) -- 0:00:22
632500 -- [-771.786] (-772.986) (-770.800) (-771.456) * (-769.844) (-771.344) [-771.513] (-772.236) -- 0:00:22
633000 -- [-773.237] (-772.543) (-769.958) (-772.643) * [-772.399] (-770.805) (-773.106) (-770.321) -- 0:00:22
633500 -- (-770.275) (-772.413) [-769.991] (-772.562) * (-772.194) (-770.682) (-771.748) [-770.676] -- 0:00:22
634000 -- (-770.182) (-773.024) (-770.235) [-773.817] * [-772.053] (-770.362) (-774.045) (-772.839) -- 0:00:22
634500 -- (-770.285) [-771.870] (-770.928) (-770.883) * (-775.617) [-773.674] (-776.854) (-773.632) -- 0:00:22
635000 -- (-769.775) [-770.782] (-771.124) (-772.021) * (-771.825) [-772.510] (-771.691) (-772.057) -- 0:00:22
Average standard deviation of split frequencies: 0.007644
635500 -- (-770.186) [-769.717] (-770.887) (-772.689) * (-771.646) (-773.363) [-774.597] (-772.473) -- 0:00:22
636000 -- (-770.468) [-773.009] (-771.386) (-774.707) * (-771.562) (-773.597) [-770.498] (-771.549) -- 0:00:22
636500 -- (-770.200) (-771.474) (-773.970) [-770.793] * (-771.697) [-771.869] (-770.314) (-770.603) -- 0:00:22
637000 -- (-771.479) (-772.873) [-769.942] (-774.443) * (-773.564) [-772.349] (-770.036) (-772.223) -- 0:00:22
637500 -- (-772.074) (-771.625) [-770.900] (-770.444) * (-774.296) [-771.064] (-770.305) (-771.365) -- 0:00:22
638000 -- (-771.335) [-771.574] (-770.357) (-770.680) * (-774.411) (-769.988) (-772.086) [-770.911] -- 0:00:22
638500 -- [-771.042] (-777.266) (-771.923) (-770.944) * (-774.437) (-772.047) (-771.764) [-769.897] -- 0:00:22
639000 -- (-770.867) [-772.672] (-774.522) (-770.457) * (-770.319) (-770.442) [-771.908] (-777.179) -- 0:00:22
639500 -- (-770.889) (-773.884) [-773.142] (-773.831) * (-770.338) (-770.438) [-769.924] (-775.728) -- 0:00:21
640000 -- (-774.255) [-772.933] (-773.414) (-775.978) * (-771.078) (-772.274) (-770.000) [-773.540] -- 0:00:21
Average standard deviation of split frequencies: 0.008094
640500 -- (-771.940) [-773.228] (-772.467) (-772.497) * [-770.572] (-772.238) (-773.985) (-776.995) -- 0:00:22
641000 -- (-769.950) (-773.382) (-771.421) [-772.108] * (-771.737) (-776.631) (-773.682) [-773.150] -- 0:00:22
641500 -- (-770.945) [-771.240] (-773.853) (-773.692) * (-771.632) (-771.958) [-773.777] (-774.214) -- 0:00:22
642000 -- [-770.621] (-771.899) (-781.559) (-773.394) * (-771.476) (-774.232) [-771.774] (-771.841) -- 0:00:22
642500 -- [-771.683] (-774.876) (-771.232) (-772.199) * (-773.226) (-770.364) (-771.361) [-773.460] -- 0:00:22
643000 -- (-770.239) (-775.037) [-772.979] (-774.358) * [-770.691] (-773.006) (-772.698) (-773.371) -- 0:00:22
643500 -- (-770.668) [-770.745] (-770.418) (-770.111) * (-771.934) (-774.809) (-770.870) [-771.565] -- 0:00:22
644000 -- [-772.692] (-771.904) (-771.269) (-769.926) * [-772.910] (-769.907) (-770.873) (-771.256) -- 0:00:22
644500 -- (-774.828) [-773.343] (-773.401) (-770.552) * (-773.876) [-771.364] (-771.189) (-771.703) -- 0:00:22
645000 -- (-772.891) (-772.888) (-770.863) [-774.304] * [-773.777] (-770.398) (-773.103) (-771.728) -- 0:00:22
Average standard deviation of split frequencies: 0.008437
645500 -- (-770.871) [-773.749] (-773.234) (-773.123) * (-773.093) (-775.252) (-773.196) [-770.680] -- 0:00:21
646000 -- (-770.860) [-771.221] (-770.458) (-773.904) * (-771.831) (-776.778) (-772.235) [-772.660] -- 0:00:21
646500 -- (-770.234) [-774.128] (-771.244) (-771.123) * (-771.702) (-775.547) [-771.103] (-772.660) -- 0:00:21
647000 -- (-780.879) [-770.533] (-769.888) (-770.676) * [-771.669] (-773.801) (-772.743) (-774.792) -- 0:00:21
647500 -- [-776.920] (-770.071) (-779.509) (-774.382) * [-771.680] (-773.619) (-773.206) (-772.470) -- 0:00:21
648000 -- (-771.776) [-770.627] (-773.104) (-777.129) * (-772.613) (-773.739) (-777.576) [-772.738] -- 0:00:21
648500 -- [-772.226] (-771.222) (-775.207) (-772.348) * (-774.878) (-777.170) (-772.169) [-771.741] -- 0:00:21
649000 -- (-770.996) [-771.758] (-774.597) (-771.292) * (-774.372) (-774.532) [-774.264] (-772.351) -- 0:00:21
649500 -- (-773.448) (-771.486) [-771.374] (-771.950) * [-775.241] (-773.652) (-772.188) (-771.521) -- 0:00:21
650000 -- (-772.218) [-771.287] (-770.511) (-771.324) * (-772.770) (-773.317) (-771.593) [-770.357] -- 0:00:21
Average standard deviation of split frequencies: 0.008558
650500 -- (-776.843) [-773.048] (-772.834) (-771.082) * (-772.212) [-770.230] (-774.714) (-770.499) -- 0:00:21
651000 -- [-770.500] (-775.380) (-774.485) (-774.461) * (-771.701) [-771.902] (-776.616) (-772.008) -- 0:00:21
651500 -- (-770.375) [-775.169] (-770.818) (-770.907) * [-771.183] (-771.061) (-770.572) (-772.353) -- 0:00:21
652000 -- (-773.886) [-774.252] (-771.182) (-774.658) * [-771.168] (-771.745) (-770.038) (-771.238) -- 0:00:21
652500 -- (-770.344) (-775.323) (-770.842) [-773.261] * (-772.674) (-771.705) [-770.000] (-770.805) -- 0:00:21
653000 -- (-771.424) (-771.040) (-771.798) [-771.657] * (-773.531) [-770.915] (-770.215) (-772.361) -- 0:00:21
653500 -- [-769.908] (-773.335) (-771.277) (-771.062) * (-770.758) (-774.242) [-774.565] (-770.760) -- 0:00:21
654000 -- (-769.584) [-771.585] (-770.956) (-769.574) * [-769.744] (-774.121) (-770.438) (-772.773) -- 0:00:21
654500 -- (-772.358) (-779.087) (-775.388) [-770.805] * (-771.208) (-771.271) (-772.973) [-772.385] -- 0:00:21
655000 -- (-772.333) (-777.673) [-771.161] (-770.153) * [-771.051] (-771.080) (-771.055) (-771.762) -- 0:00:21
Average standard deviation of split frequencies: 0.008489
655500 -- [-772.542] (-772.891) (-770.622) (-770.575) * (-773.437) [-772.425] (-771.087) (-774.907) -- 0:00:21
656000 -- (-773.131) (-772.859) (-770.625) [-769.997] * [-771.658] (-770.567) (-771.999) (-775.047) -- 0:00:20
656500 -- [-770.561] (-770.275) (-772.812) (-769.968) * [-771.996] (-770.726) (-773.111) (-770.674) -- 0:00:21
657000 -- (-770.748) (-770.182) (-772.160) [-769.726] * [-771.304] (-770.763) (-771.338) (-770.715) -- 0:00:21
657500 -- [-774.014] (-772.377) (-770.058) (-769.727) * (-771.785) [-772.242] (-770.173) (-770.542) -- 0:00:21
658000 -- (-772.333) (-775.950) [-770.016] (-771.805) * (-771.385) [-771.473] (-769.611) (-771.978) -- 0:00:21
658500 -- (-772.314) [-775.848] (-771.541) (-771.472) * [-771.085] (-771.833) (-771.075) (-771.770) -- 0:00:21
659000 -- (-773.834) (-770.913) (-772.514) [-771.930] * [-772.504] (-770.544) (-774.353) (-770.823) -- 0:00:21
659500 -- (-772.717) (-771.827) [-771.865] (-773.506) * (-776.447) (-770.138) [-773.478] (-772.124) -- 0:00:21
660000 -- [-770.387] (-772.592) (-772.176) (-772.345) * [-770.378] (-773.160) (-772.688) (-773.849) -- 0:00:21
Average standard deviation of split frequencies: 0.007983
660500 -- [-770.867] (-771.746) (-773.963) (-771.257) * (-771.560) (-775.313) (-771.509) [-771.630] -- 0:00:21
661000 -- [-770.729] (-772.449) (-772.877) (-770.923) * (-771.761) (-778.681) [-771.410] (-772.592) -- 0:00:21
661500 -- (-772.337) (-770.700) (-769.664) [-770.781] * [-771.617] (-772.800) (-770.801) (-772.186) -- 0:00:20
662000 -- (-770.277) (-771.980) [-770.904] (-771.569) * (-772.950) (-771.563) (-771.056) [-770.472] -- 0:00:20
662500 -- (-771.900) [-773.440] (-771.828) (-769.774) * (-771.808) [-773.344] (-773.814) (-775.457) -- 0:00:20
663000 -- (-774.779) (-772.554) (-769.944) [-773.050] * (-770.889) [-773.452] (-775.459) (-773.209) -- 0:00:20
663500 -- (-771.314) (-771.382) [-776.738] (-776.366) * [-770.672] (-772.661) (-772.873) (-772.773) -- 0:00:20
664000 -- (-772.969) (-772.287) [-772.532] (-772.687) * (-771.314) (-773.963) (-772.935) [-774.410] -- 0:00:20
664500 -- [-772.785] (-771.632) (-770.502) (-773.293) * (-771.622) (-771.525) (-770.047) [-772.242] -- 0:00:20
665000 -- (-777.792) (-769.807) [-771.991] (-771.130) * [-771.298] (-773.303) (-776.845) (-770.060) -- 0:00:20
Average standard deviation of split frequencies: 0.008273
665500 -- [-772.427] (-772.363) (-773.908) (-772.855) * (-770.217) (-774.363) [-771.219] (-771.005) -- 0:00:20
666000 -- [-774.416] (-775.797) (-772.883) (-771.849) * [-771.118] (-777.118) (-777.976) (-771.038) -- 0:00:20
666500 -- (-774.126) (-778.505) [-772.425] (-770.962) * [-772.902] (-779.802) (-770.871) (-771.407) -- 0:00:20
667000 -- (-771.101) (-770.926) (-774.178) [-770.691] * (-773.857) (-778.449) (-773.334) [-771.337] -- 0:00:20
667500 -- (-771.810) (-778.067) (-771.037) [-773.464] * [-771.902] (-772.201) (-774.898) (-772.405) -- 0:00:20
668000 -- (-772.838) (-771.003) [-773.190] (-771.364) * (-770.946) [-771.433] (-773.548) (-771.661) -- 0:00:20
668500 -- (-774.942) (-770.585) [-773.137] (-772.525) * (-772.978) (-774.538) (-770.627) [-771.022] -- 0:00:20
669000 -- [-772.385] (-771.815) (-771.463) (-773.759) * (-774.880) [-774.498] (-778.432) (-771.999) -- 0:00:20
669500 -- (-770.267) (-774.672) [-772.047] (-771.674) * (-772.268) (-774.324) [-774.073] (-775.585) -- 0:00:20
670000 -- (-774.388) [-771.221] (-775.934) (-771.226) * (-771.905) [-772.544] (-771.710) (-772.455) -- 0:00:20
Average standard deviation of split frequencies: 0.008479
670500 -- [-771.804] (-772.412) (-774.788) (-771.048) * (-774.983) (-771.660) (-771.941) [-770.661] -- 0:00:20
671000 -- (-770.982) (-771.440) [-773.193] (-771.275) * (-774.859) (-771.614) (-771.360) [-774.504] -- 0:00:20
671500 -- (-771.460) (-771.655) [-770.572] (-771.602) * (-771.849) [-771.360] (-773.700) (-773.648) -- 0:00:20
672000 -- (-771.344) (-772.974) [-771.479] (-773.588) * (-772.676) [-772.706] (-770.246) (-774.424) -- 0:00:20
672500 -- (-771.055) (-771.776) (-771.922) [-772.865] * (-770.887) (-771.908) [-770.333] (-776.114) -- 0:00:19
673000 -- [-771.357] (-771.296) (-771.942) (-777.713) * (-773.459) (-776.193) [-774.231] (-778.183) -- 0:00:19
673500 -- [-772.255] (-773.164) (-770.551) (-770.806) * [-771.195] (-773.866) (-776.219) (-771.688) -- 0:00:20
674000 -- (-770.792) [-771.839] (-773.504) (-774.884) * (-774.100) [-771.205] (-774.299) (-776.009) -- 0:00:20
674500 -- (-773.811) (-773.184) (-773.600) [-773.273] * (-771.217) [-771.746] (-772.135) (-771.456) -- 0:00:20
675000 -- (-771.104) (-773.803) (-771.707) [-770.906] * (-770.624) (-772.827) [-770.809] (-771.386) -- 0:00:20
Average standard deviation of split frequencies: 0.008150
675500 -- (-770.472) [-774.401] (-773.572) (-771.158) * (-771.147) (-774.252) (-771.898) [-770.281] -- 0:00:20
676000 -- (-770.717) [-771.403] (-779.786) (-770.865) * [-772.666] (-777.320) (-771.488) (-770.735) -- 0:00:20
676500 -- (-770.517) (-770.538) [-773.823] (-772.818) * (-775.325) (-772.690) [-771.306] (-771.661) -- 0:00:20
677000 -- (-770.976) (-770.153) (-772.783) [-770.424] * (-773.146) (-771.129) [-773.736] (-770.549) -- 0:00:20
677500 -- (-770.679) (-771.306) (-770.857) [-771.718] * (-773.539) (-775.351) [-772.958] (-770.177) -- 0:00:19
678000 -- [-772.779] (-772.543) (-775.739) (-772.716) * (-773.214) (-771.474) (-774.666) [-770.180] -- 0:00:19
678500 -- (-770.345) [-770.955] (-770.817) (-773.010) * (-771.945) (-772.838) [-770.739] (-770.735) -- 0:00:19
679000 -- (-770.763) (-770.327) (-772.068) [-772.321] * [-772.956] (-773.963) (-771.835) (-772.750) -- 0:00:19
679500 -- (-771.076) (-770.312) (-773.053) [-773.215] * (-777.210) (-772.624) [-770.807] (-771.484) -- 0:00:19
680000 -- (-774.194) (-771.088) (-770.265) [-770.360] * (-773.163) (-772.416) [-773.113] (-773.530) -- 0:00:19
Average standard deviation of split frequencies: 0.008441
680500 -- (-776.108) (-771.410) (-773.371) [-772.660] * (-770.704) [-771.224] (-771.985) (-770.887) -- 0:00:19
681000 -- (-772.969) (-773.085) [-771.515] (-776.348) * (-773.237) (-779.078) (-775.717) [-770.686] -- 0:00:19
681500 -- [-770.340] (-772.142) (-773.363) (-772.052) * [-775.049] (-772.639) (-773.319) (-771.319) -- 0:00:19
682000 -- (-770.488) [-770.860] (-775.863) (-772.241) * (-773.518) (-773.318) (-772.422) [-769.815] -- 0:00:19
682500 -- [-771.153] (-771.887) (-773.671) (-772.306) * (-769.796) (-773.197) (-770.310) [-769.690] -- 0:00:19
683000 -- (-774.184) (-772.072) (-774.440) [-770.693] * (-770.061) [-776.942] (-776.647) (-771.426) -- 0:00:19
683500 -- (-771.355) [-771.076] (-772.356) (-772.046) * (-771.759) [-772.665] (-771.178) (-775.931) -- 0:00:19
684000 -- (-774.003) (-770.353) [-769.698] (-772.354) * [-771.729] (-775.405) (-773.305) (-769.959) -- 0:00:19
684500 -- (-771.877) [-771.704] (-772.597) (-774.059) * (-772.415) (-771.850) [-770.828] (-774.282) -- 0:00:19
685000 -- (-772.130) [-770.614] (-770.621) (-775.425) * [-771.156] (-771.022) (-770.935) (-771.034) -- 0:00:19
Average standard deviation of split frequencies: 0.008160
685500 -- (-773.616) (-773.616) (-771.791) [-772.229] * (-770.743) [-772.262] (-771.211) (-772.065) -- 0:00:19
686000 -- (-773.443) (-773.209) (-772.601) [-772.486] * (-772.939) (-779.246) (-770.138) [-773.101] -- 0:00:19
686500 -- (-771.684) (-772.316) (-774.184) [-773.648] * (-773.076) [-773.873] (-771.548) (-771.288) -- 0:00:19
687000 -- (-772.431) [-774.836] (-772.780) (-772.483) * (-770.258) [-770.780] (-770.815) (-771.344) -- 0:00:19
687500 -- (-773.352) [-771.596] (-771.263) (-776.260) * (-769.828) (-773.705) (-777.581) [-773.185] -- 0:00:19
688000 -- (-774.875) (-771.775) [-771.510] (-772.267) * (-773.539) (-771.162) (-771.854) [-770.101] -- 0:00:19
688500 -- [-774.089] (-771.309) (-770.362) (-774.393) * [-770.586] (-771.116) (-776.595) (-769.676) -- 0:00:19
689000 -- [-771.440] (-772.167) (-773.244) (-772.258) * (-771.862) (-771.159) [-773.175] (-773.450) -- 0:00:18
689500 -- (-771.958) (-774.035) [-770.168] (-775.048) * (-774.235) (-770.761) (-772.296) [-772.023] -- 0:00:18
690000 -- [-772.957] (-776.187) (-771.344) (-771.911) * (-771.635) (-773.704) (-774.246) [-770.853] -- 0:00:18
Average standard deviation of split frequencies: 0.008276
690500 -- [-772.008] (-774.760) (-772.046) (-772.453) * (-772.762) [-770.498] (-773.261) (-770.627) -- 0:00:19
691000 -- (-771.052) (-774.494) [-771.865] (-773.656) * (-770.757) (-775.380) (-771.834) [-770.202] -- 0:00:19
691500 -- (-772.304) [-774.539] (-775.455) (-774.478) * (-770.681) [-771.310] (-775.433) (-775.099) -- 0:00:19
692000 -- (-775.079) (-773.312) (-771.609) [-771.832] * (-774.828) (-772.485) (-769.866) [-773.247] -- 0:00:19
692500 -- (-774.722) [-775.328] (-771.613) (-774.503) * [-771.193] (-770.847) (-774.519) (-774.456) -- 0:00:19
693000 -- (-775.779) (-773.894) [-771.922] (-771.694) * [-771.790] (-770.212) (-772.491) (-772.305) -- 0:00:19
693500 -- (-770.793) [-777.418] (-775.044) (-771.636) * [-771.014] (-773.034) (-771.035) (-772.734) -- 0:00:19
694000 -- (-770.992) (-772.998) [-776.668] (-769.806) * (-771.025) (-773.300) (-771.041) [-770.278] -- 0:00:18
694500 -- (-770.224) (-772.339) (-773.888) [-770.172] * (-770.190) (-770.809) [-771.871] (-774.091) -- 0:00:18
695000 -- (-772.152) [-772.363] (-779.596) (-770.430) * (-770.258) (-774.875) (-771.238) [-771.957] -- 0:00:18
Average standard deviation of split frequencies: 0.007947
695500 -- (-770.957) [-771.041] (-777.182) (-770.338) * [-770.448] (-777.313) (-771.914) (-772.294) -- 0:00:18
696000 -- (-770.480) (-771.163) (-770.366) [-770.631] * (-770.323) (-775.043) (-771.507) [-772.495] -- 0:00:18
696500 -- (-770.981) [-773.277] (-773.060) (-772.603) * [-770.533] (-774.395) (-774.191) (-772.999) -- 0:00:18
697000 -- (-769.571) (-771.797) [-770.588] (-771.344) * (-771.376) [-771.467] (-781.327) (-771.519) -- 0:00:18
697500 -- (-778.569) [-770.218] (-770.462) (-770.313) * (-772.294) [-772.161] (-780.073) (-773.082) -- 0:00:18
698000 -- (-782.859) [-771.651] (-770.371) (-774.352) * (-772.929) (-770.767) [-774.463] (-775.175) -- 0:00:18
698500 -- (-775.731) [-776.115] (-770.886) (-772.710) * [-772.147] (-772.677) (-771.109) (-771.334) -- 0:00:18
699000 -- (-780.834) (-772.061) (-771.659) [-771.473] * [-772.048] (-772.202) (-770.897) (-770.716) -- 0:00:18
699500 -- (-770.494) (-771.813) (-770.659) [-773.142] * (-772.604) (-770.120) [-770.254] (-774.020) -- 0:00:18
700000 -- (-772.072) (-772.533) (-773.029) [-773.850] * (-776.059) (-770.409) [-771.023] (-771.557) -- 0:00:18
Average standard deviation of split frequencies: 0.007984
700500 -- (-770.947) [-770.689] (-771.441) (-770.186) * [-770.991] (-770.526) (-770.461) (-773.476) -- 0:00:18
701000 -- (-772.591) (-770.845) (-771.655) [-770.937] * [-771.497] (-771.555) (-772.421) (-771.559) -- 0:00:18
701500 -- (-771.629) (-770.791) [-771.007] (-770.553) * [-771.018] (-770.043) (-771.465) (-774.656) -- 0:00:18
702000 -- (-773.106) (-772.542) [-771.600] (-774.557) * [-773.194] (-772.174) (-771.499) (-774.239) -- 0:00:18
702500 -- (-773.259) (-773.069) [-770.778] (-773.112) * (-772.517) [-771.863] (-772.518) (-775.097) -- 0:00:18
703000 -- (-773.051) [-771.720] (-770.242) (-773.025) * (-771.640) (-774.341) (-770.644) [-773.172] -- 0:00:18
703500 -- (-775.704) (-771.685) (-771.122) [-772.933] * [-772.701] (-770.334) (-775.757) (-773.176) -- 0:00:18
704000 -- [-772.360] (-778.475) (-770.065) (-771.919) * (-770.141) (-774.205) (-778.402) [-771.696] -- 0:00:18
704500 -- (-778.992) [-772.456] (-770.400) (-770.974) * (-770.635) (-772.327) (-770.194) [-772.370] -- 0:00:18
705000 -- [-778.868] (-770.964) (-770.752) (-773.223) * (-772.266) (-772.038) (-777.790) [-773.315] -- 0:00:17
Average standard deviation of split frequencies: 0.008369
705500 -- (-771.321) [-777.465] (-771.953) (-770.783) * (-774.208) (-774.353) (-770.472) [-771.502] -- 0:00:17
706000 -- (-772.553) [-769.980] (-773.447) (-771.325) * (-773.475) (-774.844) (-770.856) [-771.740] -- 0:00:17
706500 -- (-772.984) (-772.383) (-769.871) [-771.436] * (-771.884) (-770.981) [-770.641] (-770.313) -- 0:00:17
707000 -- (-770.636) (-772.287) (-774.338) [-770.659] * (-771.686) [-770.694] (-771.932) (-770.546) -- 0:00:18
707500 -- (-773.076) [-771.427] (-775.131) (-772.731) * [-770.002] (-772.002) (-772.801) (-773.347) -- 0:00:18
708000 -- (-770.593) (-771.511) (-772.686) [-771.883] * (-771.957) [-771.729] (-772.424) (-774.833) -- 0:00:18
708500 -- (-769.941) [-770.459] (-771.378) (-771.481) * (-771.508) (-772.629) (-772.566) [-770.711] -- 0:00:18
709000 -- (-770.383) (-772.245) (-772.533) [-772.053] * (-771.369) [-771.739] (-770.868) (-771.130) -- 0:00:18
709500 -- (-773.030) (-773.749) (-772.788) [-770.868] * [-771.971] (-772.126) (-773.231) (-771.657) -- 0:00:18
710000 -- (-771.330) [-770.562] (-773.934) (-770.438) * [-771.519] (-774.473) (-770.802) (-770.737) -- 0:00:17
Average standard deviation of split frequencies: 0.008004
710500 -- (-771.216) [-774.489] (-775.589) (-769.704) * (-778.280) [-771.579] (-772.297) (-771.255) -- 0:00:17
711000 -- (-772.271) (-773.047) (-776.143) [-773.514] * [-774.885] (-773.128) (-771.946) (-771.581) -- 0:00:17
711500 -- (-771.556) [-773.477] (-776.819) (-771.791) * (-774.922) [-772.463] (-771.130) (-771.193) -- 0:00:17
712000 -- (-773.528) (-771.867) (-770.839) [-772.639] * (-773.614) [-770.713] (-770.596) (-771.134) -- 0:00:17
712500 -- (-772.880) (-774.851) [-772.446] (-773.196) * (-771.813) (-772.314) (-773.302) [-772.254] -- 0:00:17
713000 -- (-779.391) [-771.595] (-773.594) (-774.524) * (-775.354) (-770.506) [-774.110] (-771.846) -- 0:00:17
713500 -- (-774.329) (-773.630) (-770.114) [-770.921] * (-771.430) [-770.180] (-771.782) (-770.152) -- 0:00:17
714000 -- [-771.588] (-771.759) (-770.046) (-774.719) * [-770.740] (-772.291) (-771.086) (-771.328) -- 0:00:17
714500 -- (-771.310) (-770.404) (-770.189) [-772.233] * (-773.894) [-772.746] (-771.563) (-770.034) -- 0:00:17
715000 -- (-771.876) [-771.431] (-773.908) (-774.045) * (-771.411) [-770.181] (-774.546) (-770.268) -- 0:00:17
Average standard deviation of split frequencies: 0.008383
715500 -- (-771.974) [-770.845] (-773.904) (-771.468) * [-771.130] (-774.871) (-770.982) (-770.245) -- 0:00:17
716000 -- (-771.052) (-770.863) (-774.153) [-770.195] * [-772.362] (-772.411) (-770.567) (-771.212) -- 0:00:17
716500 -- [-771.821] (-771.780) (-776.289) (-770.491) * (-771.071) (-775.796) (-773.681) [-772.036] -- 0:00:17
717000 -- (-772.789) (-770.929) [-774.357] (-771.494) * (-774.794) [-771.415] (-772.419) (-772.059) -- 0:00:17
717500 -- (-773.707) (-771.607) (-773.194) [-770.283] * [-771.722] (-771.716) (-779.302) (-774.901) -- 0:00:17
718000 -- (-771.862) (-773.120) [-771.274] (-772.744) * (-770.261) [-772.208] (-771.026) (-773.879) -- 0:00:17
718500 -- (-770.752) (-770.609) (-772.955) [-770.590] * [-771.259] (-771.223) (-771.300) (-771.209) -- 0:00:17
719000 -- (-770.627) (-773.576) (-771.587) [-770.688] * (-773.047) (-771.087) [-771.257] (-772.987) -- 0:00:17
719500 -- (-773.573) (-774.952) [-770.233] (-773.444) * [-773.210] (-772.167) (-771.797) (-770.582) -- 0:00:17
720000 -- (-770.902) (-777.146) [-772.037] (-775.885) * [-773.765] (-770.223) (-775.236) (-773.711) -- 0:00:17
Average standard deviation of split frequencies: 0.008504
720500 -- (-771.477) [-774.945] (-772.118) (-775.197) * [-770.622] (-775.835) (-772.730) (-773.221) -- 0:00:17
721000 -- (-773.721) [-772.357] (-774.103) (-773.861) * (-770.445) (-773.825) [-772.916] (-771.477) -- 0:00:17
721500 -- (-769.689) (-775.721) [-771.229] (-776.096) * (-775.039) (-772.662) (-772.840) [-772.030] -- 0:00:16
722000 -- (-769.985) (-771.292) [-770.567] (-772.103) * (-772.589) [-770.426] (-771.311) (-771.468) -- 0:00:16
722500 -- (-773.743) (-770.233) [-770.873] (-772.486) * (-774.749) [-770.704] (-771.712) (-770.373) -- 0:00:16
723000 -- [-771.386] (-771.402) (-770.000) (-775.715) * [-772.741] (-772.559) (-769.938) (-770.785) -- 0:00:16
723500 -- [-773.582] (-775.679) (-773.302) (-774.333) * (-772.460) (-771.659) (-770.778) [-769.792] -- 0:00:17
724000 -- (-771.008) [-771.836] (-772.261) (-772.853) * (-771.764) (-772.134) (-774.979) [-774.982] -- 0:00:17
724500 -- [-771.524] (-771.282) (-771.258) (-770.402) * (-778.204) [-773.913] (-772.853) (-773.190) -- 0:00:17
725000 -- (-779.013) (-772.026) [-770.750] (-770.764) * (-770.395) (-772.004) (-772.642) [-774.012] -- 0:00:17
Average standard deviation of split frequencies: 0.008787
725500 -- (-771.773) (-775.314) [-772.424] (-769.803) * (-772.214) (-778.252) [-776.099] (-775.731) -- 0:00:17
726000 -- (-773.418) [-770.536] (-770.846) (-770.513) * [-770.807] (-771.778) (-770.961) (-775.330) -- 0:00:16
726500 -- (-770.864) [-770.539] (-773.626) (-770.510) * (-770.588) [-770.022] (-772.651) (-773.692) -- 0:00:16
727000 -- (-773.293) [-776.847] (-774.983) (-771.439) * (-771.669) (-771.775) [-772.701] (-775.955) -- 0:00:16
727500 -- (-778.409) (-771.770) [-771.456] (-771.550) * (-771.526) (-770.760) [-772.820] (-775.956) -- 0:00:16
728000 -- (-771.936) (-770.869) (-773.267) [-774.671] * [-774.733] (-772.975) (-774.342) (-774.077) -- 0:00:16
728500 -- [-770.877] (-772.023) (-771.725) (-770.985) * (-774.575) (-777.737) (-774.181) [-773.257] -- 0:00:16
729000 -- (-771.291) [-775.521] (-772.842) (-770.517) * [-772.074] (-770.154) (-770.161) (-774.105) -- 0:00:16
729500 -- (-772.365) (-778.309) [-774.158] (-775.518) * [-772.162] (-771.004) (-770.700) (-774.385) -- 0:00:16
730000 -- (-770.112) [-771.821] (-771.443) (-773.257) * (-776.127) (-771.483) (-771.592) [-772.528] -- 0:00:16
Average standard deviation of split frequencies: 0.008602
730500 -- [-770.756] (-772.346) (-774.183) (-769.936) * [-770.902] (-772.291) (-774.266) (-772.563) -- 0:00:16
731000 -- (-770.429) [-772.172] (-775.020) (-769.943) * (-771.649) (-770.620) [-770.285] (-778.344) -- 0:00:16
731500 -- (-772.308) (-772.657) (-771.572) [-769.966] * [-772.852] (-771.087) (-771.179) (-777.959) -- 0:00:16
732000 -- (-776.114) (-771.435) [-771.338] (-771.878) * (-771.134) (-775.780) [-771.080] (-771.160) -- 0:00:16
732500 -- [-774.823] (-775.599) (-772.188) (-770.952) * (-771.553) (-773.658) (-771.633) [-770.736] -- 0:00:16
733000 -- (-773.855) (-771.799) (-772.291) [-772.439] * [-773.395] (-772.308) (-773.229) (-771.570) -- 0:00:16
733500 -- (-773.490) (-771.690) [-775.348] (-770.927) * (-770.207) [-771.001] (-771.645) (-771.937) -- 0:00:16
734000 -- (-771.107) [-771.831] (-773.624) (-771.540) * [-774.719] (-774.954) (-771.035) (-772.729) -- 0:00:16
734500 -- (-772.444) (-774.023) [-773.694] (-772.186) * (-770.258) (-772.185) [-771.912] (-773.105) -- 0:00:16
735000 -- (-771.797) (-776.124) (-774.608) [-772.148] * (-770.530) (-770.066) (-772.574) [-770.018] -- 0:00:16
Average standard deviation of split frequencies: 0.008668
735500 -- (-773.682) (-774.898) (-773.889) [-771.789] * (-769.823) (-770.215) [-772.140] (-771.304) -- 0:00:16
736000 -- (-772.742) (-774.102) [-771.367] (-772.021) * [-772.005] (-771.598) (-772.917) (-771.142) -- 0:00:16
736500 -- (-772.315) (-770.513) (-771.183) [-770.999] * (-772.846) (-770.067) (-776.234) [-771.824] -- 0:00:16
737000 -- (-771.726) (-771.191) (-770.948) [-773.692] * (-771.181) (-769.561) [-777.398] (-773.634) -- 0:00:16
737500 -- (-771.620) [-771.561] (-773.185) (-777.100) * (-770.091) (-770.984) [-771.798] (-771.923) -- 0:00:16
738000 -- (-771.399) [-771.142] (-773.549) (-775.323) * (-773.363) (-772.907) [-771.556] (-773.415) -- 0:00:15
738500 -- (-770.899) (-770.706) [-770.247] (-772.186) * [-771.274] (-773.157) (-772.589) (-773.986) -- 0:00:15
739000 -- [-773.490] (-772.515) (-770.207) (-772.155) * (-771.825) [-770.730] (-770.956) (-773.425) -- 0:00:15
739500 -- (-775.432) [-771.293] (-770.100) (-771.938) * (-770.385) (-776.772) (-771.376) [-771.197] -- 0:00:15
740000 -- (-771.311) (-774.259) [-770.398] (-770.747) * (-770.383) [-777.186] (-772.049) (-771.455) -- 0:00:15
Average standard deviation of split frequencies: 0.008529
740500 -- (-770.617) [-774.754] (-771.435) (-770.630) * [-769.838] (-775.076) (-771.435) (-776.271) -- 0:00:16
741000 -- (-772.084) (-774.178) [-772.071] (-771.133) * [-772.072] (-773.173) (-775.998) (-772.187) -- 0:00:16
741500 -- (-770.782) (-773.532) [-772.434] (-771.487) * (-770.450) [-770.960] (-773.366) (-771.878) -- 0:00:16
742000 -- (-775.984) (-774.636) (-773.189) [-773.283] * (-771.490) (-777.735) (-773.265) [-771.352] -- 0:00:15
742500 -- [-770.773] (-770.453) (-772.264) (-776.044) * [-772.919] (-773.971) (-772.491) (-772.316) -- 0:00:15
743000 -- [-773.643] (-771.843) (-773.482) (-773.972) * (-770.565) [-773.354] (-772.267) (-770.395) -- 0:00:15
743500 -- (-772.466) (-779.051) [-774.544] (-773.355) * [-771.165] (-775.765) (-775.318) (-772.288) -- 0:00:15
744000 -- (-770.728) (-770.059) [-772.381] (-770.549) * (-771.199) (-771.498) (-775.464) [-772.198] -- 0:00:15
744500 -- (-771.916) (-772.987) (-773.771) [-773.095] * (-771.051) (-771.250) [-770.398] (-772.710) -- 0:00:15
745000 -- (-771.796) (-770.604) (-772.528) [-771.694] * (-770.734) [-771.470] (-770.196) (-774.729) -- 0:00:15
Average standard deviation of split frequencies: 0.008636
745500 -- (-773.178) [-770.780] (-771.081) (-771.211) * [-770.903] (-770.701) (-773.076) (-775.844) -- 0:00:15
746000 -- (-773.098) (-773.021) (-772.043) [-770.713] * [-770.458] (-771.258) (-772.735) (-771.240) -- 0:00:15
746500 -- [-773.138] (-772.046) (-773.209) (-771.205) * [-770.654] (-772.511) (-770.942) (-774.134) -- 0:00:15
747000 -- (-771.633) (-772.046) (-773.699) [-771.296] * (-771.269) [-771.197] (-771.752) (-775.973) -- 0:00:15
747500 -- (-774.450) [-770.421] (-772.019) (-773.337) * (-774.085) [-772.126] (-772.034) (-773.218) -- 0:00:15
748000 -- (-772.033) (-770.766) (-771.539) [-774.981] * [-772.458] (-772.936) (-770.596) (-776.807) -- 0:00:15
748500 -- (-771.334) [-770.479] (-772.468) (-772.189) * (-771.510) (-772.206) (-771.047) [-771.158] -- 0:00:15
749000 -- (-770.634) (-770.518) (-770.650) [-777.461] * (-771.652) (-769.987) (-772.697) [-771.739] -- 0:00:15
749500 -- (-770.301) [-769.964] (-778.367) (-772.941) * (-776.096) (-771.538) (-773.821) [-770.373] -- 0:00:15
750000 -- (-771.407) [-770.237] (-772.475) (-775.052) * [-772.438] (-770.728) (-776.233) (-773.449) -- 0:00:15
Average standard deviation of split frequencies: 0.008247
750500 -- (-776.259) [-770.676] (-773.563) (-774.734) * (-771.723) (-773.567) (-773.867) [-769.756] -- 0:00:15
751000 -- (-775.434) [-772.009] (-770.008) (-770.564) * (-771.246) (-772.121) [-771.499] (-773.220) -- 0:00:15
751500 -- (-773.305) (-773.484) [-770.199] (-772.797) * (-770.129) (-774.627) [-770.631] (-770.804) -- 0:00:15
752000 -- (-771.898) (-773.096) (-770.480) [-775.330] * (-771.820) (-775.103) [-771.059] (-772.837) -- 0:00:15
752500 -- (-772.038) (-776.728) [-770.573] (-772.392) * [-774.558] (-774.569) (-771.233) (-775.808) -- 0:00:15
753000 -- (-772.263) (-774.116) (-771.620) [-770.365] * (-772.624) [-772.995] (-773.871) (-775.670) -- 0:00:15
753500 -- [-773.351] (-769.949) (-771.323) (-772.615) * [-775.198] (-771.083) (-777.481) (-770.788) -- 0:00:15
754000 -- (-774.338) (-776.191) (-770.074) [-772.392] * (-773.459) (-771.512) [-774.885] (-774.736) -- 0:00:15
754500 -- (-774.995) [-773.674] (-770.218) (-772.945) * (-770.703) (-772.944) [-771.182] (-774.688) -- 0:00:14
755000 -- (-774.273) (-773.862) [-769.953] (-771.803) * (-775.875) (-771.063) [-770.614] (-774.333) -- 0:00:14
Average standard deviation of split frequencies: 0.007940
755500 -- (-772.002) [-770.284] (-771.694) (-771.354) * (-771.383) (-771.986) [-770.084] (-774.344) -- 0:00:14
756000 -- [-773.162] (-769.952) (-770.881) (-771.683) * (-772.641) (-771.184) [-775.583] (-770.851) -- 0:00:14
756500 -- (-775.908) (-772.432) (-771.867) [-772.166] * (-772.163) (-775.230) (-771.977) [-770.269] -- 0:00:14
757000 -- [-771.181] (-771.630) (-772.046) (-771.054) * (-774.149) [-770.648] (-772.534) (-770.275) -- 0:00:14
757500 -- [-770.878] (-776.691) (-771.489) (-771.174) * [-773.249] (-772.059) (-770.372) (-772.280) -- 0:00:15
758000 -- [-773.003] (-772.166) (-772.190) (-772.270) * (-777.061) (-770.821) [-770.995] (-771.015) -- 0:00:15
758500 -- (-776.466) (-770.951) [-770.604] (-771.076) * (-773.768) (-773.808) [-771.405] (-770.934) -- 0:00:14
759000 -- [-771.123] (-769.672) (-774.316) (-774.492) * (-772.949) (-772.758) (-772.690) [-770.916] -- 0:00:14
759500 -- (-770.170) (-771.289) (-771.306) [-769.899] * (-773.037) (-769.985) (-770.284) [-770.981] -- 0:00:14
760000 -- (-771.550) (-772.654) (-771.201) [-770.544] * [-773.211] (-770.896) (-772.146) (-771.599) -- 0:00:14
Average standard deviation of split frequencies: 0.007891
760500 -- (-772.930) (-771.163) (-772.858) [-771.996] * (-770.988) (-769.964) (-774.340) [-775.524] -- 0:00:14
761000 -- (-770.958) [-769.721] (-772.225) (-772.058) * [-772.623] (-770.876) (-772.297) (-775.638) -- 0:00:14
761500 -- (-774.637) (-771.949) [-774.276] (-770.943) * (-772.475) [-773.670] (-775.408) (-771.645) -- 0:00:14
762000 -- (-771.860) (-772.111) (-771.013) [-770.126] * (-778.117) (-770.274) (-773.474) [-770.891] -- 0:00:14
762500 -- (-769.751) (-772.627) [-773.051] (-776.200) * (-777.247) (-772.388) [-773.400] (-774.210) -- 0:00:14
763000 -- [-770.582] (-774.485) (-770.964) (-772.622) * (-772.365) [-769.684] (-772.293) (-773.401) -- 0:00:14
763500 -- (-770.581) (-771.713) (-776.714) [-771.361] * [-771.489] (-770.788) (-772.539) (-775.712) -- 0:00:14
764000 -- (-770.556) (-773.264) (-776.415) [-772.035] * [-771.455] (-770.756) (-771.448) (-773.246) -- 0:00:14
764500 -- (-772.408) [-774.578] (-771.460) (-775.109) * [-774.111] (-772.434) (-777.601) (-774.207) -- 0:00:14
765000 -- (-772.031) [-771.016] (-774.420) (-774.209) * (-780.072) (-771.450) (-776.396) [-775.591] -- 0:00:14
Average standard deviation of split frequencies: 0.007467
765500 -- (-770.243) [-771.987] (-771.152) (-770.623) * (-773.660) [-775.194] (-771.205) (-776.779) -- 0:00:14
766000 -- (-776.093) [-772.130] (-769.791) (-770.303) * (-772.162) [-773.571] (-770.844) (-772.326) -- 0:00:14
766500 -- (-779.035) (-770.425) (-771.363) [-770.767] * (-771.718) (-771.599) (-770.773) [-772.303] -- 0:00:14
767000 -- (-772.903) (-772.738) (-770.870) [-770.389] * (-773.961) (-771.990) [-772.087] (-770.712) -- 0:00:14
767500 -- (-770.830) (-770.253) [-779.564] (-770.105) * [-772.520] (-770.921) (-775.082) (-771.158) -- 0:00:14
768000 -- [-770.667] (-774.777) (-775.126) (-771.907) * (-770.307) (-772.403) (-771.495) [-770.892] -- 0:00:14
768500 -- [-773.053] (-770.479) (-772.643) (-769.811) * [-770.307] (-772.259) (-772.173) (-771.369) -- 0:00:14
769000 -- [-771.060] (-772.494) (-771.226) (-770.094) * (-770.389) [-770.648] (-771.837) (-771.868) -- 0:00:14
769500 -- [-772.058] (-771.585) (-772.751) (-773.701) * (-772.003) (-774.480) [-770.501] (-770.754) -- 0:00:14
770000 -- (-772.815) (-774.966) (-773.095) [-780.570] * [-771.032] (-775.828) (-772.192) (-772.839) -- 0:00:14
Average standard deviation of split frequencies: 0.007422
770500 -- [-772.684] (-774.619) (-773.778) (-777.499) * (-771.569) (-770.607) [-770.834] (-770.285) -- 0:00:13
771000 -- (-772.777) (-772.187) [-771.501] (-771.604) * (-770.168) (-769.874) [-775.484] (-771.766) -- 0:00:13
771500 -- [-773.389] (-771.989) (-771.394) (-770.012) * [-770.668] (-770.901) (-773.684) (-770.917) -- 0:00:13
772000 -- (-774.398) (-771.003) (-770.457) [-770.569] * (-773.659) (-771.692) [-773.229] (-770.800) -- 0:00:13
772500 -- (-772.610) [-771.331] (-774.232) (-772.776) * (-774.066) (-771.548) (-772.716) [-773.451] -- 0:00:13
773000 -- [-771.653] (-770.949) (-775.687) (-771.221) * (-770.533) (-770.708) [-775.292] (-775.002) -- 0:00:13
773500 -- (-772.097) (-772.860) [-773.098] (-772.733) * (-774.901) (-771.016) (-771.411) [-770.994] -- 0:00:13
774000 -- (-772.106) [-772.419] (-770.593) (-772.660) * (-779.049) (-772.636) (-770.123) [-773.660] -- 0:00:14
774500 -- [-770.182] (-770.925) (-774.317) (-772.365) * (-771.869) [-773.556] (-771.196) (-774.602) -- 0:00:13
775000 -- (-774.007) (-773.508) [-771.131] (-772.010) * (-770.166) (-770.790) (-777.782) [-771.368] -- 0:00:13
Average standard deviation of split frequencies: 0.007452
775500 -- (-775.430) (-775.556) [-771.449] (-772.848) * [-770.712] (-770.995) (-773.592) (-770.037) -- 0:00:13
776000 -- (-772.869) (-770.441) (-773.045) [-770.892] * (-773.240) (-771.869) (-772.157) [-771.559] -- 0:00:13
776500 -- (-770.134) (-772.887) [-772.352] (-771.089) * (-773.743) [-772.643] (-772.094) (-773.044) -- 0:00:13
777000 -- (-769.805) (-772.660) [-774.843] (-772.217) * [-772.746] (-772.323) (-772.155) (-771.686) -- 0:00:13
777500 -- [-771.575] (-769.948) (-771.183) (-776.570) * [-771.983] (-773.266) (-773.497) (-773.122) -- 0:00:13
778000 -- [-771.657] (-771.630) (-771.188) (-772.644) * (-771.360) (-772.974) (-774.132) [-772.990] -- 0:00:13
778500 -- [-771.657] (-776.502) (-773.674) (-772.153) * (-773.236) [-770.282] (-771.536) (-773.373) -- 0:00:13
779000 -- (-771.303) [-772.366] (-774.043) (-771.358) * (-771.418) [-771.293] (-771.390) (-771.730) -- 0:00:13
779500 -- (-779.413) (-773.398) [-770.646] (-771.755) * [-770.374] (-770.300) (-771.377) (-771.926) -- 0:00:13
780000 -- [-773.695] (-772.424) (-774.014) (-770.460) * [-770.405] (-770.863) (-773.955) (-772.427) -- 0:00:13
Average standard deviation of split frequencies: 0.007206
780500 -- [-773.687] (-774.313) (-772.022) (-773.524) * (-770.158) [-770.606] (-771.776) (-773.191) -- 0:00:13
781000 -- (-769.973) (-769.963) [-773.765] (-771.952) * (-775.037) (-770.685) (-773.027) [-772.796] -- 0:00:13
781500 -- [-769.696] (-772.152) (-770.840) (-773.733) * (-772.611) (-775.634) (-776.306) [-772.557] -- 0:00:13
782000 -- (-773.925) [-775.948] (-770.687) (-773.346) * (-772.818) (-771.997) (-773.068) [-770.081] -- 0:00:13
782500 -- (-772.317) (-771.606) (-772.300) [-773.377] * (-771.260) [-770.341] (-773.551) (-772.346) -- 0:00:13
783000 -- (-771.695) (-771.974) [-772.572] (-772.247) * (-770.769) [-774.200] (-778.049) (-772.752) -- 0:00:13
783500 -- (-771.670) (-772.440) [-770.459] (-771.035) * [-772.749] (-771.674) (-771.259) (-774.364) -- 0:00:13
784000 -- (-774.182) (-774.213) [-772.469] (-770.949) * (-771.698) [-771.536] (-772.171) (-770.634) -- 0:00:13
784500 -- (-770.703) (-771.892) [-770.649] (-771.597) * (-772.078) (-772.743) (-771.344) [-772.218] -- 0:00:13
785000 -- [-771.214] (-774.867) (-774.486) (-772.595) * [-772.216] (-774.980) (-773.320) (-774.887) -- 0:00:13
Average standard deviation of split frequencies: 0.007197
785500 -- [-771.687] (-770.286) (-770.401) (-772.567) * (-770.440) (-773.350) (-773.118) [-772.144] -- 0:00:13
786000 -- (-771.098) (-772.332) (-770.838) [-772.404] * (-770.172) [-771.653] (-771.697) (-771.716) -- 0:00:13
786500 -- (-771.943) [-770.818] (-773.496) (-770.823) * (-771.029) (-774.523) (-773.421) [-773.700] -- 0:00:13
787000 -- (-772.461) (-773.502) (-772.422) [-772.238] * [-772.581] (-775.011) (-774.914) (-778.227) -- 0:00:12
787500 -- (-770.997) (-773.748) (-771.700) [-772.208] * (-770.880) (-772.621) [-772.059] (-771.774) -- 0:00:12
788000 -- (-771.278) (-772.171) (-772.791) [-770.297] * (-773.204) [-770.876] (-773.068) (-770.085) -- 0:00:12
788500 -- (-772.976) [-772.829] (-771.721) (-773.437) * (-771.251) (-773.355) (-776.896) [-771.478] -- 0:00:12
789000 -- (-772.402) (-772.507) (-770.842) [-770.353] * (-772.121) [-772.753] (-770.488) (-773.146) -- 0:00:12
789500 -- (-773.622) [-771.062] (-772.090) (-774.577) * (-770.475) [-772.364] (-772.488) (-771.795) -- 0:00:12
790000 -- [-771.613] (-771.570) (-772.598) (-773.025) * [-770.376] (-773.678) (-770.403) (-771.357) -- 0:00:12
Average standard deviation of split frequencies: 0.007552
790500 -- (-770.857) (-775.406) [-771.065] (-770.378) * [-771.445] (-770.670) (-771.841) (-772.824) -- 0:00:12
791000 -- (-773.768) (-772.430) [-772.439] (-774.477) * (-774.798) (-771.270) (-770.137) [-770.568] -- 0:00:12
791500 -- (-772.311) (-772.288) (-771.882) [-772.862] * (-771.077) (-773.724) (-772.033) [-770.727] -- 0:00:12
792000 -- (-773.408) [-771.906] (-771.018) (-771.214) * [-771.793] (-771.538) (-773.630) (-773.147) -- 0:00:12
792500 -- [-770.573] (-771.495) (-770.098) (-772.614) * [-770.213] (-771.086) (-772.332) (-771.750) -- 0:00:12
793000 -- (-771.676) (-771.205) [-770.705] (-772.624) * [-769.730] (-773.667) (-772.168) (-771.411) -- 0:00:12
793500 -- (-776.886) (-772.211) [-769.986] (-772.643) * (-772.603) (-773.831) [-770.256] (-770.204) -- 0:00:12
794000 -- [-774.694] (-771.311) (-772.595) (-771.787) * (-771.500) (-772.595) (-770.555) [-771.147] -- 0:00:12
794500 -- [-771.742] (-771.008) (-771.809) (-770.673) * [-772.282] (-770.695) (-770.513) (-771.779) -- 0:00:12
795000 -- (-773.694) (-771.070) [-770.120] (-771.372) * (-771.603) (-774.942) (-771.236) [-772.778] -- 0:00:12
Average standard deviation of split frequencies: 0.007225
795500 -- (-777.215) [-770.648] (-774.985) (-772.715) * (-770.247) [-771.032] (-772.487) (-770.448) -- 0:00:12
796000 -- (-772.535) (-772.610) [-771.515] (-771.906) * [-772.298] (-773.563) (-772.685) (-775.240) -- 0:00:12
796500 -- (-771.275) (-771.831) (-771.285) [-771.836] * (-777.122) (-772.232) (-771.888) [-774.558] -- 0:00:12
797000 -- (-775.708) (-774.096) (-770.753) [-770.106] * (-773.063) (-774.518) [-772.162] (-773.436) -- 0:00:12
797500 -- (-771.603) [-770.743] (-771.084) (-772.928) * (-770.773) [-772.800] (-772.489) (-770.430) -- 0:00:12
798000 -- (-771.192) (-771.809) (-771.368) [-770.883] * (-776.331) [-770.179] (-772.785) (-773.506) -- 0:00:12
798500 -- (-771.608) (-771.355) [-775.156] (-772.804) * [-771.790] (-770.582) (-773.502) (-771.336) -- 0:00:12
799000 -- (-770.212) (-770.065) (-772.082) [-770.740] * (-772.506) [-770.234] (-771.957) (-769.578) -- 0:00:12
799500 -- (-772.263) (-770.520) (-771.453) [-772.359] * [-770.373] (-771.553) (-771.757) (-770.082) -- 0:00:12
800000 -- (-771.349) (-771.324) [-774.449] (-771.426) * (-771.765) (-771.662) [-772.185] (-776.002) -- 0:00:12
Average standard deviation of split frequencies: 0.006987
800500 -- (-769.941) (-775.459) [-774.116] (-773.276) * [-772.340] (-771.603) (-773.041) (-772.184) -- 0:00:12
801000 -- (-770.332) (-769.964) (-773.525) [-770.635] * (-772.869) (-770.800) (-771.740) [-771.393] -- 0:00:12
801500 -- (-771.330) [-771.175] (-773.163) (-772.008) * (-772.388) (-773.840) [-771.648] (-770.526) -- 0:00:12
802000 -- (-769.966) [-770.677] (-773.474) (-777.156) * (-772.287) (-771.602) [-771.142] (-772.120) -- 0:00:12
802500 -- (-774.776) (-772.179) (-771.199) [-773.386] * [-770.025] (-771.509) (-773.771) (-770.603) -- 0:00:12
803000 -- (-772.473) (-770.808) [-770.375] (-771.615) * (-771.557) (-774.169) (-770.773) [-769.937] -- 0:00:12
803500 -- (-772.450) [-773.457] (-772.510) (-772.145) * (-771.112) [-771.495] (-770.323) (-770.261) -- 0:00:11
804000 -- [-769.929] (-775.531) (-773.166) (-771.645) * (-772.274) (-770.970) [-771.512] (-771.670) -- 0:00:11
804500 -- (-771.200) (-771.755) [-771.292] (-772.813) * (-772.080) (-770.744) (-771.015) [-771.792] -- 0:00:11
805000 -- (-773.020) (-775.203) (-770.887) [-771.186] * (-771.834) (-770.717) (-772.532) [-772.384] -- 0:00:11
Average standard deviation of split frequencies: 0.007213
805500 -- (-773.648) (-773.208) (-773.603) [-771.652] * (-772.009) [-770.493] (-771.232) (-771.830) -- 0:00:11
806000 -- (-772.288) (-770.124) [-771.429] (-771.530) * (-770.988) (-772.512) (-773.351) [-772.508] -- 0:00:11
806500 -- (-774.944) (-771.336) [-770.266] (-774.720) * (-773.894) [-771.115] (-771.395) (-773.341) -- 0:00:11
807000 -- (-771.213) (-771.162) [-770.001] (-773.392) * (-776.572) (-775.444) [-773.861] (-773.209) -- 0:00:11
807500 -- (-770.644) (-771.897) (-774.057) [-772.851] * (-771.073) [-771.362] (-774.402) (-770.282) -- 0:00:11
808000 -- [-773.660] (-770.580) (-771.580) (-772.599) * (-771.208) [-772.944] (-772.648) (-770.762) -- 0:00:11
808500 -- (-774.657) [-769.986] (-771.902) (-773.611) * (-774.561) (-772.191) (-772.860) [-770.797] -- 0:00:11
809000 -- (-776.269) (-770.501) (-771.568) [-771.984] * (-772.496) (-771.922) (-773.259) [-773.416] -- 0:00:11
809500 -- [-772.430] (-770.502) (-777.149) (-772.043) * (-774.312) [-774.823] (-771.253) (-771.133) -- 0:00:11
810000 -- (-772.692) [-770.782] (-778.468) (-772.599) * (-772.282) (-771.493) [-772.662] (-771.260) -- 0:00:11
Average standard deviation of split frequencies: 0.007366
810500 -- (-775.366) (-770.173) (-776.474) [-770.835] * (-775.942) [-774.993] (-777.999) (-776.984) -- 0:00:11
811000 -- (-770.787) [-771.268] (-774.949) (-770.845) * (-772.585) (-776.463) [-770.747] (-771.491) -- 0:00:11
811500 -- [-770.305] (-773.513) (-773.219) (-770.612) * (-772.867) [-775.753] (-770.302) (-771.677) -- 0:00:11
812000 -- (-770.520) (-774.497) (-776.946) [-771.485] * (-772.443) [-774.625] (-771.733) (-770.587) -- 0:00:11
812500 -- (-770.142) (-774.213) [-771.479] (-771.888) * [-770.413] (-770.450) (-775.052) (-770.732) -- 0:00:11
813000 -- [-770.011] (-773.655) (-771.486) (-776.848) * (-772.262) (-775.023) [-771.937] (-770.699) -- 0:00:11
813500 -- (-774.038) (-772.568) [-770.284] (-772.176) * (-772.209) (-773.603) (-770.741) [-772.199] -- 0:00:11
814000 -- [-772.549] (-774.159) (-770.296) (-771.843) * (-772.614) (-773.216) [-772.446] (-776.082) -- 0:00:11
814500 -- [-774.512] (-773.975) (-773.098) (-770.602) * (-773.477) (-771.950) [-770.926] (-775.356) -- 0:00:11
815000 -- [-771.339] (-774.959) (-776.043) (-770.075) * (-770.018) (-775.472) [-770.638] (-774.821) -- 0:00:11
Average standard deviation of split frequencies: 0.007356
815500 -- (-771.559) (-770.595) (-770.503) [-770.136] * (-771.065) [-774.593] (-773.576) (-771.846) -- 0:00:11
816000 -- (-774.565) (-770.400) (-770.647) [-771.586] * (-774.603) (-770.710) (-776.116) [-770.781] -- 0:00:11
816500 -- (-775.202) [-771.942] (-772.974) (-773.081) * [-779.054] (-770.536) (-774.814) (-776.042) -- 0:00:11
817000 -- (-773.552) [-772.498] (-773.937) (-771.118) * (-773.520) [-774.381] (-777.473) (-770.696) -- 0:00:11
817500 -- (-772.462) [-774.476] (-771.839) (-771.570) * (-770.939) (-771.063) (-775.464) [-771.476] -- 0:00:11
818000 -- (-775.144) (-771.298) (-774.611) [-772.217] * (-770.991) (-771.929) (-772.099) [-773.679] -- 0:00:11
818500 -- (-771.005) (-772.137) [-771.153] (-771.835) * (-772.892) (-771.806) (-771.781) [-770.661] -- 0:00:11
819000 -- (-770.498) [-772.474] (-770.463) (-776.465) * (-771.183) (-771.794) (-775.149) [-770.808] -- 0:00:11
819500 -- (-772.293) (-773.106) (-770.294) [-771.184] * [-772.556] (-771.264) (-772.448) (-771.742) -- 0:00:11
820000 -- (-771.708) (-770.954) (-770.185) [-770.938] * (-772.229) [-770.417] (-771.188) (-773.113) -- 0:00:10
Average standard deviation of split frequencies: 0.007575
820500 -- [-774.574] (-774.200) (-771.098) (-772.002) * (-773.251) (-773.817) [-771.831] (-774.580) -- 0:00:10
821000 -- (-772.988) (-771.164) [-773.422] (-773.477) * (-773.482) [-771.413] (-774.255) (-777.624) -- 0:00:10
821500 -- (-772.651) (-769.682) [-771.131] (-771.021) * (-773.369) (-772.331) [-773.643] (-776.548) -- 0:00:10
822000 -- [-770.673] (-773.648) (-770.667) (-775.857) * (-776.385) [-770.861] (-773.253) (-770.943) -- 0:00:10
822500 -- (-771.937) (-770.508) (-771.843) [-773.247] * (-774.793) (-769.926) (-771.827) [-773.648] -- 0:00:10
823000 -- (-775.202) [-771.530] (-770.748) (-772.820) * [-771.720] (-770.800) (-776.132) (-773.238) -- 0:00:10
823500 -- (-777.498) [-771.439] (-770.189) (-774.994) * [-773.210] (-770.477) (-771.347) (-772.619) -- 0:00:10
824000 -- (-770.900) [-771.359] (-770.971) (-771.364) * (-771.392) (-771.662) [-775.350] (-770.287) -- 0:00:10
824500 -- [-772.997] (-770.990) (-771.345) (-770.833) * (-772.307) [-770.082] (-774.214) (-772.038) -- 0:00:10
825000 -- (-771.579) (-771.078) [-771.154] (-770.683) * (-772.202) (-778.140) (-774.298) [-769.975] -- 0:00:10
Average standard deviation of split frequencies: 0.007633
825500 -- [-770.453] (-771.190) (-771.032) (-770.044) * (-772.188) [-771.611] (-772.628) (-770.859) -- 0:00:10
826000 -- (-771.099) [-771.407] (-774.543) (-771.405) * (-772.380) (-772.345) [-770.764] (-771.281) -- 0:00:10
826500 -- (-772.067) [-771.449] (-770.643) (-774.694) * (-769.755) (-772.216) (-774.185) [-771.190] -- 0:00:10
827000 -- [-770.952] (-774.231) (-774.640) (-774.056) * (-770.021) (-772.187) [-772.394] (-776.004) -- 0:00:10
827500 -- [-771.321] (-771.876) (-773.673) (-777.533) * (-772.317) (-771.368) (-772.187) [-770.456] -- 0:00:10
828000 -- (-771.727) [-770.082] (-776.442) (-771.539) * [-771.404] (-769.904) (-773.267) (-771.840) -- 0:00:10
828500 -- (-773.559) [-770.687] (-771.173) (-770.760) * (-770.314) [-772.709] (-778.152) (-774.548) -- 0:00:10
829000 -- [-773.496] (-770.988) (-773.608) (-773.742) * (-771.845) (-771.720) (-775.792) [-771.454] -- 0:00:10
829500 -- (-770.172) [-773.325] (-773.833) (-773.575) * (-772.459) [-772.347] (-774.671) (-770.880) -- 0:00:10
830000 -- (-770.167) (-770.189) (-771.240) [-772.514] * (-772.098) (-772.446) [-773.919] (-770.817) -- 0:00:10
Average standard deviation of split frequencies: 0.007413
830500 -- [-773.296] (-774.917) (-771.611) (-773.517) * (-769.858) [-770.770] (-772.208) (-770.672) -- 0:00:10
831000 -- [-774.610] (-771.542) (-773.064) (-769.943) * (-770.167) (-771.086) [-772.641] (-769.650) -- 0:00:10
831500 -- (-774.125) [-771.745] (-773.363) (-771.696) * (-771.400) (-775.624) (-772.711) [-769.791] -- 0:00:10
832000 -- [-770.601] (-769.661) (-771.441) (-771.881) * (-770.197) [-770.359] (-774.631) (-770.552) -- 0:00:10
832500 -- [-772.086] (-774.022) (-770.853) (-772.201) * [-772.429] (-771.061) (-770.771) (-771.713) -- 0:00:10
833000 -- (-771.389) [-772.196] (-772.814) (-772.299) * [-771.680] (-773.163) (-772.335) (-772.504) -- 0:00:10
833500 -- (-774.561) [-770.771] (-774.451) (-771.603) * [-771.843] (-772.829) (-772.674) (-769.742) -- 0:00:10
834000 -- [-774.538] (-771.409) (-772.131) (-772.779) * (-773.560) [-774.863] (-772.442) (-770.115) -- 0:00:10
834500 -- [-770.423] (-772.139) (-770.538) (-776.909) * [-772.758] (-776.129) (-771.033) (-772.167) -- 0:00:10
835000 -- (-770.246) (-772.142) (-772.220) [-774.428] * (-771.660) (-773.053) (-769.825) [-773.770] -- 0:00:10
Average standard deviation of split frequencies: 0.007260
835500 -- [-770.013] (-769.749) (-773.620) (-772.960) * (-771.476) (-777.634) (-772.311) [-771.841] -- 0:00:10
836000 -- [-769.867] (-770.688) (-769.879) (-774.980) * (-772.686) (-778.106) [-771.763] (-770.778) -- 0:00:10
836500 -- (-772.056) (-772.365) [-773.689] (-771.675) * (-773.835) [-774.597] (-774.283) (-773.251) -- 0:00:09
837000 -- (-770.063) (-770.745) [-771.141] (-770.651) * [-774.503] (-774.583) (-771.291) (-771.205) -- 0:00:09
837500 -- (-772.993) [-771.821] (-772.345) (-769.708) * [-772.767] (-772.572) (-776.282) (-771.845) -- 0:00:09
838000 -- [-775.615] (-771.435) (-773.365) (-772.538) * (-771.120) (-771.671) [-771.141] (-771.326) -- 0:00:09
838500 -- (-775.808) [-771.280] (-772.861) (-770.291) * (-770.827) (-771.826) [-770.846] (-772.563) -- 0:00:09
839000 -- [-772.744] (-770.088) (-773.566) (-770.115) * (-771.197) [-771.537] (-771.874) (-772.444) -- 0:00:09
839500 -- (-771.325) (-772.887) (-770.720) [-770.275] * (-771.815) [-773.814] (-771.638) (-775.822) -- 0:00:09
840000 -- (-773.428) [-770.121] (-771.622) (-772.072) * (-772.247) (-772.472) (-771.662) [-770.514] -- 0:00:09
Average standard deviation of split frequencies: 0.007570
840500 -- (-774.374) (-770.531) (-770.101) [-770.298] * (-771.353) [-773.145] (-770.592) (-771.514) -- 0:00:09
841000 -- (-772.188) [-771.622] (-775.429) (-772.670) * (-771.124) [-772.163] (-772.087) (-773.370) -- 0:00:09
841500 -- [-775.121] (-771.375) (-773.725) (-771.648) * [-774.279] (-774.072) (-773.702) (-771.222) -- 0:00:09
842000 -- (-775.115) (-770.236) [-771.842] (-774.422) * (-774.427) (-774.718) [-771.121] (-769.826) -- 0:00:09
842500 -- (-781.065) [-770.883] (-774.488) (-775.997) * (-773.533) (-772.307) [-773.288] (-772.144) -- 0:00:09
843000 -- (-781.009) (-769.959) [-771.289] (-773.118) * (-772.059) [-773.074] (-772.755) (-770.323) -- 0:00:09
843500 -- (-770.888) (-773.081) [-775.638] (-774.394) * (-782.148) [-771.489] (-776.296) (-772.496) -- 0:00:09
844000 -- [-772.085] (-775.177) (-774.943) (-773.110) * (-771.773) [-771.463] (-773.063) (-771.665) -- 0:00:09
844500 -- (-771.603) (-772.133) (-776.196) [-771.770] * (-773.814) (-771.450) (-772.001) [-770.597] -- 0:00:09
845000 -- (-773.053) [-772.842] (-783.970) (-770.422) * (-774.489) (-772.996) (-770.076) [-771.793] -- 0:00:09
Average standard deviation of split frequencies: 0.007975
845500 -- (-772.778) (-775.712) [-775.021] (-769.961) * (-773.037) (-772.622) (-770.815) [-772.923] -- 0:00:09
846000 -- [-774.308] (-773.552) (-775.516) (-774.923) * (-773.063) [-771.834] (-770.910) (-773.086) -- 0:00:09
846500 -- (-772.417) (-771.675) (-772.742) [-770.779] * (-773.585) [-772.114] (-770.542) (-776.412) -- 0:00:09
847000 -- (-774.817) (-771.314) (-778.765) [-773.602] * (-772.836) [-770.822] (-771.232) (-773.425) -- 0:00:09
847500 -- (-772.701) (-772.917) (-770.844) [-773.001] * (-772.562) [-771.959] (-772.246) (-775.100) -- 0:00:09
848000 -- (-772.738) (-773.457) (-773.020) [-771.700] * (-771.858) (-774.025) (-771.331) [-771.639] -- 0:00:09
848500 -- (-772.150) (-774.000) (-771.799) [-774.220] * (-770.932) (-771.191) (-770.902) [-770.699] -- 0:00:09
849000 -- (-773.069) [-770.606] (-774.810) (-775.079) * (-772.746) (-770.322) (-771.929) [-770.864] -- 0:00:09
849500 -- [-770.560] (-771.278) (-770.726) (-771.158) * [-772.123] (-771.148) (-770.520) (-775.503) -- 0:00:09
850000 -- (-772.420) (-775.677) [-774.178] (-770.645) * (-770.879) (-775.572) [-772.270] (-771.325) -- 0:00:09
Average standard deviation of split frequencies: 0.008573
850500 -- (-772.338) (-774.497) [-771.525] (-770.615) * [-772.602] (-771.368) (-771.709) (-771.407) -- 0:00:09
851000 -- (-776.672) [-770.810] (-771.514) (-770.561) * [-770.357] (-770.109) (-771.856) (-770.551) -- 0:00:09
851500 -- (-772.980) (-774.860) [-771.177] (-769.909) * (-773.408) (-770.862) (-771.342) [-774.111] -- 0:00:09
852000 -- (-772.739) (-772.200) (-770.920) [-772.806] * (-774.395) (-770.514) (-774.343) [-773.497] -- 0:00:09
852500 -- [-772.011] (-772.296) (-772.658) (-770.209) * (-771.235) [-771.722] (-775.564) (-771.735) -- 0:00:08
853000 -- (-773.905) [-771.223] (-770.748) (-771.932) * (-772.954) [-774.591] (-773.211) (-771.214) -- 0:00:08
853500 -- (-773.802) [-771.741] (-773.512) (-771.761) * (-771.948) [-771.715] (-771.079) (-772.358) -- 0:00:08
854000 -- (-771.094) (-771.163) (-770.920) [-778.231] * (-772.267) [-772.103] (-770.608) (-773.897) -- 0:00:08
854500 -- [-770.040] (-771.687) (-771.626) (-771.957) * [-772.063] (-772.711) (-772.503) (-774.426) -- 0:00:08
855000 -- [-771.608] (-771.930) (-771.712) (-771.732) * [-770.696] (-775.027) (-777.876) (-774.286) -- 0:00:08
Average standard deviation of split frequencies: 0.008747
855500 -- [-771.897] (-773.403) (-771.670) (-770.808) * (-775.976) (-774.716) (-770.828) [-776.570] -- 0:00:08
856000 -- (-773.126) [-769.984] (-771.656) (-773.526) * (-774.845) (-774.294) [-771.487] (-772.229) -- 0:00:08
856500 -- [-770.815] (-771.657) (-771.988) (-774.198) * (-773.072) (-774.831) (-773.459) [-771.481] -- 0:00:08
857000 -- (-772.441) (-773.518) [-772.114] (-775.875) * [-771.072] (-772.620) (-772.541) (-770.476) -- 0:00:08
857500 -- (-776.011) (-772.292) (-773.631) [-772.232] * (-772.823) [-770.604] (-772.217) (-770.952) -- 0:00:08
858000 -- (-771.304) (-770.907) (-773.033) [-771.950] * [-771.823] (-770.432) (-771.668) (-773.933) -- 0:00:08
858500 -- (-774.664) [-770.900] (-771.667) (-771.406) * (-771.028) (-773.837) (-770.550) [-769.683] -- 0:00:08
859000 -- [-770.818] (-770.777) (-773.667) (-773.071) * (-771.065) (-770.135) [-771.942] (-770.517) -- 0:00:08
859500 -- (-770.205) (-772.960) [-772.682] (-771.102) * (-774.279) (-773.308) (-775.385) [-770.982] -- 0:00:08
860000 -- (-772.414) (-774.244) (-772.251) [-770.778] * (-776.936) [-773.037] (-776.543) (-771.158) -- 0:00:08
Average standard deviation of split frequencies: 0.008248
860500 -- (-770.384) (-771.696) (-772.156) [-771.239] * (-772.581) (-770.433) (-776.525) [-770.726] -- 0:00:08
861000 -- (-770.863) (-772.269) (-770.294) [-770.861] * (-772.964) (-771.145) [-773.371] (-774.062) -- 0:00:08
861500 -- (-775.692) [-770.080] (-771.672) (-770.686) * (-771.858) (-770.323) (-771.406) [-771.877] -- 0:00:08
862000 -- (-771.265) [-770.074] (-774.387) (-770.235) * [-771.663] (-775.399) (-771.394) (-771.399) -- 0:00:08
862500 -- (-772.142) (-776.254) (-773.492) [-771.178] * [-772.827] (-772.494) (-771.047) (-770.081) -- 0:00:08
863000 -- [-771.224] (-772.852) (-772.754) (-773.396) * (-774.378) (-773.541) (-770.818) [-771.433] -- 0:00:08
863500 -- (-770.625) (-770.162) [-770.288] (-772.739) * (-774.500) [-770.084] (-771.346) (-778.497) -- 0:00:08
864000 -- (-777.072) (-774.879) (-772.793) [-771.952] * (-770.104) [-772.090] (-772.832) (-771.562) -- 0:00:08
864500 -- (-777.329) [-775.211] (-772.817) (-774.333) * [-769.854] (-770.857) (-771.653) (-772.958) -- 0:00:08
865000 -- (-770.002) (-770.967) [-771.653] (-771.886) * (-770.415) (-770.189) (-775.457) [-771.574] -- 0:00:08
Average standard deviation of split frequencies: 0.008517
865500 -- (-769.967) [-773.829] (-771.138) (-772.175) * (-774.208) (-770.020) [-772.091] (-774.417) -- 0:00:08
866000 -- [-769.926] (-772.100) (-771.620) (-771.424) * (-770.662) [-771.282] (-772.704) (-773.339) -- 0:00:08
866500 -- (-770.069) [-770.041] (-770.492) (-772.792) * (-771.324) (-771.413) [-770.942] (-771.536) -- 0:00:08
867000 -- (-769.935) (-773.715) (-772.058) [-772.590] * (-771.760) (-774.036) [-770.322] (-773.679) -- 0:00:08
867500 -- (-772.668) [-770.714] (-773.346) (-770.739) * (-772.058) (-771.357) [-770.355] (-770.757) -- 0:00:08
868000 -- (-771.322) [-778.029] (-772.675) (-770.899) * (-774.145) [-770.292] (-771.565) (-771.346) -- 0:00:08
868500 -- (-770.869) [-771.118] (-770.232) (-775.224) * [-771.166] (-771.921) (-769.789) (-770.487) -- 0:00:08
869000 -- (-771.895) (-771.118) (-772.226) [-770.071] * (-773.512) (-771.234) (-770.067) [-774.290] -- 0:00:07
869500 -- [-773.357] (-770.413) (-774.834) (-771.414) * (-774.495) (-772.576) [-771.368] (-773.293) -- 0:00:07
870000 -- (-772.169) [-770.646] (-772.829) (-773.064) * (-769.765) [-772.178] (-771.129) (-773.749) -- 0:00:07
Average standard deviation of split frequencies: 0.007851
870500 -- (-773.493) (-770.823) (-774.203) [-772.676] * [-772.254] (-772.508) (-773.654) (-772.351) -- 0:00:07
871000 -- (-771.563) [-771.296] (-772.616) (-772.265) * [-772.604] (-770.484) (-772.563) (-771.256) -- 0:00:07
871500 -- (-774.154) (-773.426) [-773.282] (-775.189) * (-770.812) (-776.147) [-773.796] (-771.947) -- 0:00:07
872000 -- [-771.317] (-773.905) (-772.352) (-775.886) * (-774.099) [-774.786] (-770.929) (-771.941) -- 0:00:07
872500 -- [-771.550] (-772.726) (-771.213) (-771.597) * (-771.532) [-772.223] (-772.920) (-770.751) -- 0:00:07
873000 -- (-773.039) (-774.260) (-771.019) [-771.283] * [-774.004] (-774.341) (-773.487) (-771.069) -- 0:00:07
873500 -- (-770.878) (-770.603) [-772.738] (-774.007) * (-772.998) [-772.397] (-777.127) (-771.379) -- 0:00:07
874000 -- (-772.477) (-773.465) (-771.889) [-773.612] * (-771.951) [-772.064] (-774.073) (-770.417) -- 0:00:07
874500 -- (-771.592) [-773.323] (-771.089) (-773.474) * (-775.009) (-773.258) (-776.235) [-771.845] -- 0:00:07
875000 -- (-770.968) [-771.076] (-770.193) (-772.051) * (-770.577) (-776.638) [-774.380] (-770.525) -- 0:00:07
Average standard deviation of split frequencies: 0.008375
875500 -- (-774.098) (-770.071) [-770.126] (-776.051) * (-771.399) (-771.741) (-772.974) [-770.704] -- 0:00:07
876000 -- (-771.417) (-769.717) [-770.998] (-770.694) * (-774.369) (-771.167) (-772.132) [-772.865] -- 0:00:07
876500 -- (-772.918) [-773.933] (-771.450) (-771.201) * (-773.189) (-772.377) [-771.991] (-770.738) -- 0:00:07
877000 -- (-771.242) (-772.651) [-775.498] (-770.786) * (-775.915) (-772.365) [-771.122] (-769.932) -- 0:00:07
877500 -- (-770.690) [-774.829] (-771.283) (-772.946) * (-772.083) (-773.292) (-771.905) [-771.006] -- 0:00:07
878000 -- (-771.574) (-775.144) [-775.202] (-770.128) * [-771.983] (-772.320) (-772.383) (-771.826) -- 0:00:07
878500 -- [-773.070] (-776.360) (-771.909) (-771.776) * [-772.278] (-775.415) (-771.719) (-770.094) -- 0:00:07
879000 -- (-779.735) (-773.633) (-773.297) [-772.118] * (-774.666) [-773.650] (-772.113) (-771.176) -- 0:00:07
879500 -- (-775.457) (-775.471) [-770.451] (-773.404) * (-771.668) (-773.145) (-774.247) [-770.957] -- 0:00:07
880000 -- (-770.479) (-771.512) (-772.357) [-770.517] * (-773.973) [-770.910] (-772.666) (-772.741) -- 0:00:07
Average standard deviation of split frequencies: 0.008130
880500 -- (-771.835) (-774.334) (-772.315) [-771.133] * (-771.257) [-769.899] (-772.366) (-772.846) -- 0:00:07
881000 -- (-769.981) (-770.844) [-776.979] (-774.439) * (-770.951) [-774.721] (-771.385) (-771.496) -- 0:00:07
881500 -- [-770.809] (-770.208) (-772.977) (-771.399) * (-775.872) [-771.861] (-773.492) (-770.248) -- 0:00:07
882000 -- (-771.885) (-779.086) [-770.132] (-772.851) * (-779.397) [-771.761] (-769.848) (-774.042) -- 0:00:07
882500 -- (-771.213) [-770.189] (-771.801) (-775.219) * (-773.021) (-775.087) [-770.267] (-773.851) -- 0:00:07
883000 -- (-771.306) [-770.701] (-772.763) (-774.877) * (-776.705) (-771.974) (-771.824) [-773.755] -- 0:00:07
883500 -- (-774.792) [-772.753] (-772.223) (-771.705) * (-771.744) (-771.215) (-771.685) [-769.974] -- 0:00:07
884000 -- (-772.425) [-771.011] (-773.009) (-771.361) * [-770.808] (-770.875) (-774.478) (-769.976) -- 0:00:07
884500 -- (-769.864) [-771.696] (-771.637) (-773.849) * (-771.106) [-774.021] (-774.644) (-776.282) -- 0:00:07
885000 -- (-769.916) (-771.603) [-772.130] (-771.408) * (-770.622) (-771.981) (-774.021) [-773.080] -- 0:00:07
Average standard deviation of split frequencies: 0.008951
885500 -- (-772.628) (-771.259) [-773.146] (-770.501) * (-770.748) [-776.312] (-772.612) (-773.739) -- 0:00:06
886000 -- (-772.516) (-771.773) (-770.243) [-773.200] * (-769.972) [-770.765] (-774.684) (-772.385) -- 0:00:06
886500 -- [-771.702] (-770.904) (-770.908) (-770.426) * (-776.366) (-772.601) [-772.709] (-774.683) -- 0:00:06
887000 -- (-771.801) (-771.675) (-775.410) [-773.788] * (-776.298) (-771.181) [-770.516] (-773.265) -- 0:00:06
887500 -- [-771.872] (-772.829) (-771.382) (-773.605) * (-771.999) [-771.412] (-771.901) (-771.448) -- 0:00:06
888000 -- (-771.890) (-775.542) [-771.151] (-776.023) * [-773.092] (-770.230) (-772.471) (-771.276) -- 0:00:06
888500 -- [-771.785] (-777.913) (-771.305) (-775.473) * (-772.550) (-770.343) (-772.814) [-770.296] -- 0:00:06
889000 -- (-775.237) (-770.805) [-769.989] (-773.744) * (-771.866) (-774.083) (-771.577) [-773.839] -- 0:00:06
889500 -- [-773.511] (-770.549) (-771.932) (-770.715) * (-772.086) [-771.639] (-775.475) (-771.939) -- 0:00:06
890000 -- (-774.461) (-772.718) (-772.722) [-771.300] * (-770.897) (-770.566) [-772.845] (-775.198) -- 0:00:06
Average standard deviation of split frequencies: 0.007972
890500 -- [-772.049] (-770.966) (-772.025) (-772.556) * (-771.631) [-770.170] (-772.801) (-773.751) -- 0:00:06
891000 -- [-771.904] (-773.330) (-772.045) (-771.293) * [-772.516] (-774.529) (-770.513) (-770.748) -- 0:00:06
891500 -- [-774.110] (-773.773) (-772.716) (-775.190) * (-771.297) [-774.793] (-772.075) (-771.233) -- 0:00:06
892000 -- (-772.021) (-770.818) [-771.973] (-776.233) * (-770.778) [-772.483] (-773.840) (-770.677) -- 0:00:06
892500 -- (-772.724) (-771.369) [-772.115] (-771.261) * [-770.842] (-770.814) (-771.403) (-774.885) -- 0:00:06
893000 -- (-771.614) [-774.561] (-773.625) (-769.979) * [-772.600] (-771.131) (-771.978) (-771.190) -- 0:00:06
893500 -- [-773.690] (-771.717) (-770.111) (-769.980) * (-773.695) (-771.624) (-771.845) [-771.417] -- 0:00:06
894000 -- (-773.053) (-775.071) [-770.483] (-769.630) * [-774.093] (-771.587) (-772.189) (-771.464) -- 0:00:06
894500 -- (-775.116) [-772.034] (-770.926) (-771.430) * (-771.007) (-771.947) [-770.323] (-774.244) -- 0:00:06
895000 -- (-771.058) (-771.180) (-772.074) [-772.404] * (-772.236) (-769.973) (-771.192) [-772.121] -- 0:00:06
Average standard deviation of split frequencies: 0.008385
895500 -- (-771.257) (-772.357) [-770.912] (-772.004) * (-771.252) (-770.818) [-773.157] (-773.306) -- 0:00:06
896000 -- (-771.263) [-772.227] (-772.645) (-775.781) * (-770.790) [-772.510] (-777.071) (-776.516) -- 0:00:06
896500 -- (-771.799) (-771.527) (-774.496) [-771.067] * (-773.111) (-771.490) [-771.140] (-771.106) -- 0:00:06
897000 -- (-776.692) (-773.099) [-770.425] (-773.358) * (-773.743) (-771.514) (-774.366) [-772.222] -- 0:00:06
897500 -- (-773.450) [-770.673] (-769.879) (-774.887) * (-773.501) (-774.033) (-774.955) [-771.486] -- 0:00:06
898000 -- (-774.603) (-770.479) [-770.554] (-776.611) * (-771.989) (-772.495) (-771.399) [-771.431] -- 0:00:06
898500 -- (-772.380) (-774.160) (-769.732) [-773.287] * (-771.466) (-773.041) [-770.409] (-770.704) -- 0:00:06
899000 -- (-771.739) [-770.897] (-770.099) (-772.706) * (-770.767) (-771.989) [-770.494] (-770.542) -- 0:00:06
899500 -- [-773.227] (-773.560) (-773.714) (-773.225) * (-773.060) [-772.394] (-774.567) (-772.980) -- 0:00:06
900000 -- (-772.628) [-773.961] (-773.112) (-771.219) * (-774.169) (-772.219) (-772.310) [-770.707] -- 0:00:06
Average standard deviation of split frequencies: 0.007982
900500 -- (-774.597) (-771.630) (-773.451) [-771.813] * (-774.142) (-774.546) (-772.761) [-770.154] -- 0:00:06
901000 -- (-771.626) (-771.995) [-771.699] (-773.032) * (-770.794) [-773.291] (-776.125) (-774.244) -- 0:00:06
901500 -- (-772.792) (-773.411) [-771.685] (-777.864) * (-772.976) (-772.598) [-772.875] (-772.280) -- 0:00:06
902000 -- [-771.505] (-770.948) (-770.338) (-774.266) * (-772.976) (-770.708) [-774.815] (-771.409) -- 0:00:05
902500 -- (-771.081) [-770.102] (-770.787) (-772.241) * (-769.627) [-771.634] (-773.118) (-769.959) -- 0:00:05
903000 -- (-771.409) [-770.377] (-775.443) (-771.406) * (-769.597) (-775.434) (-772.828) [-770.442] -- 0:00:05
903500 -- [-773.072] (-770.707) (-774.646) (-772.435) * [-773.083] (-771.542) (-776.027) (-774.357) -- 0:00:05
904000 -- [-772.898] (-771.576) (-776.361) (-778.107) * (-772.647) (-774.029) [-770.683] (-770.599) -- 0:00:05
904500 -- [-770.782] (-772.681) (-773.373) (-774.402) * [-772.485] (-771.936) (-771.476) (-769.896) -- 0:00:05
905000 -- (-770.419) (-772.242) (-774.504) [-773.784] * (-772.609) (-772.529) (-771.350) [-770.845] -- 0:00:05
Average standard deviation of split frequencies: 0.008032
905500 -- [-771.977] (-772.182) (-771.162) (-771.940) * (-773.378) (-769.737) (-771.830) [-772.624] -- 0:00:05
906000 -- (-771.491) [-774.296] (-773.475) (-772.481) * [-772.683] (-772.207) (-774.621) (-771.003) -- 0:00:05
906500 -- [-771.031] (-772.750) (-771.765) (-770.596) * (-771.417) (-773.397) (-777.540) [-772.002] -- 0:00:05
907000 -- [-771.176] (-770.004) (-777.489) (-770.338) * (-771.003) (-774.463) (-772.441) [-773.098] -- 0:00:05
907500 -- (-770.124) [-772.822] (-770.484) (-771.029) * (-772.493) [-771.228] (-772.852) (-772.225) -- 0:00:05
908000 -- (-772.230) [-771.198] (-773.947) (-773.190) * (-772.155) [-771.293] (-777.246) (-772.443) -- 0:00:05
908500 -- (-771.953) [-773.546] (-774.838) (-770.103) * (-774.030) [-773.137] (-774.284) (-772.418) -- 0:00:05
909000 -- [-777.932] (-770.988) (-773.061) (-771.211) * (-772.583) [-773.318] (-777.374) (-771.782) -- 0:00:05
909500 -- [-771.869] (-770.157) (-773.324) (-771.500) * (-775.484) [-771.901] (-771.614) (-773.457) -- 0:00:05
910000 -- (-771.563) (-770.182) [-770.530] (-772.757) * (-777.399) [-774.728] (-771.180) (-774.465) -- 0:00:05
Average standard deviation of split frequencies: 0.008121
910500 -- (-771.576) (-772.663) (-774.670) [-773.460] * [-773.003] (-772.903) (-770.160) (-773.414) -- 0:00:05
911000 -- (-771.689) (-772.819) (-770.274) [-775.935] * (-769.895) [-772.118] (-772.536) (-772.856) -- 0:00:05
911500 -- (-772.424) (-773.643) [-772.412] (-772.692) * (-771.644) [-774.596] (-770.887) (-770.962) -- 0:00:05
912000 -- [-772.700] (-774.109) (-773.879) (-770.148) * (-770.195) (-778.214) (-771.923) [-771.673] -- 0:00:05
912500 -- (-775.086) (-775.677) [-772.753] (-770.959) * [-771.544] (-770.059) (-774.097) (-772.269) -- 0:00:05
913000 -- (-772.117) [-772.943] (-772.801) (-773.058) * (-772.903) [-770.664] (-770.743) (-774.330) -- 0:00:05
913500 -- (-770.835) (-773.901) [-772.050] (-771.903) * (-774.442) (-770.530) [-771.317] (-771.813) -- 0:00:05
914000 -- (-772.455) (-772.154) (-771.306) [-771.437] * (-778.193) [-771.365] (-773.901) (-775.692) -- 0:00:05
914500 -- (-772.596) (-774.204) [-771.139] (-771.361) * [-772.250] (-771.486) (-771.081) (-772.250) -- 0:00:05
915000 -- (-769.903) (-770.784) [-771.433] (-775.371) * (-771.840) (-771.593) (-772.045) [-772.844] -- 0:00:05
Average standard deviation of split frequencies: 0.008298
915500 -- (-770.027) (-771.051) [-770.303] (-775.465) * [-770.818] (-771.496) (-771.497) (-774.793) -- 0:00:05
916000 -- (-776.680) (-770.357) [-770.306] (-773.674) * (-771.046) (-772.802) [-771.071] (-771.295) -- 0:00:05
916500 -- (-771.967) [-772.606] (-770.257) (-773.379) * [-774.086] (-771.409) (-773.737) (-772.202) -- 0:00:05
917000 -- (-769.866) (-773.492) [-772.585] (-775.737) * [-770.951] (-772.518) (-772.139) (-771.291) -- 0:00:05
917500 -- (-770.508) (-771.455) (-773.934) [-771.494] * (-773.472) (-771.185) (-771.078) [-771.759] -- 0:00:05
918000 -- (-771.994) [-770.370] (-776.292) (-772.852) * (-771.965) (-782.877) (-773.075) [-770.040] -- 0:00:05
918500 -- (-772.540) [-771.978] (-772.972) (-774.224) * (-772.982) (-770.541) (-773.379) [-772.163] -- 0:00:04
919000 -- (-773.225) (-773.868) (-771.862) [-770.083] * (-775.625) [-772.672] (-771.114) (-771.695) -- 0:00:04
919500 -- (-774.898) (-772.087) (-770.307) [-770.350] * (-771.129) (-772.070) [-771.738] (-773.838) -- 0:00:04
920000 -- (-773.500) [-771.706] (-772.060) (-771.219) * (-773.746) (-771.934) (-772.671) [-770.891] -- 0:00:04
Average standard deviation of split frequencies: 0.008448
920500 -- [-774.019] (-775.156) (-771.924) (-771.259) * [-771.732] (-773.576) (-772.625) (-772.401) -- 0:00:04
921000 -- (-773.090) [-770.530] (-772.189) (-771.146) * (-773.460) [-773.787] (-772.935) (-771.868) -- 0:00:04
921500 -- [-770.185] (-770.530) (-771.430) (-770.595) * (-773.378) [-772.798] (-770.501) (-771.754) -- 0:00:04
922000 -- [-771.210] (-771.199) (-773.321) (-773.339) * [-773.563] (-770.591) (-772.301) (-770.908) -- 0:00:04
922500 -- [-773.476] (-772.936) (-777.365) (-775.731) * [-771.174] (-771.203) (-770.567) (-770.388) -- 0:00:04
923000 -- (-774.902) [-770.409] (-772.971) (-773.442) * (-769.780) (-770.430) [-771.836] (-770.944) -- 0:00:04
923500 -- (-771.632) [-772.555] (-773.077) (-773.053) * (-770.310) [-770.574] (-770.112) (-775.939) -- 0:00:04
924000 -- [-771.579] (-770.247) (-770.508) (-773.697) * (-772.747) (-770.656) (-771.252) [-773.301] -- 0:00:04
924500 -- [-771.363] (-771.290) (-773.370) (-775.182) * [-775.400] (-770.723) (-771.411) (-773.098) -- 0:00:04
925000 -- [-770.386] (-773.769) (-771.800) (-773.560) * [-771.158] (-771.825) (-773.317) (-770.146) -- 0:00:04
Average standard deviation of split frequencies: 0.008304
925500 -- (-771.166) [-771.177] (-771.391) (-774.318) * (-775.345) (-770.589) (-770.504) [-770.554] -- 0:00:04
926000 -- (-771.488) (-771.453) (-772.272) [-774.708] * (-771.376) [-771.132] (-771.683) (-769.953) -- 0:00:04
926500 -- [-771.400] (-769.888) (-772.445) (-774.963) * (-770.383) [-770.265] (-773.746) (-772.384) -- 0:00:04
927000 -- (-773.260) (-772.889) (-770.967) [-771.262] * [-771.851] (-772.228) (-771.290) (-773.262) -- 0:00:04
927500 -- (-771.301) (-771.593) (-770.427) [-771.185] * (-772.757) (-771.780) [-771.453] (-770.736) -- 0:00:04
928000 -- [-771.478] (-773.539) (-771.769) (-773.871) * (-771.889) (-773.103) (-772.354) [-772.712] -- 0:00:04
928500 -- (-773.216) (-776.158) [-771.184] (-771.831) * (-771.474) [-771.071] (-771.725) (-770.472) -- 0:00:04
929000 -- (-771.392) [-772.533] (-770.202) (-771.466) * (-773.185) (-771.076) [-772.953] (-771.181) -- 0:00:04
929500 -- (-773.841) (-771.336) (-775.504) [-772.146] * (-774.559) (-773.351) [-772.521] (-776.412) -- 0:00:04
930000 -- (-772.172) (-770.283) [-773.477] (-770.992) * (-772.463) [-770.296] (-774.187) (-774.361) -- 0:00:04
Average standard deviation of split frequencies: 0.008358
930500 -- (-770.090) [-770.128] (-773.745) (-769.878) * (-775.779) (-772.865) [-776.174] (-771.122) -- 0:00:04
931000 -- [-772.455] (-775.724) (-773.151) (-772.926) * (-771.577) (-772.328) [-772.743] (-774.337) -- 0:00:04
931500 -- [-771.656] (-771.223) (-773.298) (-772.560) * [-772.232] (-771.043) (-773.534) (-770.100) -- 0:00:04
932000 -- [-772.378] (-772.326) (-772.239) (-772.398) * (-771.136) (-772.421) (-778.181) [-770.361] -- 0:00:04
932500 -- (-769.824) (-775.709) (-770.404) [-772.362] * (-769.893) [-771.068] (-774.514) (-777.557) -- 0:00:04
933000 -- (-770.836) (-773.199) (-770.740) [-776.642] * (-771.789) (-773.147) [-771.529] (-772.533) -- 0:00:04
933500 -- (-770.665) (-774.601) [-770.124] (-777.224) * [-773.328] (-773.980) (-771.022) (-776.510) -- 0:00:04
934000 -- (-771.364) (-776.826) (-772.938) [-776.819] * (-771.431) [-772.031] (-771.909) (-775.251) -- 0:00:04
934500 -- (-772.010) [-771.813] (-772.663) (-772.640) * (-772.945) (-774.152) [-770.795] (-773.332) -- 0:00:03
935000 -- (-772.658) (-776.290) [-771.937] (-773.610) * [-770.925] (-769.998) (-771.643) (-774.672) -- 0:00:03
Average standard deviation of split frequencies: 0.008688
935500 -- (-773.222) (-772.966) [-773.851] (-773.546) * (-771.304) [-770.372] (-772.710) (-773.088) -- 0:00:03
936000 -- (-773.897) (-776.196) [-772.594] (-771.339) * (-776.489) (-775.423) (-773.967) [-772.373] -- 0:00:03
936500 -- (-772.977) (-772.849) (-771.580) [-772.029] * (-772.768) (-772.435) (-771.017) [-770.624] -- 0:00:03
937000 -- (-773.094) [-770.285] (-772.995) (-770.573) * (-771.094) (-772.051) (-774.305) [-769.728] -- 0:00:03
937500 -- (-773.119) (-769.953) [-770.918] (-770.384) * (-770.809) (-770.650) (-771.094) [-772.618] -- 0:00:03
938000 -- [-773.421] (-772.687) (-770.592) (-770.287) * (-770.875) [-772.395] (-772.194) (-773.172) -- 0:00:03
938500 -- (-780.128) [-772.218] (-772.323) (-770.229) * (-770.910) [-773.396] (-775.005) (-774.180) -- 0:00:03
939000 -- (-776.120) [-771.168] (-773.287) (-770.495) * (-771.815) (-771.115) [-775.347] (-772.214) -- 0:00:03
939500 -- [-770.545] (-771.059) (-773.416) (-775.750) * (-775.827) (-776.302) (-774.907) [-772.130] -- 0:00:03
940000 -- (-772.442) (-771.306) [-771.247] (-772.007) * (-772.264) [-771.278] (-772.439) (-770.499) -- 0:00:03
Average standard deviation of split frequencies: 0.008613
940500 -- [-772.787] (-771.572) (-771.263) (-770.383) * (-776.134) (-773.002) [-772.347] (-771.524) -- 0:00:03
941000 -- (-772.456) (-770.436) [-771.719] (-772.474) * (-774.228) (-771.020) [-770.711] (-772.763) -- 0:00:03
941500 -- (-775.859) (-771.947) [-770.587] (-771.561) * (-770.104) [-771.056] (-771.287) (-771.680) -- 0:00:03
942000 -- (-770.387) (-772.105) [-770.271] (-774.229) * (-769.846) (-770.634) (-773.043) [-770.808] -- 0:00:03
942500 -- [-771.799] (-771.734) (-771.343) (-771.038) * (-770.726) (-772.735) (-771.228) [-770.248] -- 0:00:03
943000 -- (-771.089) [-776.069] (-772.264) (-775.391) * [-770.084] (-774.055) (-770.413) (-770.249) -- 0:00:03
943500 -- [-770.881] (-771.849) (-770.512) (-773.030) * (-769.693) (-773.423) [-770.299] (-770.819) -- 0:00:03
944000 -- (-770.546) (-770.377) (-772.696) [-772.844] * (-771.124) (-772.684) (-773.196) [-770.621] -- 0:00:03
944500 -- [-771.049] (-772.109) (-771.998) (-770.924) * (-774.653) (-771.737) [-769.783] (-770.962) -- 0:00:03
945000 -- (-771.164) (-771.442) [-773.249] (-770.522) * (-773.323) [-772.010] (-770.215) (-773.140) -- 0:00:03
Average standard deviation of split frequencies: 0.008876
945500 -- (-771.072) (-771.944) (-773.276) [-772.349] * (-770.682) [-774.926] (-774.159) (-775.720) -- 0:00:03
946000 -- (-774.445) (-772.551) [-769.932] (-772.203) * (-770.471) (-773.392) (-774.268) [-772.268] -- 0:00:03
946500 -- (-773.228) (-773.024) (-771.435) [-771.777] * [-770.181] (-770.911) (-778.375) (-772.147) -- 0:00:03
947000 -- [-772.157] (-773.485) (-770.601) (-773.225) * (-780.522) (-770.144) (-773.428) [-771.910] -- 0:00:03
947500 -- (-771.092) [-772.005] (-770.046) (-771.774) * (-772.005) (-773.503) (-773.925) [-770.199] -- 0:00:03
948000 -- (-773.645) [-770.252] (-770.462) (-770.992) * (-771.669) [-770.975] (-773.697) (-771.077) -- 0:00:03
948500 -- (-775.408) (-772.739) (-771.083) [-774.120] * (-771.148) (-770.974) [-775.159] (-771.718) -- 0:00:03
949000 -- (-771.566) [-770.891] (-770.519) (-775.524) * (-773.238) (-772.029) [-770.978] (-769.711) -- 0:00:03
949500 -- [-771.867] (-770.580) (-772.233) (-775.363) * [-770.556] (-772.444) (-772.407) (-775.973) -- 0:00:03
950000 -- (-772.809) [-770.918] (-775.765) (-775.116) * (-770.180) (-776.461) (-772.306) [-772.081] -- 0:00:03
Average standard deviation of split frequencies: 0.009019
950500 -- (-773.013) (-770.773) (-773.685) [-773.706] * (-772.467) (-772.090) (-774.748) [-773.301] -- 0:00:03
951000 -- (-771.075) (-771.550) [-776.542] (-773.025) * [-774.221] (-770.504) (-772.929) (-772.047) -- 0:00:02
951500 -- (-771.060) (-772.854) [-770.184] (-770.981) * (-775.121) (-771.291) (-772.071) [-770.504] -- 0:00:02
952000 -- (-771.240) [-771.598] (-769.852) (-774.599) * [-771.070] (-772.399) (-773.215) (-774.110) -- 0:00:02
952500 -- (-771.519) (-771.271) [-770.387] (-772.691) * (-772.562) (-771.034) [-771.023] (-772.450) -- 0:00:02
953000 -- (-772.816) (-770.991) [-770.466] (-770.868) * (-770.868) (-775.027) (-773.679) [-770.824] -- 0:00:02
953500 -- (-773.201) [-771.991] (-770.131) (-774.562) * (-772.565) (-772.595) [-772.540] (-776.403) -- 0:00:02
954000 -- (-771.962) [-772.717] (-771.686) (-772.782) * (-771.933) (-772.436) [-774.314] (-773.226) -- 0:00:02
954500 -- (-772.705) (-771.539) [-770.017] (-774.107) * (-771.835) (-774.253) (-771.238) [-771.738] -- 0:00:02
955000 -- (-771.965) [-773.363] (-780.504) (-774.645) * (-771.409) [-770.672] (-770.310) (-771.554) -- 0:00:02
Average standard deviation of split frequencies: 0.008753
955500 -- (-770.381) (-770.257) (-773.269) [-772.154] * [-770.837] (-777.574) (-771.262) (-772.399) -- 0:00:02
956000 -- [-774.093] (-770.144) (-774.106) (-771.057) * [-774.732] (-774.085) (-770.888) (-772.537) -- 0:00:02
956500 -- (-772.923) [-770.923] (-777.685) (-769.840) * [-770.722] (-770.981) (-772.845) (-771.432) -- 0:00:02
957000 -- (-772.863) (-774.324) [-771.174] (-772.206) * [-770.820] (-771.410) (-772.155) (-772.582) -- 0:00:02
957500 -- [-770.375] (-772.113) (-770.651) (-771.235) * (-772.851) [-771.515] (-774.761) (-771.862) -- 0:00:02
958000 -- [-770.565] (-773.024) (-770.924) (-770.454) * (-771.078) (-769.934) (-771.218) [-771.793] -- 0:00:02
958500 -- [-770.324] (-772.224) (-773.890) (-770.129) * (-770.194) [-771.061] (-771.276) (-771.417) -- 0:00:02
959000 -- (-772.828) [-773.584] (-771.420) (-770.220) * [-773.117] (-776.165) (-773.950) (-773.116) -- 0:00:02
959500 -- [-771.129] (-771.792) (-771.096) (-770.387) * (-776.832) [-776.475] (-774.897) (-771.522) -- 0:00:02
960000 -- (-771.064) [-771.592] (-771.528) (-774.915) * (-774.086) (-771.962) (-770.938) [-772.752] -- 0:00:02
Average standard deviation of split frequencies: 0.009078
960500 -- [-771.924] (-773.151) (-774.559) (-772.733) * [-771.110] (-772.995) (-772.687) (-775.364) -- 0:00:02
961000 -- (-774.242) (-773.256) [-772.905] (-773.643) * (-771.719) (-772.882) (-774.915) [-772.656] -- 0:00:02
961500 -- (-774.424) (-772.726) (-770.717) [-772.253] * (-770.742) (-772.124) (-772.872) [-771.720] -- 0:00:02
962000 -- (-773.004) [-775.087] (-772.064) (-771.480) * (-772.422) [-772.353] (-775.628) (-773.776) -- 0:00:02
962500 -- [-772.163] (-772.930) (-772.337) (-772.513) * (-771.741) [-772.048] (-770.631) (-773.353) -- 0:00:02
963000 -- (-770.903) (-776.273) [-770.220] (-772.096) * [-771.362] (-770.923) (-773.640) (-773.954) -- 0:00:02
963500 -- (-770.538) (-774.332) [-770.441] (-771.245) * [-770.153] (-770.806) (-775.680) (-773.995) -- 0:00:02
964000 -- [-772.166] (-772.056) (-771.948) (-772.079) * (-771.267) (-770.832) [-776.445] (-770.826) -- 0:00:02
964500 -- [-772.983] (-770.380) (-772.838) (-771.634) * (-772.443) (-773.282) (-776.528) [-771.028] -- 0:00:02
965000 -- [-777.262] (-770.548) (-771.265) (-774.833) * [-770.877] (-770.602) (-775.584) (-772.035) -- 0:00:02
Average standard deviation of split frequencies: 0.008967
965500 -- [-772.635] (-772.074) (-771.191) (-773.671) * (-770.479) [-773.848] (-772.511) (-772.282) -- 0:00:02
966000 -- [-773.538] (-773.304) (-771.575) (-772.173) * (-769.848) (-770.772) (-770.417) [-771.290] -- 0:00:02
966500 -- (-773.872) (-772.054) [-770.369] (-772.462) * (-770.210) [-772.145] (-771.179) (-771.365) -- 0:00:02
967000 -- (-773.098) (-772.108) (-771.267) [-772.790] * [-770.455] (-771.297) (-769.927) (-774.346) -- 0:00:02
967500 -- (-774.562) [-772.155] (-772.069) (-772.649) * (-772.690) (-771.470) [-770.139] (-772.806) -- 0:00:01
968000 -- (-775.504) [-772.927] (-771.275) (-773.910) * (-773.045) [-772.202] (-771.148) (-772.574) -- 0:00:01
968500 -- (-773.186) [-774.545] (-771.058) (-772.344) * (-777.114) [-772.191] (-770.787) (-772.937) -- 0:00:01
969000 -- (-771.797) (-774.705) [-770.547] (-775.313) * [-772.209] (-772.882) (-770.565) (-774.593) -- 0:00:01
969500 -- [-773.407] (-774.718) (-774.030) (-772.477) * [-770.955] (-771.541) (-776.031) (-774.048) -- 0:00:01
970000 -- (-772.071) (-771.318) [-773.079] (-771.780) * [-775.107] (-773.156) (-772.847) (-771.583) -- 0:00:01
Average standard deviation of split frequencies: 0.008711
970500 -- [-776.290] (-771.604) (-774.363) (-772.225) * (-771.996) (-769.942) (-771.973) [-770.439] -- 0:00:01
971000 -- [-769.927] (-773.899) (-770.776) (-770.837) * (-771.082) [-771.547] (-772.378) (-770.945) -- 0:00:01
971500 -- (-769.823) (-773.899) [-769.937] (-771.704) * (-770.569) (-775.906) (-772.429) [-772.043] -- 0:00:01
972000 -- (-769.831) [-773.641] (-771.018) (-772.151) * (-770.253) [-771.346] (-772.057) (-771.550) -- 0:00:01
972500 -- (-770.353) [-773.723] (-770.596) (-776.588) * (-771.009) [-771.974] (-773.420) (-771.457) -- 0:00:01
973000 -- (-771.908) (-775.752) [-770.230] (-771.114) * (-772.798) (-773.421) (-771.603) [-772.034] -- 0:00:01
973500 -- (-772.351) (-775.351) [-770.300] (-770.369) * [-770.768] (-771.783) (-774.600) (-773.636) -- 0:00:01
974000 -- [-770.583] (-773.763) (-776.040) (-771.224) * (-771.128) (-772.634) [-770.678] (-773.274) -- 0:00:01
974500 -- (-771.657) [-771.467] (-776.853) (-773.380) * [-772.131] (-770.532) (-770.896) (-772.071) -- 0:00:01
975000 -- [-770.875] (-772.430) (-776.468) (-771.716) * (-772.726) [-774.235] (-772.681) (-770.722) -- 0:00:01
Average standard deviation of split frequencies: 0.008664
975500 -- (-771.203) (-772.121) (-769.761) [-773.463] * (-774.474) (-776.209) (-773.210) [-773.270] -- 0:00:01
976000 -- (-770.199) (-771.015) (-771.724) [-774.135] * (-771.066) (-773.590) [-771.535] (-773.674) -- 0:00:01
976500 -- [-770.631] (-773.314) (-769.802) (-771.561) * (-770.714) (-774.655) [-771.392] (-771.388) -- 0:00:01
977000 -- [-773.995] (-772.634) (-770.849) (-770.370) * [-769.944] (-770.976) (-776.112) (-771.254) -- 0:00:01
977500 -- (-770.915) (-776.633) (-775.667) [-770.413] * [-773.072] (-774.979) (-771.994) (-770.894) -- 0:00:01
978000 -- (-773.781) [-771.954] (-776.466) (-773.994) * (-774.661) (-774.901) (-777.246) [-770.553] -- 0:00:01
978500 -- (-773.703) (-774.880) (-774.948) [-772.213] * (-771.203) [-775.351] (-772.895) (-771.578) -- 0:00:01
979000 -- (-774.074) [-769.617] (-771.635) (-770.236) * (-772.644) (-772.157) [-772.430] (-772.523) -- 0:00:01
979500 -- (-773.682) (-771.966) (-775.293) [-771.910] * (-770.153) [-770.181] (-769.655) (-776.227) -- 0:00:01
980000 -- (-772.939) (-770.827) (-774.737) [-772.194] * (-770.195) (-772.529) [-772.933] (-772.271) -- 0:00:01
Average standard deviation of split frequencies: 0.008683
980500 -- (-770.334) (-770.901) [-774.002] (-771.004) * (-770.068) (-770.493) [-772.058] (-770.280) -- 0:00:01
981000 -- (-770.845) (-770.903) [-771.409] (-771.528) * (-770.966) [-772.631] (-772.287) (-770.215) -- 0:00:01
981500 -- (-769.913) [-772.677] (-773.102) (-772.853) * [-772.152] (-771.609) (-772.380) (-770.506) -- 0:00:01
982000 -- (-771.306) [-772.832] (-776.124) (-773.042) * (-773.210) [-771.486] (-771.071) (-771.112) -- 0:00:01
982500 -- (-772.414) [-774.876] (-772.163) (-772.568) * (-774.683) [-771.223] (-772.893) (-771.851) -- 0:00:01
983000 -- (-770.197) [-771.638] (-772.236) (-777.130) * (-771.314) [-772.005] (-771.464) (-776.413) -- 0:00:01
983500 -- (-776.225) [-770.497] (-771.031) (-771.557) * [-773.241] (-775.993) (-770.876) (-772.371) -- 0:00:01
984000 -- (-770.733) (-773.756) [-771.820] (-771.505) * (-772.436) (-777.394) (-776.124) [-770.004] -- 0:00:00
984500 -- (-772.194) (-774.010) (-771.031) [-771.539] * (-771.436) (-775.326) [-773.159] (-775.767) -- 0:00:00
985000 -- (-775.439) (-772.199) [-771.333] (-770.710) * (-772.388) [-772.219] (-772.647) (-773.722) -- 0:00:00
Average standard deviation of split frequencies: 0.009024
985500 -- (-776.512) (-770.256) [-770.696] (-770.964) * [-771.413] (-771.951) (-772.307) (-770.898) -- 0:00:00
986000 -- (-772.992) [-772.814] (-770.656) (-770.064) * [-773.449] (-771.919) (-772.818) (-773.098) -- 0:00:00
986500 -- [-775.217] (-771.296) (-774.379) (-771.885) * (-771.674) (-771.427) [-769.895] (-773.895) -- 0:00:00
987000 -- (-773.775) (-774.160) [-772.099] (-770.247) * (-772.010) (-772.390) [-772.058] (-771.939) -- 0:00:00
987500 -- (-773.232) (-772.551) (-773.545) [-771.569] * [-772.173] (-770.164) (-773.611) (-770.713) -- 0:00:00
988000 -- (-771.545) (-773.325) [-773.863] (-771.328) * (-775.992) [-771.390] (-772.192) (-774.572) -- 0:00:00
988500 -- (-776.130) [-774.460] (-770.471) (-771.170) * (-774.140) (-770.842) (-771.759) [-770.138] -- 0:00:00
989000 -- (-780.792) [-773.001] (-770.338) (-770.654) * (-776.061) (-771.554) (-770.340) [-771.115] -- 0:00:00
989500 -- (-774.245) [-772.351] (-771.784) (-771.187) * [-775.022] (-772.284) (-770.781) (-772.140) -- 0:00:00
990000 -- (-770.473) [-771.715] (-772.141) (-771.162) * [-780.851] (-772.628) (-770.495) (-772.926) -- 0:00:00
Average standard deviation of split frequencies: 0.008863
990500 -- [-770.935] (-770.739) (-770.717) (-772.273) * (-775.958) (-770.768) [-772.233] (-773.854) -- 0:00:00
991000 -- (-775.407) (-771.372) (-771.348) [-770.003] * (-771.808) (-771.433) [-770.052] (-771.036) -- 0:00:00
991500 -- (-771.471) [-769.797] (-771.577) (-770.993) * (-771.709) (-772.465) (-772.662) [-770.091] -- 0:00:00
992000 -- (-771.892) (-770.435) (-770.719) [-771.441] * (-773.200) (-772.414) (-772.458) [-771.570] -- 0:00:00
992500 -- (-771.110) (-770.812) [-772.864] (-771.926) * (-771.674) (-776.255) (-772.835) [-773.184] -- 0:00:00
993000 -- (-773.194) (-771.364) (-770.747) [-771.300] * (-770.910) (-772.616) (-773.066) [-774.087] -- 0:00:00
993500 -- (-771.510) [-770.860] (-773.177) (-770.872) * [-773.157] (-770.606) (-770.963) (-771.851) -- 0:00:00
994000 -- (-776.712) [-770.009] (-776.408) (-770.672) * (-773.099) (-771.330) [-771.960] (-770.978) -- 0:00:00
994500 -- (-772.040) (-774.596) [-772.108] (-774.745) * (-773.869) (-772.239) [-773.939] (-770.362) -- 0:00:00
995000 -- (-770.770) (-773.598) [-771.987] (-775.157) * (-773.682) (-773.353) (-772.100) [-770.659] -- 0:00:00
Average standard deviation of split frequencies: 0.008963
995500 -- [-772.105] (-772.928) (-771.870) (-776.096) * (-771.334) (-774.985) (-771.550) [-771.736] -- 0:00:00
996000 -- (-773.233) (-772.234) [-771.651] (-775.165) * (-774.265) (-771.213) [-775.751] (-772.217) -- 0:00:00
996500 -- (-777.135) [-773.659] (-772.838) (-774.497) * (-772.225) (-772.571) [-777.077] (-771.933) -- 0:00:00
997000 -- (-775.205) (-773.924) (-771.754) [-773.647] * (-774.948) [-773.188] (-771.384) (-773.463) -- 0:00:00
997500 -- (-772.491) (-775.437) (-770.811) [-772.764] * (-772.752) (-772.306) (-771.043) [-770.741] -- 0:00:00
998000 -- [-771.514] (-774.435) (-775.588) (-771.641) * (-770.904) [-770.922] (-771.405) (-772.535) -- 0:00:00
998500 -- (-771.530) (-773.404) (-775.530) [-772.614] * (-770.546) (-772.175) (-772.282) [-773.927] -- 0:00:00
999000 -- [-770.676] (-770.943) (-771.515) (-771.270) * (-770.381) (-774.794) [-771.947] (-771.293) -- 0:00:00
999500 -- (-771.192) (-772.136) (-774.592) [-770.586] * (-771.179) (-779.524) (-771.972) [-774.046] -- 0:00:00
1000000 -- (-772.252) (-775.071) [-773.179] (-773.606) * (-773.789) [-774.333] (-773.797) (-772.710) -- 0:00:00
Average standard deviation of split frequencies: 0.008332
Analysis completed in 1 mins 1 seconds
Analysis used 59.88 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -769.52
Likelihood of best state for "cold" chain of run 2 was -769.52
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.4 % ( 34 %) Dirichlet(Pi{all})
30.6 % ( 28 %) Slider(Pi{all})
79.2 % ( 55 %) Multiplier(Alpha{1,2})
77.7 % ( 56 %) Multiplier(Alpha{3})
23.0 % ( 28 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 59 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.7 % ( 28 %) Dirichlet(Pi{all})
31.2 % ( 25 %) Slider(Pi{all})
79.3 % ( 60 %) Multiplier(Alpha{1,2})
77.7 % ( 58 %) Multiplier(Alpha{3})
22.1 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167500 0.82 0.67
3 | 167096 166081 0.84
4 | 166633 166330 166360
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166642 0.82 0.67
3 | 166798 166572 0.84
4 | 166798 166825 166365
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -771.42
| 2 1 1 2 2 2 1 2 |
| 2 2 2 11 12 |
| 2 2 1 1 1 2 1 2 |
| 2 2 2 1 1 1 1 2 |
| 1 * 1 2 11 1 2 1 1 2 |
| 2 1 22 2 2 1 *2 2 2 1 2 2 * 1 1|
|*1 1 2 2 1 2 2 2 2 2 2 |
| *1 2 2 2 1 1 2 1 |
| 1 2 2 1 1 11 2 1 2 1 1 1 |
| 1 1 2 2 21 1 2 1 2 |
| 1 * * |
| 1 1 1 1 |
| 2 |
| 1 |
| 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -772.90
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.26 -774.57
2 -771.24 -774.49
--------------------------------------
TOTAL -771.25 -774.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890083 0.086225 0.365869 1.483477 0.861010 1501.00 1501.00 1.000
r(A<->C){all} 0.163753 0.018611 0.000015 0.431572 0.127768 139.96 155.84 1.008
r(A<->G){all} 0.166838 0.020197 0.000143 0.448462 0.125792 240.74 252.51 1.005
r(A<->T){all} 0.174781 0.021402 0.000110 0.472429 0.136649 183.24 196.39 1.000
r(C<->G){all} 0.159894 0.018443 0.000134 0.427793 0.121892 170.58 229.88 1.000
r(C<->T){all} 0.155123 0.018107 0.000077 0.415961 0.120349 251.04 311.70 1.000
r(G<->T){all} 0.179611 0.021697 0.000125 0.477631 0.140397 173.93 217.83 1.000
pi(A){all} 0.204286 0.000273 0.170463 0.234631 0.204034 1070.29 1101.63 1.000
pi(C){all} 0.358696 0.000392 0.319227 0.396658 0.358595 1045.96 1132.84 1.000
pi(G){all} 0.272190 0.000328 0.237122 0.305993 0.271941 997.24 1143.90 1.000
pi(T){all} 0.164829 0.000233 0.136801 0.194738 0.164560 1233.05 1286.00 1.001
alpha{1,2} 0.439401 0.259233 0.000190 1.461941 0.255873 1115.27 1185.70 1.000
alpha{3} 0.438784 0.216229 0.000314 1.397965 0.289855 1294.38 1306.40 1.000
pinvar{all} 0.997208 0.000011 0.990790 0.999998 0.998314 1234.94 1342.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*...*
9 -- ....**
10 -- .*.*..
11 -- .*..*.
12 -- .****.
13 -- .***.*
14 -- ..*..*
15 -- ...*.*
16 -- .**.**
17 -- ...**.
18 -- ..****
19 -- .**...
20 -- ..**..
21 -- .*.***
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.000471 0.155230 0.155896 2
8 453 0.150899 0.011777 0.142572 0.159227 2
9 444 0.147901 0.019786 0.133911 0.161892 2
10 437 0.145570 0.009893 0.138574 0.152565 2
11 436 0.145237 0.004711 0.141905 0.148568 2
12 436 0.145237 0.016017 0.133911 0.156562 2
13 436 0.145237 0.003769 0.142572 0.147901 2
14 431 0.143571 0.013662 0.133911 0.153231 2
15 426 0.141905 0.016959 0.129913 0.153897 2
16 422 0.140573 0.007537 0.135243 0.145903 2
17 418 0.139241 0.005653 0.135243 0.143238 2
18 417 0.138907 0.008009 0.133245 0.144570 2
19 413 0.137575 0.003298 0.135243 0.139907 2
20 408 0.135909 0.000000 0.135909 0.135909 2
21 408 0.135909 0.000000 0.135909 0.135909 2
22 289 0.096269 0.011777 0.087941 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098612 0.009808 0.000028 0.295904 0.070265 1.000 2
length{all}[2] 0.099911 0.009937 0.000009 0.287430 0.069604 1.000 2
length{all}[3] 0.097815 0.009359 0.000043 0.290972 0.068232 1.000 2
length{all}[4] 0.100444 0.010130 0.000017 0.308768 0.070434 1.000 2
length{all}[5] 0.096765 0.009119 0.000058 0.287730 0.067735 1.000 2
length{all}[6] 0.099434 0.009905 0.000000 0.288446 0.069487 1.000 2
length{all}[7] 0.100538 0.010761 0.000021 0.330968 0.065578 1.000 2
length{all}[8] 0.102208 0.009018 0.001289 0.305501 0.071345 1.000 2
length{all}[9] 0.095141 0.008937 0.000058 0.285220 0.066677 1.012 2
length{all}[10] 0.092104 0.008859 0.000113 0.301013 0.062303 0.998 2
length{all}[11] 0.094671 0.007929 0.000440 0.261272 0.069494 0.999 2
length{all}[12] 0.098236 0.010550 0.000152 0.325872 0.062848 0.998 2
length{all}[13] 0.088843 0.007272 0.000736 0.253314 0.065641 0.998 2
length{all}[14] 0.094829 0.009517 0.000028 0.299673 0.066094 1.000 2
length{all}[15] 0.101781 0.009922 0.000158 0.301131 0.074260 0.999 2
length{all}[16] 0.108091 0.012533 0.000094 0.341310 0.075106 0.998 2
length{all}[17] 0.096724 0.009452 0.000312 0.289279 0.064921 0.998 2
length{all}[18] 0.101766 0.009490 0.000201 0.287162 0.074384 0.999 2
length{all}[19] 0.105258 0.012087 0.000392 0.313382 0.068141 1.010 2
length{all}[20] 0.098698 0.009711 0.000055 0.327452 0.068499 1.009 2
length{all}[21] 0.095858 0.008452 0.000247 0.282243 0.071329 0.998 2
length{all}[22] 0.093052 0.010817 0.000195 0.299197 0.057963 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008332
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 573
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 191 / 191 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 191 / 191 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060609 0.010483 0.043900 0.077067 0.031221 0.106454 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -803.484839
Iterating by ming2
Initial: fx= 803.484839
x= 0.06061 0.01048 0.04390 0.07707 0.03122 0.10645 0.30000 1.30000
1 h-m-p 0.0000 0.0001 459.1574 ++ 791.791276 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0145 40.5401 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 419.2759 ++ 772.395035 m 0.0001 44 | 2/8
4 h-m-p 0.0013 0.0215 32.6717 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 375.9475 ++ 762.843731 m 0.0001 75 | 3/8
6 h-m-p 0.0009 0.0389 25.3275 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 325.7907 ++ 753.356374 m 0.0001 106 | 4/8
8 h-m-p 0.0013 0.0722 18.8821 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 266.3399 ++ 747.090058 m 0.0001 137 | 5/8
10 h-m-p 0.0013 0.1111 12.5469 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 188.3941 ++ 741.450733 m 0.0002 168 | 6/8
12 h-m-p 0.7517 8.0000 0.0000 ++ 741.450733 m 8.0000 179 | 6/8
13 h-m-p 0.0256 8.0000 0.0023 ----C 741.450733 0 0.0000 196 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 ----C 741.450733 0 0.0000 213 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 741.450733 m 8.0000 229 | 6/8
16 h-m-p 0.0160 8.0000 0.6324 +++++ 741.450721 m 8.0000 245 | 6/8
17 h-m-p 1.6000 8.0000 0.4348 ++ 741.450720 m 8.0000 258 | 6/8
18 h-m-p 1.6000 8.0000 1.6410 Y 741.450720 0 3.9664 271 | 6/8
19 h-m-p 1.6000 8.0000 3.9004 ---------C 741.450720 0 0.0000 291 | 6/8
20 h-m-p 1.6000 8.0000 0.0000 C 741.450720 0 1.6000 302 | 6/8
21 h-m-p 0.8454 8.0000 0.0000 -C 741.450720 0 0.0528 316 | 6/8
22 h-m-p 0.1345 8.0000 0.0000 ---Y 741.450720 0 0.0005 332
Out..
lnL = -741.450720
333 lfun, 333 eigenQcodon, 1998 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077051 0.060193 0.078324 0.059493 0.049825 0.070257 15.343590 0.774764 0.184878
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 1.641634
np = 9
lnL0 = -811.612201
Iterating by ming2
Initial: fx= 811.612201
x= 0.07705 0.06019 0.07832 0.05949 0.04982 0.07026 15.34359 0.77476 0.18488
1 h-m-p 0.0000 0.0003 413.3636 +++ 759.700794 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0003 187.5843 ++ 750.444724 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0001 327.0060 ++ 749.406833 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 40552.2351 ++ 744.120932 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0002 14.3579 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 321.3521 ++ 743.249106 m 0.0000 82 | 5/9
7 h-m-p 0.0004 0.0436 6.0193 ----------.. | 5/9
8 h-m-p 0.0000 0.0000 262.9313 ++ 741.605804 m 0.0000 114 | 6/9
9 h-m-p 0.0010 0.0569 4.6221 -----------.. | 6/9
10 h-m-p 0.0000 0.0000 187.2383 ++ 741.450683 m 0.0000 147 | 7/9
11 h-m-p 1.3232 8.0000 0.0000 Y 741.450683 0 1.3232 159 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 -N 741.450683 0 0.0010 174
Out..
lnL = -741.450683
175 lfun, 525 eigenQcodon, 2100 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.091288 0.104027 0.078555 0.040461 0.100403 0.074264 15.343857 1.647490 0.240545 0.343794 1.735589
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.236834
np = 11
lnL0 = -827.021699
Iterating by ming2
Initial: fx= 827.021699
x= 0.09129 0.10403 0.07856 0.04046 0.10040 0.07426 15.34386 1.64749 0.24055 0.34379 1.73559
1 h-m-p 0.0000 0.0002 402.7202 +++ 786.719135 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0009 212.5911 ++ 754.965728 m 0.0009 31 | 2/11
3 h-m-p 0.0000 0.0000 998.9187 ++ 751.496443 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 724.2344 ++ 745.916234 m 0.0002 59 | 4/11
5 h-m-p 0.0014 0.0070 5.6459 -----------.. | 4/11
6 h-m-p 0.0000 0.0000 317.8444 ++ 744.599472 m 0.0000 96 | 5/11
7 h-m-p 0.0160 8.0000 2.3898 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 260.7291 ++ 741.979165 m 0.0000 135 | 6/11
9 h-m-p 0.0160 8.0000 1.3543 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 187.0459 ++ 741.450693 m 0.0000 174 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 741.450693 m 8.0000 191 | 7/11
12 h-m-p 0.0160 8.0000 0.0023 -------Y 741.450693 0 0.0000 216 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 741.450693 m 8.0000 266 | 7/11
15 h-m-p 0.0160 8.0000 1.8426 -----------C 741.450693 0 0.0000 295 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 741.450693 m 8.0000 312 | 7/11
17 h-m-p 0.0041 2.0741 4.7190 ---------Y 741.450693 0 0.0000 339 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 741.450693 m 8.0000 356 | 7/11
19 h-m-p 0.0144 7.2032 1.0699 +++++ 741.450653 m 7.2032 377 | 7/11
20 h-m-p -0.0000 -0.0000 0.1276
h-m-p: -0.00000000e+00 -0.00000000e+00 1.27568973e-01 741.450653
.. | 8/11
21 h-m-p 0.0160 8.0000 0.0000 -N 741.450653 0 0.0010 407 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 741.450653 m 8.0000 427 | 8/11
23 h-m-p 0.0160 8.0000 0.3604 ---------C 741.450653 0 0.0000 453 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 ----C 741.450653 0 0.0000 474 | 8/11
25 h-m-p 0.0160 8.0000 0.0000 ---Y 741.450653 0 0.0001 494
Out..
lnL = -741.450653
495 lfun, 1980 eigenQcodon, 8910 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -741.474745 S = -741.451120 -0.009069
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:04
did 20 / 50 patterns 0:04
did 30 / 50 patterns 0:04
did 40 / 50 patterns 0:04
did 50 / 50 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039578 0.036843 0.039388 0.102753 0.036610 0.017694 18.374894 0.203789 1.674088
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 2.043142
np = 9
lnL0 = -790.400371
Iterating by ming2
Initial: fx= 790.400371
x= 0.03958 0.03684 0.03939 0.10275 0.03661 0.01769 18.37489 0.20379 1.67409
1 h-m-p 0.0000 0.0001 428.1546 ++ 772.067620 m 0.0001 14 | 1/9
2 h-m-p 0.0029 0.0888 13.3999 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 398.7301 ++ 754.930656 m 0.0001 48 | 2/9
4 h-m-p 0.0088 0.1014 4.3158 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 364.9232 ++ 754.757416 m 0.0000 83 | 3/9
6 h-m-p 0.0001 0.0357 6.0817 ---------.. | 3/9
7 h-m-p 0.0000 0.0000 314.4473 ++ 753.350052 m 0.0000 114 | 4/9
8 h-m-p 0.0005 0.0267 7.7320 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 255.0660 ++ 753.280998 m 0.0000 147 | 5/9
10 h-m-p 0.0000 0.0213 9.3287 ---------.. | 5/9
11 h-m-p 0.0000 0.0004 175.0869 +++ 741.450668 m 0.0004 179 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 741.450668 m 8.0000 191 | 6/9
13 h-m-p 0.0160 8.0000 0.0023 ----Y 741.450668 0 0.0000 210 | 6/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 741.450668 m 8.0000 228 | 6/9
15 h-m-p 0.0160 8.0000 0.8881 +++++ 741.450662 m 8.0000 246 | 6/9
16 h-m-p 1.6000 8.0000 0.4453 ++ 741.450661 m 8.0000 261 | 6/9
17 h-m-p 0.4375 8.0000 8.1422 +++ 741.450640 m 8.0000 277 | 6/9
18 h-m-p 0.2065 1.0325 75.0710 ------------C 741.450640 0 0.0000 301 | 6/9
19 h-m-p 0.0232 8.0000 0.0000 -----N 741.450640 0 0.0000 318 | 6/9
20 h-m-p 0.0160 8.0000 0.0000 Y 741.450640 0 0.0160 333
Out..
lnL = -741.450640
334 lfun, 3674 eigenQcodon, 20040 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069569 0.072766 0.089602 0.027385 0.081526 0.037264 2.835996 0.900000 0.386033 1.113293 1.594065
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.726083
np = 11
lnL0 = -807.292788
Iterating by ming2
Initial: fx= 807.292788
x= 0.06957 0.07277 0.08960 0.02739 0.08153 0.03726 2.83600 0.90000 0.38603 1.11329 1.59407
1 h-m-p 0.0000 0.0002 399.4688 +++ 780.096846 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0003 179.7184 ++ 771.205060 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0002 673.4454 ++ 747.896368 m 0.0002 45 | 3/11
4 h-m-p 0.0003 0.0016 46.9332 ++ 746.159115 m 0.0016 59 | 4/11
5 h-m-p 0.0000 0.0002 1799.0135 ++ 744.131052 m 0.0002 73 | 5/11
6 h-m-p 0.0017 0.0083 26.1330 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 262.9155 ++ 742.759871 m 0.0000 110 | 6/11
8 h-m-p 0.0005 0.0482 7.7275 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 186.8634 ++ 741.450704 m 0.0000 147 | 7/11
10 h-m-p 0.1447 8.0000 0.0000 +++ 741.450704 m 8.0000 162 | 7/11
11 h-m-p 0.0347 8.0000 0.0020 -----Y 741.450704 0 0.0000 185 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 741.450704 m 8.0000 206 | 7/11
13 h-m-p 0.0160 8.0000 0.2482 ----------Y 741.450704 0 0.0000 234 | 7/11
14 h-m-p 0.0160 8.0000 0.0017 +++++ 741.450704 m 8.0000 255 | 7/11
15 h-m-p 0.0160 5.6656 0.8294 --------C 741.450704 0 0.0000 281 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 741.450703 m 8.0000 331 | 7/11
18 h-m-p 0.0038 1.9083 0.3357 ---------Y 741.450703 0 0.0000 358 | 7/11
19 h-m-p 0.0160 8.0000 0.0128 +++++ 741.450693 m 8.0000 379 | 7/11
20 h-m-p 0.2846 2.0608 0.3595 -------------C 741.450693 0 0.0000 410 | 7/11
21 h-m-p 0.0003 0.1331 2.0846 +++++ 741.450627 m 0.1331 431 | 8/11
22 h-m-p 1.6000 8.0000 0.0072 ++ 741.450627 m 8.0000 445 | 8/11
23 h-m-p 0.0046 0.6166 12.3588 +++
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
+ 741.450579 m 0.6166 464
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.038785e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
| 9/11
24 h-m-p 0.1805 0.9024 8.6960
QuantileBeta(0.15, 0.00500, 2.23456) = 1.170958e-160 2000 rounds
++ 741.450579 m 0.9024 478 | 9/11
25 h-m-p 1.5804 8.0000 4.9655
QuantileBeta(0.15, 0.00500, 2.53087) = 1.003744e-160 2000 rounds
-----------Y 741.450579 0 0.0000 503 | 9/11
26 h-m-p 0.0160 8.0000 10.8544 ---------Y 741.450579 0 0.0000 526 | 10/11
27 h-m-p 0.0160 8.0000 2.0493 ++
QuantileBeta(0.15, 0.00500, 3.14776) = 7.731192e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.44316) = 2.302567e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
+ 741.450579 m 8.0000 543
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.258406e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44359) = 1.215957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44358) = 1.215957e-161 2000 rounds
| 10/11
28 h-m-p 1.6000 8.0000 1.6394
QuantileBeta(0.15, 0.00500, 14.82049) = 1.438562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.78781) = 1.264891e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.27964) = 1.227832e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.40259) = 1.218905e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.43333) = 1.216693e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44326) = 1.215980e-161 2000 rounds
Y 741.450579 0 0.0016 561
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.258596e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
| 10/11
29 h-m-p 1.6000 8.0000 0.0013
QuantileBeta(0.15, 0.00500, 17.44307) = 1.215994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44153) = 1.216104e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44102) = 1.216141e-161 2000 rounds
Y 741.450579 0 0.1000 576
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.258587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44154) = 1.216104e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44075) = 1.216160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
| 10/11
30 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
C 741.450579 0 0.4000 591
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.258587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44154) = 1.216104e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44075) = 1.216160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
| 10/11
31 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
Y 741.450579 0 0.0000 616
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
Out..
lnL = -741.450579
617 lfun, 7404 eigenQcodon, 40722 P(t)
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -741.483536 S = -741.451090 -0.014316
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:19
did 20 / 50 patterns 0:20
did 30 / 50 patterns 0:20
did 40 / 50 patterns 0:20
did 50 / 50 patterns 0:20
QuantileBeta(0.15, 0.00500, 17.44114) = 1.216132e-161 2000 rounds
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=191
NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
NC_002677_1_NP_302151_1_1023_ML1677 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV
**************************************************
NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
NC_002677_1_NP_302151_1_1023_ML1677 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT
**************************************************
NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
NC_002677_1_NP_302151_1_1023_ML1677 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV
**************************************************
NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
NC_002677_1_NP_302151_1_1023_ML1677 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
*****************************************
>NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC >NC_002677_1_NP_302151_1_1023_ML1677 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC >NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC >NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC >NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC >NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 GTGACGAGCAACTCCGACGCTGGTTCTGCTGTCGACGCAGGCGGGCCACC ACGCACCGTGATTATCGCCGCAGTGGTGCTGACAGCAGCAACGATCGGCA CAATCTTGGTCCTCGCAGCAACCCTCCACGAGCCACCACAGCCAGTTGTC ATTACTGCCGTCCCAGCCCCGCAGGCCACCACTGCCGCATGCCGATCGCT GACGCAAGCACTGCCTCAGCGGCTCGGCGACTATGAGCGTGCACCTGTCG CGCAACCAGCGCCCGACGCCGTAGCCGCCTGGCGAACCGGCTCAGACACC GAGCCAGTGGTGCTGCGCTGCGGACTCGACGGCCCAGCCGAATTCGTTGT GGGTTCCCCAATCCAAGCCGTCGATCAAGTGCAGTGGTTTGAGGTGGACG CCAAACCAAAACCCGCCATTGATGCCGGCAGATCCACCTGGTACACAGTA GACCGACCAGTGTATGTCGCATTGACACTGCCATCTGGATCGGGACCGAC ACCCATCCAAGAACTCTCCGACGTGATCGACCGGACCTTGGCGGCCATCC CGATCAGCCCGGCTCAGTCTCAC
>NC_011896_1_WP_010908472_1_1782_MLBR_RS08445 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH >NC_002677_1_NP_302151_1_1023_ML1677 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH >NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH >NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH >NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH >NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445 VTSNSDAGSAVDAGGPPRTVIIAAVVLTAATIGTILVLAATLHEPPQPVV ITAVPAPQATTAACRSLTQALPQRLGDYERAPVAQPAPDAVAAWRTGSDT EPVVLRCGLDGPAEFVVGSPIQAVDQVQWFEVDAKPKPAIDAGRSTWYTV DRPVYVALTLPSGSGPTPIQELSDVIDRTLAAIPISPAQSH
#NEXUS
[ID: 5649937995]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908472_1_1782_MLBR_RS08445
NC_002677_1_NP_302151_1_1023_ML1677
NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085
NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415
NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210
NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908472_1_1782_MLBR_RS08445,
2 NC_002677_1_NP_302151_1_1023_ML1677,
3 NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085,
4 NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415,
5 NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210,
6 NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07026504,2:0.0696038,3:0.0682315,4:0.07043394,5:0.06773451,6:0.06948658);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07026504,2:0.0696038,3:0.0682315,4:0.07043394,5:0.06773451,6:0.06948658);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.26 -774.57
2 -771.24 -774.49
--------------------------------------
TOTAL -771.25 -774.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1677/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890083 0.086225 0.365869 1.483477 0.861010 1501.00 1501.00 1.000
r(A<->C){all} 0.163753 0.018611 0.000015 0.431572 0.127768 139.96 155.84 1.008
r(A<->G){all} 0.166838 0.020197 0.000143 0.448462 0.125792 240.74 252.51 1.005
r(A<->T){all} 0.174781 0.021402 0.000110 0.472429 0.136649 183.24 196.39 1.000
r(C<->G){all} 0.159894 0.018443 0.000134 0.427793 0.121892 170.58 229.88 1.000
r(C<->T){all} 0.155123 0.018107 0.000077 0.415961 0.120349 251.04 311.70 1.000
r(G<->T){all} 0.179611 0.021697 0.000125 0.477631 0.140397 173.93 217.83 1.000
pi(A){all} 0.204286 0.000273 0.170463 0.234631 0.204034 1070.29 1101.63 1.000
pi(C){all} 0.358696 0.000392 0.319227 0.396658 0.358595 1045.96 1132.84 1.000
pi(G){all} 0.272190 0.000328 0.237122 0.305993 0.271941 997.24 1143.90 1.000
pi(T){all} 0.164829 0.000233 0.136801 0.194738 0.164560 1233.05 1286.00 1.001
alpha{1,2} 0.439401 0.259233 0.000190 1.461941 0.255873 1115.27 1185.70 1.000
alpha{3} 0.438784 0.216229 0.000314 1.397965 0.289855 1294.38 1306.40 1.000
pinvar{all} 0.997208 0.000011 0.990790 0.999998 0.998314 1234.94 1342.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1677/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 191
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 4 4 4 4 4 4 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 5 5 5 5 5 5 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 13 13 13 13 13 13 | Gln CAA 5 5 5 5 5 5 | CGA 3 3 3 3 3 3
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 7 7 7 7 7 7 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 5 5 5 5 5 5 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 0 0 0 0 0 0 | ACG 3 3 3 3 3 3 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 7 7 7 7 7 7 | GCC 14 14 14 14 14 14 | GAC 10 10 10 10 10 10 | GGC 6 6 6 6 6 6
GTA 2 2 2 2 2 2 | GCA 10 10 10 10 10 10 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 11 11 11 11 11 11 | GCG 3 3 3 3 3 3 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908472_1_1782_MLBR_RS08445
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
#2: NC_002677_1_NP_302151_1_1023_ML1677
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
#3: NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
#4: NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
#5: NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
#6: NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 0
TTC 6 | TCC 24 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 6
CTC 30 | CCC 18 | CAC 12 | CGC 12
CTA 0 | CCA 78 | Gln Q CAA 30 | CGA 18
CTG 30 | CCG 24 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 48 | ACC 42 | AAC 6 | AGC 12
ATA 0 | ACA 30 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 0 | ACG 18 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 12 | Gly G GGT 12
GTC 42 | GCC 84 | GAC 60 | GGC 36
GTA 12 | GCA 60 | Glu E GAA 12 | GGA 18
GTG 66 | GCG 18 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12042 C:0.27225 A:0.17801 G:0.42932
position 2: T:0.25131 C:0.41361 A:0.18848 G:0.14660
position 3: T:0.12042 C:0.39267 A:0.24607 G:0.24084
Average T:0.16405 C:0.35951 A:0.20419 G:0.27225
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -741.450720 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.343590 1.594065
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908472_1_1782_MLBR_RS08445: 0.000004, NC_002677_1_NP_302151_1_1023_ML1677: 0.000004, NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085: 0.000004, NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415: 0.000004, NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210: 0.000004, NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.34359
omega (dN/dS) = 1.59407
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
7..2 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
7..3 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
7..4 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
7..5 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
7..6 0.000 390.5 182.5 1.5941 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -741.450683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.343857 0.738417 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908472_1_1782_MLBR_RS08445: 0.000004, NC_002677_1_NP_302151_1_1023_ML1677: 0.000004, NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085: 0.000004, NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415: 0.000004, NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210: 0.000004, NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.34386
MLEs of dN/dS (w) for site classes (K=2)
p: 0.73842 0.26158
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
7..2 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
7..3 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
7..4 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
7..5 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
7..6 0.000 390.5 182.5 0.2616 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -741.450653 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 18.374894 0.998160 0.001624 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908472_1_1782_MLBR_RS08445: 0.000004, NC_002677_1_NP_302151_1_1023_ML1677: 0.000004, NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085: 0.000004, NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415: 0.000004, NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210: 0.000004, NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 18.37489
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99816 0.00162 0.00022
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
7..2 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
7..3 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
7..4 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
7..5 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
7..6 0.000 390.4 182.6 0.0018 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908472_1_1782_MLBR_RS08445)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -741.450640 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 2.835996 4.375011 75.751611
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908472_1_1782_MLBR_RS08445: 0.000004, NC_002677_1_NP_302151_1_1023_ML1677: 0.000004, NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085: 0.000004, NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415: 0.000004, NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210: 0.000004, NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.83600
Parameters in M7 (beta):
p = 4.37501 q = 75.75161
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02029 0.02946 0.03608 0.04204 0.04791 0.05406 0.06092 0.06916 0.08038 0.10148
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
7..2 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
7..3 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
7..4 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
7..5 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
7..6 0.000 392.1 180.9 0.0542 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -741.450579 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 17.441143 1.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908472_1_1782_MLBR_RS08445: 0.000004, NC_002677_1_NP_302151_1_1023_ML1677: 0.000004, NZ_LVXE01000025_1_WP_010908472_1_1046_A3216_RS08085: 0.000004, NZ_LYPH01000028_1_WP_010908472_1_1128_A8144_RS05415: 0.000004, NZ_CP029543_1_WP_010908472_1_1810_DIJ64_RS09210: 0.000004, NZ_AP014567_1_WP_010908472_1_1857_JK2ML_RS09445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 17.44114
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 395.1 177.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908472_1_1782_MLBR_RS08445)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:20
Model 1: NearlyNeutral -741.450683 Model 2: PositiveSelection -741.450653 Model 0: one-ratio -741.45072 Model 7: beta -741.45064 Model 8: beta&w>1 -741.450579 Model 0 vs 1 7.400000004054164E-5 Model 2 vs 1 6.000000007588824E-5 Model 8 vs 7 1.2200000014672696E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
