--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:18:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1680/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -880.84 -883.91
2 -880.85 -883.92
--------------------------------------
TOTAL -880.85 -883.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885604 0.084218 0.367232 1.472256 0.854557 1402.04 1451.52 1.000
r(A<->C){all} 0.178512 0.020122 0.000148 0.460281 0.148073 188.91 261.34 1.013
r(A<->G){all} 0.160698 0.017931 0.000005 0.425057 0.127385 161.15 189.78 1.000
r(A<->T){all} 0.162359 0.019323 0.000146 0.449142 0.126679 108.44 170.71 1.000
r(C<->G){all} 0.161741 0.018384 0.000111 0.441107 0.127129 93.01 176.10 1.001
r(C<->T){all} 0.170888 0.020380 0.000282 0.455869 0.134218 172.18 182.98 1.000
r(G<->T){all} 0.165803 0.020056 0.000341 0.450846 0.125095 236.53 341.57 1.003
pi(A){all} 0.196402 0.000248 0.166347 0.227652 0.196122 1261.80 1381.40 1.000
pi(C){all} 0.327191 0.000326 0.291271 0.361395 0.326879 1109.33 1238.42 1.000
pi(G){all} 0.291099 0.000315 0.257259 0.326906 0.291104 1287.43 1296.57 1.000
pi(T){all} 0.185308 0.000233 0.156838 0.215697 0.184858 1404.40 1421.99 1.001
alpha{1,2} 0.408426 0.224988 0.000118 1.358987 0.242435 1227.12 1252.45 1.000
alpha{3} 0.461412 0.244096 0.000444 1.427834 0.291508 1106.99 1238.74 1.000
pinvar{all} 0.997531 0.000009 0.992225 0.999997 0.998491 1336.57 1418.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -852.522276
Model 2: PositiveSelection -852.52228
Model 0: one-ratio -852.522287
Model 7: beta -852.522274
Model 8: beta&w>1 -852.522193
Model 0 vs 1 2.199999994445534E-5
Model 2 vs 1 7.999999979801942E-6
Model 8 vs 7 1.6200000004573667E-4
>C1
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C2
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C3
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C4
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C5
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C6
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216
C1 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C2 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C3 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C4 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C5 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C6 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
**************************************************
C1 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C2 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C3 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C4 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C5 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C6 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
**************************************************
C1 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C2 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C3 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C4 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C5 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C6 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
**************************************************
C1 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C2 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C3 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C4 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C5 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C6 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
**************************************************
C1 RRLGIGAATTRVVAHL
C2 RRLGIGAATTRVVAHL
C3 RRLGIGAATTRVVAHL
C4 RRLGIGAATTRVVAHL
C5 RRLGIGAATTRVVAHL
C6 RRLGIGAATTRVVAHL
****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6480]--->[6480]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.762 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C2 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C3 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C4 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C5 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
C6 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
**************************************************
C1 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C2 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C3 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C4 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C5 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
C6 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
**************************************************
C1 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C2 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C3 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C4 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C5 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
C6 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
**************************************************
C1 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C2 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C3 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C4 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C5 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
C6 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
**************************************************
C1 RRLGIGAATTRVVAHL
C2 RRLGIGAATTRVVAHL
C3 RRLGIGAATTRVVAHL
C4 RRLGIGAATTRVVAHL
C5 RRLGIGAATTRVVAHL
C6 RRLGIGAATTRVVAHL
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
C2 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
C3 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
C4 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
C5 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
C6 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
**************************************************
C1 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
C2 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
C3 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
C4 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
C5 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
C6 CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
**************************************************
C1 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
C2 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
C3 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
C4 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
C5 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
C6 CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
**************************************************
C1 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
C2 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
C3 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
C4 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
C5 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
C6 GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
**************************************************
C1 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
C2 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
C3 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
C4 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
C5 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
C6 TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
**************************************************
C1 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
C2 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
C3 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
C4 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
C5 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
C6 ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
**************************************************
C1 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
C2 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
C3 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
C4 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
C5 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
C6 GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
**************************************************
C1 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
C2 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
C3 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
C4 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
C5 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
C6 AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
**************************************************
C1 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
C2 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
C3 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
C4 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
C5 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
C6 CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
**************************************************
C1 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
C2 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
C3 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
C4 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
C5 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
C6 GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
**************************************************
C1 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
C2 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
C3 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
C4 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
C5 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
C6 TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
**************************************************
C1 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
C2 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
C3 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
C4 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
C5 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
C6 GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
**************************************************
C1 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
C2 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
C3 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
C4 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
C5 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
C6 CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
************************************************
>C1
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C2
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C3
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C4
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C5
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C6
ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC
CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA
CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC
GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA
TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG
ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT
GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG
AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG
CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC
GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA
TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT
GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA
CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>C1
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C2
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C3
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C4
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C5
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
>C6
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
RRLGIGAATTRVVAHL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 648 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857449
Setting output file names to "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 36935024
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5474653881
Seed = 980524091
Swapseed = 1579857449
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1450.255068 -- -24.965149
Chain 2 -- -1450.255068 -- -24.965149
Chain 3 -- -1450.254847 -- -24.965149
Chain 4 -- -1450.254985 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1450.254847 -- -24.965149
Chain 2 -- -1450.254985 -- -24.965149
Chain 3 -- -1450.254985 -- -24.965149
Chain 4 -- -1450.254985 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1450.255] (-1450.255) (-1450.255) (-1450.255) * [-1450.255] (-1450.255) (-1450.255) (-1450.255)
500 -- [-891.224] (-909.138) (-891.492) (-897.701) * (-896.902) (-893.031) (-893.766) [-893.387] -- 0:00:00
1000 -- (-884.560) (-901.769) [-890.052] (-895.571) * (-891.428) [-890.328] (-893.128) (-893.155) -- 0:00:00
1500 -- (-890.175) (-890.671) [-887.129] (-890.243) * [-893.096] (-890.146) (-894.051) (-889.294) -- 0:00:00
2000 -- (-887.228) (-890.008) [-884.015] (-888.116) * (-894.131) [-888.010] (-891.729) (-891.606) -- 0:00:00
2500 -- [-888.172] (-893.196) (-886.879) (-893.548) * (-887.867) [-889.363] (-890.162) (-887.031) -- 0:00:00
3000 -- (-889.161) [-885.134] (-890.164) (-887.587) * (-892.395) (-889.107) (-891.046) [-892.981] -- 0:05:32
3500 -- (-885.469) (-891.825) [-890.298] (-887.855) * (-890.646) (-892.880) (-891.315) [-891.317] -- 0:04:44
4000 -- [-889.530] (-892.065) (-888.386) (-890.316) * (-888.153) (-891.129) [-887.042] (-888.736) -- 0:04:09
4500 -- (-889.961) (-884.471) [-885.853] (-888.888) * (-886.703) (-889.914) [-892.905] (-892.076) -- 0:03:41
5000 -- (-890.680) (-891.843) [-890.836] (-891.805) * (-890.250) [-889.697] (-896.906) (-890.662) -- 0:03:19
Average standard deviation of split frequencies: 0.081983
5500 -- (-890.383) (-893.067) [-890.676] (-893.148) * (-888.343) (-888.840) (-887.549) [-889.126] -- 0:03:00
6000 -- [-892.001] (-887.443) (-895.762) (-887.021) * (-890.845) (-889.094) (-896.304) [-891.044] -- 0:02:45
6500 -- (-887.930) [-890.152] (-889.789) (-891.387) * (-887.825) [-890.319] (-901.733) (-897.398) -- 0:02:32
7000 -- (-888.000) (-897.024) [-891.485] (-889.083) * (-889.952) [-884.195] (-891.878) (-893.158) -- 0:02:21
7500 -- (-896.756) (-888.433) (-890.450) [-886.794] * (-888.789) (-891.280) (-894.319) [-886.097] -- 0:02:12
8000 -- (-883.447) (-887.992) (-893.905) [-890.912] * (-907.190) (-885.437) [-886.950] (-892.550) -- 0:02:04
8500 -- (-891.534) (-892.175) (-889.060) [-888.745] * (-890.421) (-904.103) (-888.038) [-888.699] -- 0:01:56
9000 -- (-889.289) (-886.934) [-886.145] (-889.036) * (-889.445) (-895.486) [-888.078] (-904.783) -- 0:01:50
9500 -- (-892.080) (-889.226) (-891.569) [-893.843] * (-898.148) (-890.165) (-886.270) [-886.199] -- 0:01:44
10000 -- (-891.537) (-889.126) [-886.605] (-886.481) * [-891.967] (-890.922) (-894.556) (-890.743) -- 0:01:39
Average standard deviation of split frequencies: 0.076859
10500 -- (-886.440) (-888.513) (-896.400) [-886.934] * (-901.872) (-888.380) [-889.896] (-898.807) -- 0:01:34
11000 -- [-885.795] (-888.133) (-888.871) (-897.597) * [-888.246] (-885.621) (-891.930) (-889.802) -- 0:01:29
11500 -- (-889.482) [-885.698] (-896.485) (-894.490) * (-890.510) (-898.643) (-891.734) [-884.371] -- 0:01:25
12000 -- (-892.896) (-890.980) [-891.650] (-897.195) * (-891.053) (-889.025) [-885.824] (-890.671) -- 0:01:22
12500 -- (-896.011) (-894.737) (-890.064) [-891.635] * (-896.604) (-887.085) (-891.864) [-894.306] -- 0:01:19
13000 -- (-888.801) (-890.500) (-894.736) [-890.579] * [-882.282] (-888.232) (-895.280) (-901.939) -- 0:01:15
13500 -- [-888.700] (-891.982) (-892.598) (-891.854) * (-885.410) (-889.754) (-884.162) [-890.022] -- 0:01:13
14000 -- (-885.124) [-892.277] (-889.636) (-893.657) * (-892.734) [-890.044] (-890.847) (-889.934) -- 0:01:10
14500 -- [-886.634] (-888.326) (-897.111) (-892.647) * (-882.737) (-887.185) (-901.275) [-884.517] -- 0:01:07
15000 -- (-886.238) (-890.464) (-890.695) [-887.467] * (-882.057) (-893.362) [-889.935] (-890.763) -- 0:01:05
Average standard deviation of split frequencies: 0.075130
15500 -- (-894.636) (-894.125) [-885.792] (-894.292) * (-881.847) [-889.805] (-889.389) (-890.435) -- 0:01:03
16000 -- (-899.005) (-894.883) (-893.561) [-888.622] * (-883.051) (-889.062) [-886.774] (-889.854) -- 0:01:01
16500 -- (-891.812) (-891.661) [-894.238] (-886.065) * (-884.003) (-891.373) (-889.627) [-891.069] -- 0:00:59
17000 -- (-889.670) (-886.933) (-887.400) [-889.491] * (-882.869) (-897.156) [-889.591] (-894.840) -- 0:00:57
17500 -- [-887.011] (-895.076) (-889.963) (-892.690) * (-880.871) [-898.064] (-887.135) (-890.982) -- 0:00:56
18000 -- [-897.190] (-895.196) (-890.918) (-890.725) * (-885.282) (-891.989) [-891.247] (-892.236) -- 0:00:54
18500 -- (-896.141) [-890.846] (-891.096) (-893.311) * (-881.462) (-891.971) [-890.111] (-886.946) -- 0:00:53
19000 -- [-890.940] (-893.938) (-900.591) (-887.469) * (-880.565) (-888.912) (-901.198) [-881.697] -- 0:01:43
19500 -- (-898.046) [-887.411] (-903.712) (-889.020) * [-879.832] (-894.152) (-892.639) (-883.977) -- 0:01:40
20000 -- (-895.810) (-897.050) (-896.119) [-887.382] * (-879.936) [-892.391] (-903.841) (-880.983) -- 0:01:38
Average standard deviation of split frequencies: 0.051622
20500 -- (-893.219) [-888.427] (-894.856) (-888.580) * [-879.755] (-894.960) (-895.925) (-881.727) -- 0:01:35
21000 -- (-883.926) [-889.147] (-911.187) (-901.504) * [-884.032] (-890.170) (-887.520) (-880.437) -- 0:01:33
21500 -- (-896.188) (-888.131) [-891.495] (-894.772) * (-880.619) (-888.282) (-902.473) [-880.565] -- 0:01:31
22000 -- (-890.323) [-889.705] (-885.941) (-881.728) * (-884.318) (-889.047) (-906.556) [-881.647] -- 0:01:28
22500 -- (-887.107) [-898.000] (-890.812) (-887.677) * (-885.004) (-884.701) (-884.091) [-880.599] -- 0:01:26
23000 -- (-890.641) (-891.034) [-895.794] (-886.115) * (-884.051) (-887.514) [-883.917] (-882.002) -- 0:01:24
23500 -- (-893.721) (-891.292) [-893.914] (-883.932) * (-887.119) [-887.336] (-881.727) (-880.465) -- 0:01:23
24000 -- (-889.689) (-895.454) [-890.738] (-882.370) * (-884.864) (-895.990) [-882.536] (-882.507) -- 0:01:21
24500 -- (-900.353) [-888.611] (-889.669) (-881.256) * (-886.233) [-891.038] (-879.763) (-886.232) -- 0:01:19
25000 -- [-888.057] (-889.699) (-895.181) (-880.881) * [-883.487] (-894.695) (-880.186) (-883.042) -- 0:01:18
Average standard deviation of split frequencies: 0.033789
25500 -- (-894.421) [-890.706] (-894.525) (-881.302) * (-880.475) [-884.698] (-880.921) (-880.941) -- 0:01:16
26000 -- (-903.592) [-888.681] (-894.425) (-882.333) * (-882.024) (-887.622) (-882.880) [-885.072] -- 0:01:14
26500 -- [-890.189] (-896.395) (-890.298) (-881.508) * (-881.289) (-889.921) (-882.461) [-881.109] -- 0:01:13
27000 -- (-889.312) (-886.878) [-891.055] (-881.732) * (-880.323) (-888.683) (-882.610) [-880.196] -- 0:01:12
27500 -- [-886.450] (-889.678) (-888.802) (-880.937) * [-880.595] (-886.985) (-880.211) (-880.820) -- 0:01:10
28000 -- (-887.631) [-891.833] (-891.673) (-880.490) * (-881.033) [-888.827] (-879.912) (-882.436) -- 0:01:09
28500 -- (-891.745) (-888.070) (-900.495) [-882.520] * (-881.880) (-888.752) (-881.048) [-881.767] -- 0:01:08
29000 -- (-887.145) [-893.779] (-891.092) (-880.260) * (-881.582) [-890.838] (-881.633) (-880.589) -- 0:01:06
29500 -- (-888.918) [-888.594] (-893.081) (-880.480) * (-883.919) [-891.818] (-879.466) (-883.404) -- 0:01:05
30000 -- (-904.725) (-891.947) [-892.356] (-879.668) * [-881.808] (-889.879) (-879.525) (-880.090) -- 0:01:04
Average standard deviation of split frequencies: 0.034587
30500 -- (-892.813) (-891.133) (-895.925) [-879.804] * (-881.130) (-899.654) (-880.533) [-879.543] -- 0:01:03
31000 -- (-888.709) (-893.618) [-885.798] (-882.424) * [-881.743] (-895.647) (-879.790) (-879.984) -- 0:01:02
31500 -- (-891.633) (-893.948) [-889.771] (-881.361) * (-883.247) (-887.983) [-880.455] (-880.454) -- 0:01:01
32000 -- [-891.380] (-885.336) (-892.106) (-881.553) * [-887.833] (-888.540) (-879.660) (-880.913) -- 0:01:00
32500 -- (-898.699) (-892.110) (-892.134) [-880.741] * (-881.686) (-905.177) [-884.251] (-882.286) -- 0:00:59
33000 -- [-893.521] (-890.570) (-889.769) (-879.630) * (-880.385) [-889.164] (-881.330) (-881.860) -- 0:00:58
33500 -- (-893.453) (-890.121) [-885.322] (-879.551) * (-879.750) (-894.161) [-883.635] (-880.981) -- 0:00:57
34000 -- (-897.290) (-894.000) (-890.894) [-880.726] * (-881.005) [-891.833] (-882.045) (-880.153) -- 0:00:56
34500 -- (-894.644) (-897.304) [-891.529] (-885.554) * [-879.749] (-896.871) (-880.899) (-879.876) -- 0:00:55
35000 -- [-888.575] (-886.024) (-890.650) (-881.438) * (-880.255) (-895.366) (-880.076) [-880.455] -- 0:00:55
Average standard deviation of split frequencies: 0.033672
35500 -- (-891.074) [-887.479] (-890.098) (-879.619) * (-880.734) (-890.588) (-882.246) [-880.232] -- 0:01:21
36000 -- [-886.620] (-892.012) (-884.812) (-880.488) * [-880.040] (-888.497) (-882.026) (-880.901) -- 0:01:20
36500 -- (-888.958) (-890.144) [-890.930] (-879.805) * [-879.615] (-888.857) (-880.477) (-881.333) -- 0:01:19
37000 -- (-887.900) (-889.771) [-888.978] (-879.967) * (-882.896) [-883.033] (-881.265) (-884.106) -- 0:01:18
37500 -- (-892.150) [-888.045] (-893.832) (-879.614) * (-879.554) [-890.139] (-880.558) (-880.487) -- 0:01:17
38000 -- (-889.236) (-889.536) (-885.939) [-880.924] * (-880.654) (-893.269) [-880.824] (-880.404) -- 0:01:15
38500 -- (-890.366) (-888.427) (-882.191) [-885.370] * (-880.568) (-897.572) (-879.888) [-882.130] -- 0:01:14
39000 -- (-890.584) (-889.748) [-881.576] (-886.814) * [-881.262] (-885.881) (-882.770) (-880.092) -- 0:01:13
39500 -- (-893.611) [-890.814] (-882.734) (-883.180) * (-883.368) (-888.008) (-880.927) [-880.691] -- 0:01:12
40000 -- (-892.796) (-885.578) [-880.550] (-880.910) * (-887.906) [-888.875] (-881.788) (-880.640) -- 0:01:12
Average standard deviation of split frequencies: 0.029808
40500 -- [-890.521] (-887.872) (-881.296) (-882.128) * [-882.065] (-894.131) (-883.929) (-880.798) -- 0:01:11
41000 -- (-892.537) [-890.092] (-883.007) (-879.818) * (-880.559) (-889.133) [-880.364] (-890.507) -- 0:01:10
41500 -- (-893.687) (-904.286) (-880.730) [-881.245] * (-882.850) (-898.434) (-880.059) [-883.644] -- 0:01:09
42000 -- [-890.647] (-891.894) (-880.490) (-880.885) * (-882.344) (-888.836) (-880.853) [-882.120] -- 0:01:08
42500 -- [-887.244] (-898.286) (-879.507) (-883.152) * (-881.059) (-883.168) (-881.418) [-880.337] -- 0:01:07
43000 -- [-889.746] (-889.590) (-879.978) (-881.159) * (-881.212) (-881.745) [-880.758] (-879.553) -- 0:01:06
43500 -- (-896.408) (-884.723) (-880.876) [-880.989] * (-881.060) (-884.036) (-880.842) [-883.210] -- 0:01:05
44000 -- (-887.246) [-881.317] (-880.481) (-881.415) * (-882.782) (-884.364) (-882.436) [-884.345] -- 0:01:05
44500 -- (-895.060) (-881.882) (-881.174) [-883.427] * (-883.212) (-882.630) [-881.634] (-885.357) -- 0:01:04
45000 -- [-893.799] (-882.679) (-881.393) (-882.747) * (-885.498) [-883.333] (-880.922) (-882.373) -- 0:01:03
Average standard deviation of split frequencies: 0.026734
45500 -- (-888.963) (-881.403) (-881.077) [-882.958] * [-879.520] (-883.471) (-881.047) (-883.666) -- 0:01:02
46000 -- [-893.368] (-880.823) (-880.052) (-880.718) * (-879.921) (-881.354) (-885.158) [-883.732] -- 0:01:02
46500 -- [-889.193] (-879.873) (-880.876) (-880.115) * (-880.355) (-880.911) (-883.536) [-879.865] -- 0:01:01
47000 -- (-894.031) (-879.603) (-879.942) [-880.787] * (-884.694) (-882.354) [-883.460] (-882.977) -- 0:01:00
47500 -- (-887.269) (-881.458) (-881.508) [-880.217] * (-886.007) [-880.326] (-882.924) (-882.290) -- 0:01:00
48000 -- (-887.281) (-884.770) (-880.835) [-880.006] * (-886.959) (-881.380) [-882.607] (-880.987) -- 0:00:59
48500 -- (-890.353) [-882.991] (-883.570) (-880.484) * (-883.418) (-881.128) [-881.547] (-883.032) -- 0:00:58
49000 -- [-889.249] (-880.192) (-881.383) (-880.975) * (-882.692) (-881.281) [-881.992] (-882.561) -- 0:00:58
49500 -- (-894.757) (-881.363) [-881.835] (-881.574) * (-881.388) (-881.520) (-884.212) [-880.653] -- 0:00:57
50000 -- (-887.848) (-885.254) [-881.430] (-880.617) * (-883.982) (-880.804) (-883.366) [-879.355] -- 0:00:57
Average standard deviation of split frequencies: 0.023725
50500 -- (-892.996) [-881.442] (-881.079) (-883.503) * (-879.674) (-884.793) (-883.717) [-880.157] -- 0:00:56
51000 -- [-886.340] (-882.469) (-880.791) (-881.757) * (-882.328) (-881.764) [-881.848] (-880.677) -- 0:00:55
51500 -- (-889.197) [-881.549] (-884.172) (-880.661) * (-880.002) (-880.065) (-885.301) [-882.272] -- 0:01:13
52000 -- (-888.899) [-882.670] (-880.843) (-882.662) * [-879.442] (-881.188) (-881.065) (-881.118) -- 0:01:12
52500 -- (-893.865) [-883.684] (-882.097) (-881.152) * (-883.059) (-879.605) [-880.155] (-881.470) -- 0:01:12
53000 -- (-901.295) (-879.783) [-880.896] (-885.329) * [-880.874] (-880.583) (-881.357) (-881.773) -- 0:01:11
53500 -- (-891.815) (-882.398) [-882.688] (-882.003) * (-883.594) (-881.960) (-880.850) [-880.712] -- 0:01:10
54000 -- (-889.515) (-881.565) (-879.673) [-881.482] * (-885.124) (-881.322) (-880.370) [-880.161] -- 0:01:10
54500 -- (-889.731) [-879.288] (-881.114) (-881.500) * [-882.964] (-883.089) (-882.762) (-879.987) -- 0:01:09
55000 -- (-887.723) (-879.760) [-880.824] (-880.374) * [-882.938] (-880.222) (-885.064) (-884.720) -- 0:01:08
Average standard deviation of split frequencies: 0.021266
55500 -- (-901.826) [-880.309] (-882.288) (-881.359) * (-883.005) (-881.557) (-884.147) [-881.329] -- 0:01:08
56000 -- (-890.199) (-880.795) (-881.323) [-881.185] * (-880.652) (-884.445) (-879.538) [-881.077] -- 0:01:07
56500 -- (-887.602) [-879.539] (-881.980) (-882.447) * (-884.759) (-884.887) [-885.399] (-881.272) -- 0:01:06
57000 -- (-894.157) (-880.862) (-879.957) [-883.463] * (-879.220) [-883.825] (-883.925) (-881.191) -- 0:01:06
57500 -- [-885.913] (-880.301) (-882.032) (-881.299) * (-881.084) (-881.874) (-884.181) [-881.799] -- 0:01:05
58000 -- (-894.258) [-880.548] (-881.070) (-881.412) * (-882.495) (-883.486) (-881.597) [-879.888] -- 0:01:04
58500 -- [-888.594] (-880.972) (-880.709) (-881.407) * [-880.602] (-880.818) (-881.468) (-883.419) -- 0:01:04
59000 -- (-886.968) (-882.574) (-883.953) [-880.579] * (-879.866) [-880.476] (-884.887) (-881.666) -- 0:01:03
59500 -- (-889.536) (-881.424) [-880.312] (-880.111) * (-879.766) (-881.199) (-880.030) [-886.957] -- 0:01:03
60000 -- [-899.850] (-885.056) (-879.843) (-881.489) * [-881.605] (-882.175) (-883.865) (-880.441) -- 0:01:02
Average standard deviation of split frequencies: 0.020721
60500 -- (-890.095) (-882.397) [-880.451] (-881.743) * (-879.818) (-884.594) (-880.141) [-880.750] -- 0:01:02
61000 -- (-885.671) [-880.856] (-879.771) (-880.620) * (-881.060) (-881.084) [-880.203] (-881.126) -- 0:01:01
61500 -- (-894.452) (-881.873) [-879.388] (-880.294) * (-881.067) (-881.832) (-880.600) [-880.724] -- 0:01:01
62000 -- (-892.386) [-884.653] (-880.012) (-879.355) * (-880.470) (-879.730) [-880.365] (-882.889) -- 0:01:00
62500 -- (-894.552) (-884.805) [-880.500] (-881.526) * [-880.467] (-880.911) (-879.239) (-888.904) -- 0:01:00
63000 -- (-894.397) [-881.923] (-880.372) (-882.024) * [-881.947] (-880.911) (-883.242) (-883.015) -- 0:00:59
63500 -- (-892.914) (-880.999) (-881.247) [-881.920] * (-880.008) (-882.911) [-880.277] (-882.779) -- 0:00:58
64000 -- [-888.959] (-880.589) (-881.082) (-881.855) * (-881.360) (-883.486) [-883.461] (-882.984) -- 0:00:58
64500 -- (-892.440) (-882.036) (-882.029) [-880.466] * (-880.007) (-882.140) (-880.920) [-882.088] -- 0:00:58
65000 -- (-889.181) (-881.505) [-880.036] (-881.688) * [-881.450] (-884.267) (-880.636) (-882.783) -- 0:00:57
Average standard deviation of split frequencies: 0.024642
65500 -- (-899.237) (-880.221) (-886.020) [-880.080] * (-880.337) (-881.037) (-881.867) [-880.263] -- 0:00:57
66000 -- (-893.599) (-879.892) (-881.945) [-879.948] * (-880.813) [-880.500] (-880.093) (-880.906) -- 0:00:56
66500 -- (-894.477) [-881.837] (-880.574) (-881.036) * (-884.852) (-881.704) [-880.991] (-881.756) -- 0:00:56
67000 -- (-884.664) [-880.243] (-883.096) (-883.910) * (-883.773) (-883.994) [-883.136] (-880.932) -- 0:00:55
67500 -- (-888.323) [-880.834] (-884.003) (-883.083) * (-880.964) (-882.558) (-880.661) [-880.805] -- 0:00:55
68000 -- [-885.825] (-880.329) (-886.644) (-881.528) * (-880.964) [-881.554] (-883.175) (-880.511) -- 0:01:08
68500 -- (-899.135) (-880.375) (-885.764) [-880.122] * [-880.530] (-880.986) (-881.723) (-888.940) -- 0:01:07
69000 -- (-893.179) (-883.581) (-880.352) [-879.834] * (-882.821) (-880.309) [-880.117] (-884.037) -- 0:01:07
69500 -- (-885.377) (-884.538) (-880.618) [-879.386] * (-880.113) (-881.564) [-880.063] (-884.305) -- 0:01:06
70000 -- (-885.325) (-886.080) (-880.580) [-881.939] * [-882.596] (-880.198) (-879.945) (-884.358) -- 0:01:06
Average standard deviation of split frequencies: 0.022470
70500 -- (-882.453) [-883.357] (-880.397) (-881.489) * (-879.945) (-883.164) (-879.985) [-886.505] -- 0:01:05
71000 -- [-882.255] (-883.073) (-881.433) (-880.970) * [-880.022] (-881.473) (-879.992) (-884.676) -- 0:01:05
71500 -- (-881.000) (-880.741) [-880.300] (-879.851) * [-881.231] (-882.095) (-881.672) (-881.519) -- 0:01:04
72000 -- [-881.301] (-881.703) (-879.655) (-884.219) * (-884.143) (-880.841) [-880.060] (-880.858) -- 0:01:04
72500 -- (-881.068) (-879.893) (-880.916) [-881.504] * (-884.861) (-881.337) [-882.875] (-880.677) -- 0:01:03
73000 -- (-885.752) (-879.832) [-884.037] (-882.729) * [-884.477] (-884.265) (-883.126) (-882.497) -- 0:01:03
73500 -- (-884.968) (-879.927) [-881.575] (-882.825) * (-883.632) (-881.693) [-890.780] (-881.468) -- 0:01:03
74000 -- [-880.083] (-880.837) (-882.739) (-884.005) * (-880.521) (-880.489) [-885.508] (-881.761) -- 0:01:02
74500 -- [-879.840] (-880.723) (-882.399) (-886.554) * (-885.708) [-882.647] (-882.762) (-879.988) -- 0:01:02
75000 -- [-881.309] (-879.886) (-881.935) (-879.295) * [-885.985] (-883.169) (-881.567) (-879.820) -- 0:01:01
Average standard deviation of split frequencies: 0.019587
75500 -- (-881.599) (-881.149) [-883.882] (-879.708) * (-884.071) (-882.835) [-884.388] (-881.521) -- 0:01:01
76000 -- (-882.071) (-880.414) (-883.273) [-880.894] * (-880.456) (-881.555) (-880.914) [-881.775] -- 0:01:00
76500 -- [-880.880] (-881.051) (-883.320) (-879.525) * (-881.231) (-884.534) [-880.270] (-882.409) -- 0:01:00
77000 -- (-879.959) [-881.211] (-880.674) (-883.041) * [-884.932] (-880.055) (-881.474) (-883.786) -- 0:00:59
77500 -- (-880.349) (-881.422) (-880.974) [-884.147] * [-882.959] (-881.612) (-881.343) (-883.165) -- 0:00:59
78000 -- (-882.374) (-881.506) (-880.838) [-880.365] * (-884.457) [-881.172] (-882.024) (-881.634) -- 0:00:59
78500 -- (-883.362) [-880.002] (-882.184) (-880.288) * (-886.342) [-881.367] (-881.568) (-887.665) -- 0:00:58
79000 -- [-881.221] (-881.902) (-882.870) (-882.039) * (-880.900) (-881.251) [-882.207] (-884.177) -- 0:00:58
79500 -- [-881.544] (-880.348) (-880.510) (-879.522) * (-882.803) (-882.037) (-881.492) [-883.568] -- 0:00:57
80000 -- (-880.376) (-882.109) (-880.769) [-881.381] * (-882.233) (-881.623) [-881.148] (-882.899) -- 0:00:57
Average standard deviation of split frequencies: 0.023068
80500 -- (-881.950) [-879.494] (-882.596) (-879.645) * [-882.814] (-881.958) (-883.225) (-884.252) -- 0:00:57
81000 -- (-881.489) (-880.053) [-880.773] (-885.404) * (-884.722) (-884.519) [-880.473] (-883.490) -- 0:00:56
81500 -- (-882.474) (-880.963) [-882.166] (-885.357) * [-883.471] (-885.666) (-879.993) (-884.534) -- 0:00:56
82000 -- (-882.755) (-882.538) [-882.109] (-884.896) * [-880.533] (-883.281) (-880.589) (-885.782) -- 0:00:55
82500 -- (-881.871) (-884.015) (-881.787) [-881.724] * (-882.677) [-880.445] (-882.003) (-882.210) -- 0:00:55
83000 -- (-880.082) [-882.115] (-882.894) (-880.419) * (-881.846) [-882.100] (-880.865) (-882.235) -- 0:00:55
83500 -- (-885.099) (-880.900) (-883.839) [-882.998] * (-881.050) (-882.561) (-881.280) [-881.371] -- 0:00:54
84000 -- (-882.553) [-886.710] (-884.283) (-881.602) * [-880.752] (-881.632) (-882.341) (-881.647) -- 0:00:54
84500 -- (-882.557) [-881.157] (-883.305) (-891.109) * (-883.682) (-881.355) (-890.772) [-881.102] -- 0:01:05
85000 -- (-881.080) (-880.945) [-879.965] (-881.231) * (-882.905) (-879.839) (-879.826) [-879.903] -- 0:01:04
Average standard deviation of split frequencies: 0.020555
85500 -- (-881.937) [-880.285] (-879.538) (-884.388) * [-881.558] (-881.425) (-879.665) (-883.055) -- 0:01:04
86000 -- (-881.343) (-880.520) (-879.721) [-880.241] * (-888.268) (-880.959) [-883.058] (-882.220) -- 0:01:03
86500 -- (-880.631) (-881.868) (-880.059) [-880.949] * (-883.153) (-883.470) (-886.223) [-880.030] -- 0:01:03
87000 -- (-880.247) (-882.911) (-883.447) [-881.654] * (-882.624) (-887.687) (-881.595) [-882.220] -- 0:01:02
87500 -- (-880.462) [-880.802] (-880.669) (-882.562) * [-882.655] (-886.784) (-880.726) (-882.331) -- 0:01:02
88000 -- [-879.439] (-880.873) (-881.382) (-882.084) * (-884.757) (-880.315) (-881.247) [-879.993] -- 0:01:02
88500 -- [-883.717] (-881.079) (-880.569) (-879.866) * (-883.765) [-879.684] (-885.492) (-884.494) -- 0:01:01
89000 -- (-882.272) (-884.178) [-881.422] (-879.542) * (-881.999) [-880.863] (-882.964) (-880.216) -- 0:01:01
89500 -- (-881.603) (-880.065) (-883.203) [-879.168] * (-881.662) (-880.702) (-886.303) [-879.679] -- 0:01:01
90000 -- [-882.190] (-882.836) (-884.282) (-879.738) * (-880.505) (-884.310) (-883.486) [-882.524] -- 0:01:00
Average standard deviation of split frequencies: 0.022035
90500 -- [-880.669] (-881.539) (-881.804) (-880.112) * (-879.608) (-885.518) (-883.122) [-881.082] -- 0:01:00
91000 -- [-881.305] (-879.868) (-881.039) (-881.528) * (-880.280) (-885.119) [-883.336] (-893.702) -- 0:00:59
91500 -- (-881.376) [-880.128] (-882.265) (-879.802) * [-881.106] (-890.457) (-882.408) (-883.034) -- 0:00:59
92000 -- (-882.001) (-879.994) (-879.912) [-880.150] * [-881.907] (-885.202) (-880.666) (-880.599) -- 0:00:59
92500 -- [-880.519] (-880.455) (-881.838) (-880.336) * (-880.806) (-886.240) (-882.533) [-881.365] -- 0:00:58
93000 -- (-885.367) (-881.940) (-880.790) [-879.909] * (-880.548) (-881.324) (-880.988) [-881.085] -- 0:00:58
93500 -- (-886.731) (-883.737) [-881.136] (-883.074) * (-883.171) (-886.496) (-885.864) [-884.250] -- 0:00:58
94000 -- (-882.336) (-885.491) [-879.976] (-880.240) * (-880.848) (-885.684) (-885.367) [-883.745] -- 0:00:57
94500 -- (-881.587) (-884.436) (-881.221) [-880.160] * (-880.373) [-883.551] (-882.246) (-882.090) -- 0:00:57
95000 -- (-886.120) (-885.892) [-881.327] (-880.443) * (-880.960) [-880.094] (-882.571) (-880.998) -- 0:00:57
Average standard deviation of split frequencies: 0.022485
95500 -- (-888.659) (-880.685) [-882.257] (-880.916) * (-884.160) [-880.513] (-882.098) (-883.084) -- 0:00:56
96000 -- (-883.365) (-882.416) (-881.654) [-881.465] * (-880.094) (-880.121) (-880.103) [-879.918] -- 0:00:56
96500 -- (-882.661) [-880.467] (-881.145) (-881.706) * (-881.385) (-879.686) (-880.228) [-881.795] -- 0:00:56
97000 -- (-883.253) (-881.199) [-881.637] (-881.346) * (-883.744) (-880.402) (-880.915) [-883.303] -- 0:00:55
97500 -- (-887.908) (-880.632) (-882.095) [-882.333] * [-880.582] (-888.002) (-880.411) (-882.159) -- 0:00:55
98000 -- (-881.222) [-880.632] (-881.848) (-882.147) * (-881.377) (-884.042) [-881.223] (-880.938) -- 0:00:55
98500 -- [-881.022] (-880.960) (-882.050) (-880.474) * (-879.326) [-880.102] (-882.453) (-879.944) -- 0:00:54
99000 -- [-879.619] (-880.770) (-879.973) (-880.791) * (-879.298) [-884.120] (-881.439) (-881.284) -- 0:00:54
99500 -- (-879.851) (-883.904) [-884.450] (-880.745) * [-879.548] (-881.558) (-882.136) (-880.977) -- 0:00:54
100000 -- (-885.032) [-879.995] (-881.222) (-882.134) * (-881.989) (-884.500) (-881.020) [-881.110] -- 0:01:02
Average standard deviation of split frequencies: 0.022312
100500 -- (-883.452) [-883.651] (-882.523) (-890.150) * (-882.956) (-884.988) (-879.970) [-880.300] -- 0:01:02
101000 -- (-889.346) (-882.550) [-879.934] (-887.300) * [-880.339] (-881.809) (-881.011) (-881.985) -- 0:01:02
101500 -- (-889.194) [-881.355] (-880.798) (-882.564) * (-880.084) (-879.965) [-880.791] (-884.972) -- 0:01:01
102000 -- (-883.472) (-883.362) (-880.745) [-883.188] * [-881.150] (-881.788) (-880.881) (-886.464) -- 0:01:01
102500 -- (-880.652) (-882.060) (-880.304) [-880.700] * [-880.144] (-881.034) (-882.842) (-886.242) -- 0:01:01
103000 -- (-880.656) (-880.931) (-879.794) [-881.756] * (-882.077) (-881.591) (-882.266) [-882.814] -- 0:01:00
103500 -- [-880.620] (-882.862) (-882.817) (-881.164) * (-882.817) [-879.718] (-883.620) (-881.181) -- 0:01:00
104000 -- (-881.219) [-884.278] (-882.876) (-880.204) * (-881.352) (-879.865) [-881.885] (-882.575) -- 0:01:00
104500 -- (-881.754) (-881.952) (-880.653) [-880.082] * (-881.693) (-879.614) (-880.702) [-883.553] -- 0:00:59
105000 -- (-879.806) (-880.082) [-883.375] (-880.917) * (-885.508) [-880.066] (-879.783) (-881.451) -- 0:00:59
Average standard deviation of split frequencies: 0.024354
105500 -- [-882.674] (-881.616) (-880.001) (-879.675) * (-879.967) (-880.386) (-882.514) [-883.857] -- 0:00:59
106000 -- (-884.026) (-883.949) (-879.851) [-880.240] * (-881.899) [-880.544] (-881.472) (-883.146) -- 0:00:59
106500 -- (-881.023) (-885.101) (-882.977) [-879.574] * (-881.659) (-880.030) (-883.617) [-882.700] -- 0:00:58
107000 -- [-880.758] (-881.805) (-883.310) (-879.462) * (-886.251) (-882.596) [-884.315] (-881.983) -- 0:00:58
107500 -- (-881.813) (-882.388) [-880.324] (-879.897) * (-880.133) (-880.483) (-886.060) [-882.259] -- 0:00:58
108000 -- (-882.983) (-884.647) (-881.812) [-881.850] * (-879.685) (-880.730) [-883.011] (-889.802) -- 0:00:57
108500 -- (-882.769) (-887.101) (-881.445) [-881.536] * [-880.338] (-880.335) (-881.015) (-885.721) -- 0:00:57
109000 -- (-880.073) [-881.493] (-880.974) (-882.864) * (-882.333) (-882.251) (-882.447) [-879.980] -- 0:00:57
109500 -- [-880.280] (-881.916) (-882.947) (-886.614) * (-880.176) (-886.068) (-881.813) [-885.265] -- 0:00:56
110000 -- [-883.753] (-883.672) (-884.277) (-881.172) * [-880.423] (-882.484) (-880.904) (-883.779) -- 0:00:56
Average standard deviation of split frequencies: 0.022301
110500 -- (-882.237) (-888.720) (-881.589) [-880.113] * [-879.720] (-881.379) (-882.182) (-881.930) -- 0:00:56
111000 -- [-881.192] (-881.978) (-881.182) (-881.087) * [-881.778] (-880.011) (-881.491) (-882.562) -- 0:00:56
111500 -- [-879.660] (-881.951) (-880.739) (-882.659) * [-882.195] (-879.883) (-883.170) (-880.420) -- 0:00:55
112000 -- (-880.505) [-879.603] (-880.199) (-881.140) * (-882.303) [-880.129] (-881.189) (-879.941) -- 0:00:55
112500 -- (-879.998) [-885.894] (-880.479) (-884.243) * (-881.827) (-879.808) (-884.228) [-881.448] -- 0:00:55
113000 -- (-882.319) [-880.192] (-880.868) (-885.826) * [-882.963] (-880.630) (-881.822) (-881.026) -- 0:00:54
113500 -- [-880.441] (-880.765) (-880.718) (-881.568) * (-884.852) (-880.682) (-880.805) [-882.178] -- 0:00:54
114000 -- (-880.034) [-882.079] (-880.220) (-881.230) * (-883.133) (-879.753) (-881.666) [-883.285] -- 0:00:54
114500 -- [-880.310] (-883.187) (-884.235) (-881.193) * (-880.707) (-885.373) [-879.930] (-881.583) -- 0:00:54
115000 -- (-880.172) [-882.215] (-879.790) (-882.155) * (-885.876) (-882.936) (-879.979) [-881.970] -- 0:00:53
Average standard deviation of split frequencies: 0.023706
115500 -- (-880.173) (-882.695) [-880.120] (-883.027) * (-884.561) (-882.791) (-880.660) [-881.621] -- 0:00:53
116000 -- [-879.629] (-880.155) (-879.814) (-881.811) * [-881.140] (-881.958) (-882.641) (-882.842) -- 0:01:00
116500 -- (-882.587) (-880.495) (-880.604) [-881.766] * (-879.502) (-880.589) (-881.199) [-882.171] -- 0:01:00
117000 -- [-883.406] (-881.608) (-882.158) (-885.042) * (-880.608) (-882.597) (-882.065) [-880.438] -- 0:01:00
117500 -- [-880.410] (-880.558) (-883.559) (-882.905) * (-882.388) (-888.214) [-881.240] (-882.139) -- 0:01:00
118000 -- [-881.453] (-880.018) (-885.353) (-881.923) * (-881.423) [-880.597] (-881.654) (-885.793) -- 0:00:59
118500 -- (-882.652) (-881.192) [-881.308] (-882.353) * (-880.787) (-886.485) [-879.810] (-879.837) -- 0:00:59
119000 -- (-881.639) (-880.666) [-881.240] (-880.452) * (-882.428) (-884.498) (-883.388) [-879.594] -- 0:00:59
119500 -- [-882.777] (-881.016) (-885.835) (-881.421) * [-881.408] (-880.190) (-880.337) (-881.739) -- 0:00:58
120000 -- (-880.466) (-880.435) (-881.160) [-880.572] * (-881.395) (-879.775) [-880.002] (-882.150) -- 0:00:58
Average standard deviation of split frequencies: 0.024262
120500 -- [-881.553] (-879.834) (-885.082) (-880.643) * [-880.419] (-881.138) (-879.976) (-882.444) -- 0:00:58
121000 -- (-880.712) (-880.434) [-883.891] (-880.966) * (-882.107) (-882.136) [-881.022] (-883.168) -- 0:00:58
121500 -- (-883.030) (-879.949) [-882.662] (-883.010) * (-879.981) [-884.832] (-879.773) (-884.612) -- 0:00:57
122000 -- (-881.393) [-880.926] (-883.050) (-884.189) * [-880.799] (-881.770) (-881.122) (-882.686) -- 0:00:57
122500 -- [-882.208] (-881.447) (-883.247) (-886.884) * (-882.383) [-881.199] (-881.483) (-880.160) -- 0:00:57
123000 -- [-880.459] (-881.552) (-883.075) (-882.324) * [-881.290] (-884.392) (-879.897) (-880.217) -- 0:00:57
123500 -- (-883.776) (-882.243) (-882.009) [-880.360] * (-882.712) (-883.266) (-880.197) [-883.455] -- 0:00:56
124000 -- (-885.312) (-885.006) [-883.610] (-883.058) * (-891.039) [-881.233] (-880.628) (-883.539) -- 0:00:56
124500 -- (-880.251) [-880.488] (-881.063) (-882.918) * (-881.403) (-886.950) [-881.709] (-885.640) -- 0:00:56
125000 -- [-881.276] (-880.969) (-885.518) (-879.885) * (-880.303) [-881.487] (-879.931) (-881.777) -- 0:00:56
Average standard deviation of split frequencies: 0.023196
125500 -- (-879.849) (-881.869) (-882.436) [-881.207] * (-882.150) (-880.868) (-883.175) [-880.414] -- 0:00:55
126000 -- [-883.577] (-879.804) (-880.036) (-880.956) * (-885.216) (-881.464) (-883.136) [-883.045] -- 0:00:55
126500 -- (-884.366) [-880.169] (-882.727) (-882.023) * [-881.440] (-882.446) (-884.577) (-880.991) -- 0:00:55
127000 -- (-885.480) (-880.224) [-881.930] (-879.849) * [-880.098] (-880.924) (-882.415) (-880.875) -- 0:00:54
127500 -- (-881.454) [-881.097] (-883.231) (-880.158) * (-882.266) (-880.724) (-883.515) [-880.781] -- 0:00:54
128000 -- (-881.322) [-879.606] (-885.398) (-880.561) * [-881.227] (-882.522) (-884.080) (-880.366) -- 0:00:54
128500 -- [-881.499] (-881.110) (-885.029) (-880.868) * [-882.449] (-881.455) (-881.961) (-880.290) -- 0:00:54
129000 -- [-882.965] (-879.902) (-880.495) (-883.590) * [-880.223] (-880.134) (-880.629) (-879.931) -- 0:00:54
129500 -- (-884.105) [-881.698] (-882.062) (-884.937) * (-882.203) (-886.189) [-882.698] (-879.729) -- 0:00:53
130000 -- (-884.564) [-880.695] (-881.279) (-885.045) * (-882.202) (-881.643) [-880.338] (-879.958) -- 0:00:53
Average standard deviation of split frequencies: 0.021446
130500 -- [-883.260] (-880.892) (-881.359) (-886.512) * (-886.373) [-881.466] (-880.818) (-887.592) -- 0:00:53
131000 -- (-883.062) (-882.594) [-881.360] (-883.910) * (-880.129) (-880.197) [-886.363] (-880.166) -- 0:00:53
131500 -- (-887.312) (-881.666) (-883.430) [-879.954] * [-880.483] (-880.374) (-884.741) (-879.825) -- 0:00:52
132000 -- (-883.183) (-880.351) [-880.819] (-879.977) * (-881.568) [-880.212] (-885.480) (-883.627) -- 0:00:52
132500 -- [-882.945] (-882.046) (-883.887) (-881.307) * [-880.335] (-880.259) (-883.514) (-880.040) -- 0:00:52
133000 -- (-881.621) (-883.167) (-885.917) [-883.349] * (-880.638) (-883.742) [-880.385] (-880.026) -- 0:00:52
133500 -- (-883.851) (-886.044) [-883.714] (-881.334) * (-880.410) (-882.256) (-883.500) [-879.658] -- 0:00:58
134000 -- [-882.096] (-883.690) (-882.637) (-881.359) * (-880.633) (-882.521) (-880.358) [-882.473] -- 0:00:58
134500 -- (-880.619) [-879.795] (-881.956) (-881.434) * (-880.633) (-880.698) [-880.124] (-880.064) -- 0:00:57
135000 -- (-881.693) [-879.785] (-880.981) (-880.204) * (-880.206) [-880.953] (-881.613) (-882.889) -- 0:00:57
Average standard deviation of split frequencies: 0.022021
135500 -- (-885.975) (-882.580) (-882.656) [-881.158] * [-880.078] (-881.828) (-881.321) (-882.698) -- 0:00:57
136000 -- (-880.979) (-881.937) [-880.275] (-880.390) * (-881.113) [-880.062] (-884.823) (-885.025) -- 0:00:57
136500 -- [-882.327] (-882.252) (-880.171) (-882.257) * (-882.439) (-879.431) (-884.652) [-883.691] -- 0:00:56
137000 -- (-881.008) (-881.708) (-880.982) [-879.727] * (-886.632) (-879.909) (-881.686) [-881.625] -- 0:00:56
137500 -- (-882.134) (-882.316) (-881.690) [-880.219] * [-882.047] (-880.204) (-881.417) (-881.619) -- 0:00:56
138000 -- (-881.128) (-889.751) (-879.679) [-881.115] * (-883.260) (-879.563) [-883.648] (-882.622) -- 0:00:56
138500 -- [-880.172] (-880.596) (-880.644) (-883.417) * (-883.635) (-884.413) (-879.773) [-882.305] -- 0:00:55
139000 -- [-882.345] (-881.394) (-881.187) (-880.472) * [-880.590] (-880.365) (-883.835) (-882.797) -- 0:00:55
139500 -- [-880.772] (-879.798) (-881.913) (-882.300) * (-881.409) (-882.218) (-882.497) [-880.819] -- 0:00:55
140000 -- (-883.097) (-882.569) (-882.178) [-881.190] * [-881.411] (-882.686) (-884.098) (-881.214) -- 0:00:55
Average standard deviation of split frequencies: 0.020896
140500 -- (-882.900) [-880.797] (-883.811) (-881.038) * (-880.496) (-881.426) (-881.690) [-881.112] -- 0:00:55
141000 -- [-880.481] (-880.682) (-884.152) (-881.359) * (-879.644) [-881.145] (-880.857) (-881.132) -- 0:00:54
141500 -- (-882.872) [-880.517] (-883.442) (-890.994) * (-879.900) [-881.837] (-882.664) (-881.355) -- 0:00:54
142000 -- [-882.910] (-881.896) (-889.547) (-885.936) * [-880.321] (-882.445) (-883.632) (-885.657) -- 0:00:54
142500 -- [-881.175] (-880.042) (-885.902) (-882.282) * [-880.898] (-880.087) (-880.841) (-882.342) -- 0:00:54
143000 -- (-880.216) (-885.685) [-881.825] (-881.486) * (-879.883) (-880.926) [-880.327] (-880.390) -- 0:00:53
143500 -- (-886.228) [-882.245] (-884.445) (-881.379) * (-881.876) [-883.537] (-886.095) (-881.757) -- 0:00:53
144000 -- [-880.460] (-881.965) (-881.608) (-881.701) * (-881.837) (-881.886) (-881.191) [-883.383] -- 0:00:53
144500 -- (-882.961) (-882.144) [-880.235] (-881.683) * [-880.868] (-879.398) (-881.805) (-885.315) -- 0:00:53
145000 -- (-881.259) (-881.402) (-883.398) [-882.779] * (-887.772) (-882.985) (-881.022) [-884.836] -- 0:00:53
Average standard deviation of split frequencies: 0.021072
145500 -- (-879.836) (-884.530) (-882.903) [-884.996] * (-885.027) (-881.505) [-880.186] (-882.696) -- 0:00:52
146000 -- (-879.965) [-881.160] (-882.371) (-879.399) * [-880.013] (-882.509) (-882.517) (-880.474) -- 0:00:52
146500 -- (-881.124) [-881.495] (-883.636) (-880.813) * (-881.408) [-880.597] (-882.131) (-881.758) -- 0:00:52
147000 -- (-881.408) (-881.461) (-887.674) [-883.651] * (-880.183) [-880.732] (-880.753) (-882.632) -- 0:00:52
147500 -- [-880.137] (-881.570) (-882.289) (-879.827) * (-881.936) [-880.743] (-880.196) (-881.112) -- 0:00:52
148000 -- (-880.769) (-881.406) [-880.607] (-884.304) * (-879.352) (-882.376) (-879.976) [-882.072] -- 0:00:51
148500 -- (-882.528) [-882.696] (-886.095) (-882.423) * (-881.908) (-883.073) (-882.477) [-880.635] -- 0:00:51
149000 -- [-879.486] (-880.696) (-880.776) (-883.081) * [-881.756] (-883.617) (-883.194) (-883.180) -- 0:00:51
149500 -- (-880.856) [-880.836] (-881.753) (-882.208) * (-882.470) (-884.060) (-880.896) [-880.743] -- 0:00:51
150000 -- (-882.059) [-879.822] (-880.963) (-881.151) * [-881.454] (-883.321) (-880.793) (-880.295) -- 0:00:56
Average standard deviation of split frequencies: 0.022249
150500 -- (-881.918) (-880.105) [-881.190] (-883.751) * (-883.359) (-884.603) (-881.573) [-880.076] -- 0:00:56
151000 -- [-881.576] (-879.795) (-881.364) (-886.362) * (-884.262) (-884.167) (-880.836) [-880.730] -- 0:00:56
151500 -- [-880.683] (-880.913) (-881.066) (-880.639) * (-880.774) (-883.825) [-880.220] (-881.122) -- 0:00:56
152000 -- (-881.441) [-880.610] (-881.638) (-880.127) * (-881.427) (-881.191) (-880.269) [-881.223] -- 0:00:55
152500 -- [-884.026] (-887.001) (-884.533) (-880.757) * [-880.332] (-881.718) (-879.898) (-880.897) -- 0:00:55
153000 -- [-886.442] (-881.740) (-884.525) (-881.878) * (-880.319) (-882.935) [-881.858] (-880.114) -- 0:00:55
153500 -- (-885.490) [-881.555] (-886.836) (-885.165) * (-879.676) (-880.274) [-881.471] (-882.853) -- 0:00:55
154000 -- (-884.299) (-881.148) (-881.783) [-880.880] * (-883.669) (-880.654) (-879.184) [-885.367] -- 0:00:54
154500 -- (-883.083) (-884.414) [-885.193] (-882.402) * (-884.779) (-880.511) [-881.525] (-880.303) -- 0:00:54
155000 -- (-883.006) (-884.322) [-882.751] (-882.762) * (-880.021) (-883.566) (-882.446) [-881.496] -- 0:00:54
Average standard deviation of split frequencies: 0.023167
155500 -- (-882.012) (-883.475) [-881.989] (-882.263) * [-880.229] (-884.427) (-885.575) (-880.998) -- 0:00:54
156000 -- (-882.981) (-880.288) (-884.623) [-884.575] * (-880.353) (-885.069) (-882.898) [-880.342] -- 0:00:54
156500 -- [-882.192] (-880.428) (-884.442) (-880.691) * (-882.779) [-881.569] (-884.865) (-879.756) -- 0:00:53
157000 -- (-880.613) (-882.824) (-881.212) [-881.522] * (-883.406) [-882.624] (-883.905) (-880.973) -- 0:00:53
157500 -- (-884.538) (-884.608) [-882.288] (-882.693) * (-882.275) [-881.791] (-883.047) (-881.321) -- 0:00:53
158000 -- (-883.977) (-880.955) [-882.525] (-889.106) * (-883.112) [-880.133] (-880.026) (-881.384) -- 0:00:53
158500 -- (-883.997) [-880.591] (-881.214) (-883.108) * (-880.546) (-880.133) (-879.605) [-880.599] -- 0:00:53
159000 -- (-881.896) [-879.754] (-885.712) (-881.528) * (-880.643) (-885.861) (-882.270) [-882.346] -- 0:00:52
159500 -- [-882.769] (-882.727) (-882.345) (-879.733) * (-882.359) (-879.629) (-882.280) [-881.400] -- 0:00:52
160000 -- (-881.232) (-883.830) (-880.488) [-880.266] * (-883.249) [-881.975] (-883.417) (-880.930) -- 0:00:52
Average standard deviation of split frequencies: 0.022005
160500 -- [-880.091] (-882.950) (-881.448) (-881.024) * [-880.761] (-880.000) (-884.965) (-880.010) -- 0:00:52
161000 -- (-880.550) (-880.396) [-880.471] (-880.653) * (-881.928) [-881.372] (-881.946) (-879.771) -- 0:00:52
161500 -- [-881.787] (-883.993) (-882.465) (-879.545) * (-884.102) (-880.467) (-879.397) [-879.320] -- 0:00:51
162000 -- (-883.388) (-882.202) (-882.055) [-881.820] * (-887.887) [-882.135] (-880.049) (-882.155) -- 0:00:51
162500 -- (-883.052) (-882.702) [-881.290] (-880.704) * (-889.198) (-881.551) (-882.391) [-881.932] -- 0:00:51
163000 -- (-881.039) (-880.585) (-882.056) [-887.020] * (-880.635) (-884.759) (-883.795) [-880.254] -- 0:00:51
163500 -- [-881.443] (-885.280) (-882.046) (-883.273) * (-883.275) (-884.375) [-881.594] (-883.081) -- 0:00:51
164000 -- (-879.682) (-886.669) (-883.749) [-883.036] * (-881.222) (-885.185) [-882.755] (-880.546) -- 0:00:50
164500 -- (-881.586) (-881.464) (-886.876) [-883.176] * (-884.133) [-880.486] (-880.734) (-881.514) -- 0:00:50
165000 -- (-879.408) (-881.222) [-883.081] (-884.959) * (-882.388) (-881.882) (-879.943) [-881.486] -- 0:00:55
Average standard deviation of split frequencies: 0.022245
165500 -- (-879.445) [-881.708] (-882.874) (-883.117) * (-881.196) [-882.279] (-879.936) (-883.706) -- 0:00:55
166000 -- [-880.755] (-884.506) (-882.021) (-881.363) * [-882.337] (-881.270) (-881.856) (-879.167) -- 0:00:55
166500 -- [-880.177] (-885.679) (-880.292) (-885.149) * [-880.808] (-883.459) (-882.778) (-882.077) -- 0:00:55
167000 -- (-882.691) [-883.885] (-880.472) (-880.179) * [-883.751] (-884.877) (-882.988) (-880.059) -- 0:00:54
167500 -- (-880.518) (-882.568) (-880.392) [-881.334] * (-883.796) (-884.407) [-882.412] (-880.085) -- 0:00:54
168000 -- (-879.828) (-884.250) [-880.377] (-880.911) * (-883.827) (-881.487) [-881.970] (-880.085) -- 0:00:54
168500 -- (-880.582) (-881.627) [-881.560] (-882.305) * [-880.951] (-880.749) (-881.199) (-882.004) -- 0:00:54
169000 -- (-882.063) [-879.660] (-881.235) (-881.344) * (-883.573) (-880.829) [-887.271] (-883.836) -- 0:00:54
169500 -- [-881.557] (-887.084) (-882.737) (-883.236) * [-880.533] (-881.522) (-881.124) (-881.124) -- 0:00:53
170000 -- (-879.815) (-882.220) [-881.410] (-881.298) * (-881.558) (-885.007) [-880.680] (-880.376) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
170500 -- (-880.001) (-880.354) (-881.525) [-883.433] * [-882.382] (-881.204) (-881.421) (-881.359) -- 0:00:53
171000 -- [-880.404] (-881.416) (-882.526) (-886.864) * (-883.515) (-880.932) [-881.937] (-881.215) -- 0:00:53
171500 -- (-882.309) (-880.776) (-882.253) [-881.064] * (-886.050) (-880.339) (-882.290) [-881.437] -- 0:00:53
172000 -- [-880.820] (-879.588) (-882.195) (-883.529) * (-884.972) (-881.188) (-883.068) [-880.799] -- 0:00:52
172500 -- (-880.439) (-880.722) [-882.820] (-880.720) * [-884.300] (-881.799) (-883.327) (-879.686) -- 0:00:52
173000 -- [-880.902] (-886.371) (-882.368) (-881.925) * (-881.861) (-881.760) [-881.849] (-880.449) -- 0:00:52
173500 -- [-879.770] (-880.497) (-881.214) (-884.622) * (-881.765) (-882.312) (-882.350) [-881.580] -- 0:00:52
174000 -- [-882.927] (-883.857) (-882.533) (-879.973) * (-880.370) (-881.408) [-881.171] (-883.049) -- 0:00:52
174500 -- (-883.703) (-882.496) [-880.112] (-880.343) * (-879.452) (-882.951) [-882.406] (-881.218) -- 0:00:52
175000 -- [-881.324] (-882.541) (-884.154) (-887.120) * [-880.290] (-884.317) (-881.810) (-886.009) -- 0:00:51
Average standard deviation of split frequencies: 0.019344
175500 -- (-881.750) (-883.238) [-884.018] (-881.906) * (-881.085) (-881.807) [-880.283] (-883.899) -- 0:00:51
176000 -- (-886.017) [-881.318] (-881.782) (-883.809) * [-880.781] (-884.760) (-888.997) (-884.764) -- 0:00:51
176500 -- (-885.085) (-882.662) [-886.074] (-883.210) * [-882.679] (-881.883) (-888.764) (-887.479) -- 0:00:51
177000 -- (-884.302) (-884.962) (-892.525) [-885.793] * [-879.841] (-880.828) (-887.719) (-884.494) -- 0:00:51
177500 -- (-885.621) [-883.439] (-882.684) (-888.223) * (-880.456) [-883.053] (-884.406) (-881.957) -- 0:00:50
178000 -- (-890.468) (-886.656) [-883.268] (-881.814) * (-880.669) (-881.924) [-884.194] (-880.072) -- 0:00:50
178500 -- (-880.429) (-881.582) (-881.715) [-881.520] * (-881.775) [-885.434] (-884.531) (-881.025) -- 0:00:50
179000 -- (-881.611) (-880.270) (-879.678) [-880.590] * (-881.334) (-888.754) [-883.730] (-881.700) -- 0:00:50
179500 -- (-880.775) (-880.442) (-880.321) [-879.918] * (-881.613) (-888.550) (-885.007) [-881.122] -- 0:00:50
180000 -- (-881.142) (-883.068) (-879.562) [-880.743] * (-882.340) (-881.506) [-881.945] (-880.514) -- 0:00:50
Average standard deviation of split frequencies: 0.020149
180500 -- (-882.028) (-880.658) (-880.926) [-880.171] * [-881.737] (-880.158) (-881.762) (-880.394) -- 0:00:49
181000 -- (-883.601) [-885.466] (-881.250) (-881.472) * (-881.688) (-880.873) [-879.808] (-881.095) -- 0:00:54
181500 -- (-891.818) (-890.420) [-881.144] (-884.539) * [-883.777] (-880.580) (-881.105) (-880.825) -- 0:00:54
182000 -- (-888.148) (-883.564) (-888.697) [-883.210] * [-882.135] (-881.949) (-882.112) (-879.977) -- 0:00:53
182500 -- (-886.028) [-883.518] (-881.798) (-880.869) * (-882.443) [-882.727] (-880.853) (-880.565) -- 0:00:53
183000 -- (-887.418) (-882.963) [-881.327] (-882.854) * (-892.797) (-882.470) (-884.156) [-879.753] -- 0:00:53
183500 -- (-882.345) (-881.717) [-881.064] (-884.688) * (-882.566) [-882.274] (-879.349) (-882.063) -- 0:00:53
184000 -- (-880.846) [-883.501] (-881.411) (-884.203) * [-881.921] (-882.497) (-880.527) (-881.823) -- 0:00:53
184500 -- [-881.924] (-882.486) (-882.093) (-882.681) * (-880.528) (-887.149) [-880.010] (-880.213) -- 0:00:53
185000 -- (-881.381) (-880.575) (-882.483) [-889.130] * (-879.887) [-882.247] (-883.162) (-881.413) -- 0:00:52
Average standard deviation of split frequencies: 0.020979
185500 -- [-880.588] (-882.221) (-883.004) (-882.042) * (-880.455) (-879.850) (-880.979) [-880.030] -- 0:00:52
186000 -- (-882.440) (-880.813) [-879.344] (-886.194) * (-879.831) (-884.124) (-880.969) [-884.520] -- 0:00:52
186500 -- [-882.481] (-883.038) (-880.869) (-883.408) * [-880.193] (-880.795) (-879.820) (-880.926) -- 0:00:52
187000 -- (-881.984) (-882.561) [-880.777] (-883.007) * (-879.678) (-880.863) (-881.133) [-882.797] -- 0:00:52
187500 -- (-880.218) [-884.752] (-882.045) (-879.502) * [-879.826] (-879.938) (-889.275) (-881.042) -- 0:00:52
188000 -- (-879.923) (-883.361) (-881.514) [-880.941] * (-880.022) [-880.844] (-884.471) (-881.838) -- 0:00:51
188500 -- (-884.605) (-881.002) (-880.569) [-881.454] * (-879.904) [-879.897] (-881.701) (-880.802) -- 0:00:51
189000 -- (-886.970) (-879.714) (-880.637) [-884.163] * (-881.440) (-880.489) [-882.781] (-881.866) -- 0:00:51
189500 -- [-884.807] (-880.198) (-879.245) (-880.177) * (-884.149) (-880.931) (-881.409) [-881.017] -- 0:00:51
190000 -- (-882.726) [-881.021] (-880.184) (-879.878) * (-880.432) [-881.337] (-881.292) (-880.622) -- 0:00:51
Average standard deviation of split frequencies: 0.021427
190500 -- (-886.177) [-880.759] (-881.341) (-880.364) * (-882.190) (-887.046) [-881.321] (-880.033) -- 0:00:50
191000 -- (-881.696) (-881.495) [-882.872] (-880.480) * (-883.145) [-880.965] (-880.577) (-881.912) -- 0:00:50
191500 -- (-882.000) [-880.820] (-882.814) (-879.884) * (-881.447) (-880.238) [-881.263] (-882.574) -- 0:00:50
192000 -- [-881.255] (-883.235) (-881.279) (-882.453) * (-880.246) [-881.131] (-884.589) (-882.117) -- 0:00:50
192500 -- (-881.169) [-881.054] (-879.634) (-880.528) * (-880.657) (-881.977) [-881.201] (-883.243) -- 0:00:50
193000 -- (-881.295) (-883.561) [-880.840] (-881.166) * (-879.875) (-880.217) (-883.063) [-882.228] -- 0:00:50
193500 -- (-880.517) (-882.098) [-879.907] (-882.088) * [-880.163] (-879.978) (-881.435) (-881.010) -- 0:00:50
194000 -- (-881.095) [-880.043] (-880.294) (-881.763) * [-883.026] (-885.488) (-882.470) (-882.676) -- 0:00:49
194500 -- [-882.489] (-880.005) (-881.011) (-882.940) * (-881.653) (-881.684) [-885.263] (-880.458) -- 0:00:49
195000 -- (-883.841) (-879.976) [-880.978] (-882.192) * (-882.015) (-884.810) [-884.273] (-880.342) -- 0:00:49
Average standard deviation of split frequencies: 0.021245
195500 -- (-881.017) [-883.973] (-880.995) (-881.506) * (-880.842) (-881.639) (-880.182) [-880.114] -- 0:00:49
196000 -- [-880.585] (-882.308) (-881.457) (-881.573) * (-881.317) (-882.045) [-880.037] (-882.628) -- 0:00:49
196500 -- (-880.339) (-882.769) [-881.233] (-880.984) * [-880.333] (-882.523) (-880.916) (-882.466) -- 0:00:49
197000 -- (-882.395) (-884.196) (-883.016) [-880.697] * [-881.048] (-881.774) (-884.269) (-884.259) -- 0:00:48
197500 -- [-880.047] (-887.337) (-880.783) (-879.475) * (-880.564) (-881.171) (-880.441) [-885.035] -- 0:00:48
198000 -- (-882.531) (-881.784) [-880.546] (-881.849) * [-880.632] (-881.631) (-881.412) (-882.038) -- 0:00:52
198500 -- (-886.933) [-882.366] (-881.453) (-883.743) * (-880.357) [-879.307] (-879.744) (-882.635) -- 0:00:52
199000 -- [-882.340] (-880.210) (-881.213) (-883.007) * (-880.593) [-879.641] (-879.651) (-880.798) -- 0:00:52
199500 -- (-885.273) [-883.781] (-881.059) (-884.743) * (-880.759) [-882.005] (-885.505) (-881.575) -- 0:00:52
200000 -- (-882.939) (-883.250) [-880.366] (-880.549) * (-880.297) [-882.592] (-883.515) (-879.615) -- 0:00:51
Average standard deviation of split frequencies: 0.021795
200500 -- (-881.874) (-881.408) (-882.322) [-882.521] * (-880.959) [-880.701] (-882.810) (-879.660) -- 0:00:51
201000 -- (-881.885) [-882.123] (-880.993) (-881.040) * (-881.199) (-881.800) (-884.772) [-879.738] -- 0:00:51
201500 -- [-880.098] (-884.958) (-880.617) (-879.492) * (-884.028) [-881.029] (-882.384) (-880.262) -- 0:00:51
202000 -- [-881.119] (-882.413) (-879.699) (-883.502) * (-881.784) [-881.498] (-881.908) (-880.230) -- 0:00:51
202500 -- (-880.668) (-881.060) [-884.664] (-883.147) * (-880.124) (-880.954) [-881.558] (-880.620) -- 0:00:51
203000 -- (-880.522) (-881.367) [-880.043] (-880.370) * (-881.678) (-880.619) (-881.471) [-880.156] -- 0:00:51
203500 -- (-881.230) (-879.533) [-879.388] (-880.052) * (-880.062) (-882.793) (-887.530) [-880.130] -- 0:00:50
204000 -- (-883.124) [-881.288] (-888.919) (-882.172) * (-880.067) (-880.391) (-881.291) [-880.761] -- 0:00:50
204500 -- [-880.494] (-879.681) (-881.524) (-879.853) * (-879.979) (-880.447) (-880.197) [-880.658] -- 0:00:50
205000 -- [-880.952] (-882.113) (-882.140) (-880.067) * (-879.898) (-885.586) [-880.294] (-880.622) -- 0:00:50
Average standard deviation of split frequencies: 0.022643
205500 -- (-881.529) [-880.238] (-881.115) (-887.335) * (-885.088) [-881.858] (-880.272) (-881.966) -- 0:00:50
206000 -- (-881.671) (-881.928) (-881.433) [-879.647] * (-882.291) [-881.250] (-881.353) (-880.730) -- 0:00:50
206500 -- [-882.641] (-882.611) (-882.616) (-879.883) * (-881.667) [-880.914] (-885.932) (-882.508) -- 0:00:49
207000 -- [-882.606] (-881.420) (-884.257) (-880.697) * (-879.952) (-882.595) (-884.935) [-880.149] -- 0:00:49
207500 -- (-882.446) (-880.628) (-882.602) [-881.442] * (-885.212) (-883.273) [-882.924] (-880.756) -- 0:00:49
208000 -- (-881.638) (-886.143) (-883.659) [-880.638] * [-884.387] (-881.747) (-879.379) (-879.918) -- 0:00:49
208500 -- [-880.519] (-883.258) (-883.311) (-879.792) * (-885.896) (-881.309) [-879.383] (-885.645) -- 0:00:49
209000 -- (-880.813) [-880.806] (-881.630) (-880.860) * (-883.116) (-883.931) [-881.019] (-883.059) -- 0:00:49
209500 -- [-881.188] (-881.764) (-880.276) (-882.700) * (-880.396) (-883.158) (-881.076) [-882.300] -- 0:00:49
210000 -- (-882.710) [-880.708] (-880.155) (-880.686) * [-881.384] (-886.651) (-881.417) (-888.721) -- 0:00:48
Average standard deviation of split frequencies: 0.022141
210500 -- (-882.986) (-880.240) [-880.991] (-879.462) * [-881.138] (-887.549) (-883.113) (-883.189) -- 0:00:48
211000 -- (-883.366) [-880.328] (-881.777) (-886.687) * (-881.796) [-881.594] (-881.037) (-881.412) -- 0:00:48
211500 -- [-880.676] (-884.118) (-879.401) (-884.215) * (-883.000) (-880.996) (-881.354) [-879.893] -- 0:00:48
212000 -- (-881.788) (-883.492) [-879.534] (-883.905) * (-890.444) (-880.240) [-880.940] (-879.565) -- 0:00:48
212500 -- [-879.949] (-880.816) (-880.086) (-882.000) * (-881.383) (-885.150) (-883.676) [-880.137] -- 0:00:48
213000 -- (-880.864) (-883.207) [-882.000] (-882.441) * (-880.411) (-880.707) [-882.938] (-881.262) -- 0:00:48
213500 -- (-880.973) (-884.631) [-884.157] (-881.259) * (-880.320) [-881.572] (-879.758) (-884.793) -- 0:00:47
214000 -- (-881.761) (-883.736) [-884.957] (-880.780) * (-880.965) [-882.813] (-882.610) (-883.915) -- 0:00:47
214500 -- [-880.641] (-881.505) (-883.971) (-879.876) * [-881.209] (-883.163) (-883.497) (-882.989) -- 0:00:51
215000 -- [-881.855] (-880.841) (-884.381) (-880.760) * (-880.163) [-881.170] (-884.726) (-881.539) -- 0:00:51
Average standard deviation of split frequencies: 0.021097
215500 -- (-881.986) [-881.065] (-884.172) (-880.695) * (-881.973) [-879.669] (-882.382) (-879.716) -- 0:00:50
216000 -- (-880.315) [-884.163] (-882.231) (-881.350) * (-880.788) [-881.008] (-882.918) (-880.634) -- 0:00:50
216500 -- (-881.442) (-886.629) (-885.632) [-881.960] * (-881.694) (-884.395) [-883.214] (-880.329) -- 0:00:50
217000 -- (-881.941) (-883.154) (-881.281) [-881.501] * (-881.894) (-883.223) [-882.601] (-880.002) -- 0:00:50
217500 -- (-880.670) [-881.622] (-880.101) (-881.720) * (-879.736) (-880.647) (-882.450) [-880.770] -- 0:00:50
218000 -- [-882.362] (-881.995) (-880.043) (-882.209) * (-881.642) [-880.038] (-881.260) (-881.947) -- 0:00:50
218500 -- (-881.561) (-881.148) [-881.088] (-882.460) * (-879.903) (-879.943) [-883.949] (-879.973) -- 0:00:50
219000 -- (-880.586) [-884.975] (-881.423) (-881.260) * (-883.035) (-884.395) (-881.600) [-881.356] -- 0:00:49
219500 -- [-881.843] (-880.579) (-882.368) (-881.951) * (-881.232) (-882.236) (-880.778) [-882.683] -- 0:00:49
220000 -- (-887.877) [-881.692] (-885.737) (-883.402) * (-879.386) [-885.776] (-881.687) (-881.041) -- 0:00:49
Average standard deviation of split frequencies: 0.019789
220500 -- (-886.624) (-884.490) (-881.850) [-886.547] * (-880.727) (-883.268) [-882.350] (-880.938) -- 0:00:49
221000 -- [-880.658] (-883.459) (-880.909) (-883.299) * (-881.571) (-886.306) [-882.005] (-881.482) -- 0:00:49
221500 -- (-881.038) [-881.416] (-880.645) (-881.207) * (-879.911) (-884.112) (-883.642) [-881.514] -- 0:00:49
222000 -- [-882.307] (-881.284) (-881.668) (-883.716) * (-879.937) (-883.609) [-880.663] (-882.342) -- 0:00:49
222500 -- (-881.340) (-882.746) [-882.634] (-884.765) * [-881.760] (-879.839) (-881.583) (-883.366) -- 0:00:48
223000 -- (-883.402) (-883.600) [-880.293] (-883.605) * (-881.225) [-881.641] (-883.932) (-885.845) -- 0:00:48
223500 -- (-883.002) (-882.047) (-880.771) [-880.301] * (-885.209) [-880.069] (-884.937) (-882.681) -- 0:00:48
224000 -- (-885.087) (-883.729) [-882.167] (-882.194) * (-880.550) (-880.604) [-880.358] (-882.006) -- 0:00:48
224500 -- (-882.581) [-882.242] (-880.557) (-883.876) * (-883.135) (-880.636) [-880.525] (-879.939) -- 0:00:48
225000 -- (-882.664) [-883.230] (-881.389) (-883.090) * (-883.657) (-879.981) [-879.915] (-881.767) -- 0:00:48
Average standard deviation of split frequencies: 0.019761
225500 -- (-881.114) [-881.247] (-882.237) (-881.505) * (-882.395) [-881.296] (-881.019) (-884.923) -- 0:00:48
226000 -- (-881.619) [-880.594] (-881.993) (-882.843) * (-879.904) (-881.024) [-880.298] (-881.626) -- 0:00:47
226500 -- [-882.575] (-886.688) (-879.644) (-882.290) * (-880.745) (-881.169) [-880.115] (-881.870) -- 0:00:47
227000 -- (-883.520) (-879.979) [-883.425] (-881.706) * (-881.408) [-884.704] (-881.954) (-882.075) -- 0:00:47
227500 -- (-880.189) [-880.774] (-882.430) (-881.432) * (-881.279) [-883.863] (-879.583) (-881.952) -- 0:00:47
228000 -- (-879.774) (-880.564) (-883.375) [-880.210] * (-882.484) [-880.621] (-879.794) (-880.996) -- 0:00:47
228500 -- (-882.011) (-880.101) (-883.535) [-879.399] * (-886.047) (-882.805) [-880.794] (-885.287) -- 0:00:47
229000 -- (-887.646) (-882.388) [-879.377] (-882.449) * (-881.686) [-894.007] (-881.588) (-879.793) -- 0:00:47
229500 -- (-880.477) (-882.450) (-880.455) [-879.865] * [-882.107] (-887.762) (-880.150) (-880.736) -- 0:00:47
230000 -- [-881.641] (-882.998) (-879.387) (-880.035) * (-881.277) (-881.412) [-880.093] (-881.492) -- 0:00:46
Average standard deviation of split frequencies: 0.018802
230500 -- [-879.780] (-885.956) (-880.326) (-880.303) * (-883.071) (-881.524) [-880.773] (-880.683) -- 0:00:46
231000 -- [-880.064] (-881.879) (-887.092) (-880.462) * (-881.399) (-883.780) (-880.643) [-881.026] -- 0:00:49
231500 -- (-880.755) (-881.870) [-880.233] (-881.626) * (-879.431) [-881.724] (-880.671) (-880.203) -- 0:00:49
232000 -- (-885.257) [-880.277] (-881.083) (-883.418) * (-889.758) (-880.618) (-881.281) [-883.391] -- 0:00:49
232500 -- (-882.200) (-882.552) (-881.018) [-882.887] * (-888.947) [-880.918] (-882.507) (-881.826) -- 0:00:49
233000 -- (-881.683) (-881.496) (-880.152) [-882.798] * (-882.062) (-884.037) (-880.952) [-885.758] -- 0:00:49
233500 -- (-882.095) (-880.547) (-881.943) [-880.434] * (-883.560) [-883.995] (-881.500) (-882.334) -- 0:00:49
234000 -- (-881.904) (-880.757) (-881.663) [-880.186] * (-883.545) (-880.876) (-882.326) [-882.503] -- 0:00:49
234500 -- [-882.718] (-881.623) (-882.536) (-881.612) * (-879.980) (-882.696) (-880.277) [-880.185] -- 0:00:48
235000 -- [-884.104] (-883.094) (-879.920) (-881.999) * (-883.441) (-883.385) (-880.069) [-880.185] -- 0:00:48
Average standard deviation of split frequencies: 0.019134
235500 -- (-881.297) (-880.765) (-879.784) [-883.691] * (-880.182) [-879.845] (-879.947) (-881.006) -- 0:00:48
236000 -- (-883.523) (-883.805) (-880.107) [-884.314] * (-881.966) (-880.371) (-885.729) [-882.196] -- 0:00:48
236500 -- (-885.268) (-882.963) [-880.274] (-884.587) * [-879.999] (-881.029) (-884.030) (-879.752) -- 0:00:48
237000 -- (-888.230) [-882.003] (-882.381) (-882.396) * (-879.867) (-882.912) (-889.209) [-881.538] -- 0:00:48
237500 -- (-883.825) (-881.612) [-881.149] (-885.398) * (-879.382) [-882.973] (-881.631) (-883.059) -- 0:00:48
238000 -- (-880.905) (-881.420) [-880.420] (-881.320) * [-880.041] (-881.726) (-879.772) (-880.482) -- 0:00:48
238500 -- [-883.008] (-883.321) (-883.576) (-880.990) * (-880.821) (-882.746) [-880.673] (-880.640) -- 0:00:47
239000 -- (-880.654) (-880.524) [-884.586] (-881.555) * (-881.282) (-884.004) [-880.520] (-879.670) -- 0:00:47
239500 -- (-880.262) [-882.243] (-880.692) (-882.704) * (-880.724) (-887.542) (-882.991) [-879.671] -- 0:00:47
240000 -- (-880.322) (-880.680) (-882.027) [-882.233] * [-881.505] (-882.706) (-880.932) (-881.272) -- 0:00:47
Average standard deviation of split frequencies: 0.019175
240500 -- (-880.971) [-880.635] (-881.760) (-879.867) * (-880.839) (-881.647) [-881.300] (-881.551) -- 0:00:47
241000 -- [-885.055] (-880.241) (-882.960) (-882.116) * (-880.062) [-879.465] (-884.048) (-883.321) -- 0:00:47
241500 -- (-885.708) (-880.376) [-883.442] (-879.909) * [-879.972] (-880.485) (-883.338) (-884.018) -- 0:00:47
242000 -- (-883.997) [-880.537] (-882.120) (-880.928) * [-880.270] (-882.441) (-885.657) (-883.502) -- 0:00:46
242500 -- (-881.100) (-880.961) [-880.529] (-880.910) * (-879.558) [-881.950] (-881.439) (-882.840) -- 0:00:46
243000 -- [-883.228] (-880.918) (-881.923) (-880.354) * (-879.989) (-881.279) (-880.488) [-880.345] -- 0:00:46
243500 -- [-882.380] (-881.474) (-882.848) (-880.261) * (-879.968) [-880.515] (-881.061) (-881.190) -- 0:00:46
244000 -- (-882.230) (-887.501) (-879.704) [-881.146] * (-884.212) [-881.694] (-882.478) (-880.830) -- 0:00:46
244500 -- (-880.192) (-882.767) [-881.123] (-885.482) * (-884.590) (-880.433) (-880.822) [-880.295] -- 0:00:46
245000 -- (-880.841) (-884.309) (-880.452) [-881.006] * (-889.733) (-880.297) (-880.379) [-880.796] -- 0:00:46
Average standard deviation of split frequencies: 0.019163
245500 -- (-882.347) (-881.280) (-881.475) [-880.682] * (-884.514) (-880.922) (-881.656) [-881.805] -- 0:00:46
246000 -- (-882.921) (-882.102) (-880.808) [-882.426] * (-885.396) (-880.143) (-881.376) [-882.006] -- 0:00:45
246500 -- [-881.515] (-882.978) (-881.131) (-882.972) * (-880.697) (-880.968) (-882.727) [-882.561] -- 0:00:45
247000 -- [-881.435] (-882.896) (-881.307) (-880.729) * (-884.067) (-882.337) (-884.343) [-881.009] -- 0:00:45
247500 -- [-880.783] (-882.157) (-882.403) (-881.201) * (-883.361) (-880.847) (-885.223) [-880.978] -- 0:00:48
248000 -- [-882.484] (-880.415) (-880.734) (-880.607) * (-883.168) (-882.902) (-881.581) [-881.116] -- 0:00:48
248500 -- (-879.961) (-880.858) (-881.867) [-882.250] * (-882.182) [-882.254] (-880.472) (-882.223) -- 0:00:48
249000 -- (-880.927) (-880.407) [-880.930] (-881.314) * (-884.681) [-881.114] (-881.377) (-881.019) -- 0:00:48
249500 -- (-880.452) [-880.570] (-880.907) (-883.492) * (-882.233) (-880.884) (-881.995) [-883.933] -- 0:00:48
250000 -- [-879.611] (-881.233) (-882.054) (-883.121) * (-881.692) (-880.779) (-882.780) [-881.211] -- 0:00:48
Average standard deviation of split frequencies: 0.018148
250500 -- (-882.746) (-887.192) (-881.655) [-881.697] * (-884.070) (-880.670) [-885.807] (-883.215) -- 0:00:47
251000 -- (-881.279) (-883.191) (-882.140) [-881.427] * [-882.283] (-880.797) (-882.286) (-883.811) -- 0:00:47
251500 -- [-880.876] (-882.003) (-885.421) (-880.765) * (-883.154) (-881.082) [-882.216] (-883.091) -- 0:00:47
252000 -- (-879.649) (-881.278) (-881.394) [-880.462] * (-881.642) (-880.417) (-879.998) [-886.578] -- 0:00:47
252500 -- (-882.319) (-881.002) (-880.639) [-880.655] * [-883.943] (-880.147) (-882.357) (-885.156) -- 0:00:47
253000 -- (-880.354) (-881.722) (-882.815) [-880.647] * (-882.448) (-880.402) [-884.799] (-887.044) -- 0:00:47
253500 -- (-880.572) (-884.821) (-884.929) [-880.255] * (-879.358) [-880.923] (-882.423) (-881.671) -- 0:00:47
254000 -- (-881.110) (-885.669) (-888.008) [-880.221] * [-883.752] (-881.993) (-882.706) (-880.299) -- 0:00:46
254500 -- [-880.167] (-881.444) (-884.878) (-880.801) * (-879.978) [-880.351] (-884.755) (-886.835) -- 0:00:46
255000 -- (-879.665) (-888.600) (-884.589) [-880.366] * [-882.466] (-880.813) (-881.561) (-880.954) -- 0:00:46
Average standard deviation of split frequencies: 0.017736
255500 -- [-880.878] (-880.637) (-888.203) (-882.550) * (-880.668) (-880.966) [-881.577] (-883.373) -- 0:00:46
256000 -- (-880.707) [-883.063] (-881.429) (-882.545) * (-882.827) (-880.093) (-884.188) [-881.883] -- 0:00:46
256500 -- (-879.971) (-882.074) [-880.098] (-884.613) * [-879.957] (-881.937) (-882.265) (-885.750) -- 0:00:46
257000 -- [-887.177] (-887.690) (-879.655) (-884.258) * (-881.076) (-884.136) [-882.877] (-885.187) -- 0:00:46
257500 -- [-883.055] (-881.475) (-880.235) (-883.443) * [-879.786] (-883.489) (-879.358) (-880.634) -- 0:00:46
258000 -- (-879.967) (-880.701) [-883.377] (-883.058) * (-882.297) (-883.649) [-881.486] (-880.792) -- 0:00:46
258500 -- [-881.979] (-884.245) (-880.778) (-883.363) * [-883.236] (-882.302) (-879.250) (-882.602) -- 0:00:45
259000 -- (-879.502) (-886.488) [-880.416] (-887.434) * (-886.436) (-882.623) (-881.382) [-880.601] -- 0:00:45
259500 -- [-881.472] (-885.184) (-883.032) (-880.864) * (-881.529) (-883.482) [-882.174] (-880.498) -- 0:00:45
260000 -- [-881.850] (-882.136) (-882.464) (-879.619) * (-882.776) (-885.901) (-880.693) [-880.073] -- 0:00:45
Average standard deviation of split frequencies: 0.016778
260500 -- (-882.358) (-881.824) [-880.245] (-880.287) * (-882.630) (-882.109) [-881.762] (-881.517) -- 0:00:45
261000 -- (-882.325) (-879.255) [-884.756] (-881.332) * (-880.372) (-883.024) (-879.661) [-880.736] -- 0:00:45
261500 -- (-880.767) (-879.649) (-882.573) [-883.632] * (-881.410) (-880.555) [-880.809] (-881.953) -- 0:00:45
262000 -- (-881.385) (-881.801) [-882.578] (-880.981) * (-881.630) [-883.341] (-879.660) (-880.558) -- 0:00:45
262500 -- (-886.652) (-882.532) [-881.792] (-881.774) * (-880.414) (-879.850) (-881.492) [-881.945] -- 0:00:44
263000 -- [-883.220] (-881.918) (-883.366) (-883.303) * (-880.235) [-881.234] (-879.669) (-883.487) -- 0:00:44
263500 -- (-881.842) (-881.019) [-884.887] (-884.131) * [-881.491] (-881.050) (-880.448) (-880.773) -- 0:00:44
264000 -- (-881.640) (-880.184) (-881.544) [-880.111] * (-880.198) [-880.771] (-880.870) (-882.031) -- 0:00:47
264500 -- (-880.778) [-880.390] (-882.172) (-880.459) * (-884.259) (-879.698) (-881.800) [-881.158] -- 0:00:47
265000 -- (-882.167) [-879.942] (-880.273) (-879.658) * (-885.658) (-880.365) (-884.081) [-883.787] -- 0:00:47
Average standard deviation of split frequencies: 0.017230
265500 -- (-886.122) (-880.732) [-881.078] (-880.802) * (-884.128) (-881.103) [-882.055] (-882.475) -- 0:00:47
266000 -- (-880.299) (-881.409) (-881.096) [-880.553] * (-880.464) (-882.347) (-881.337) [-882.054] -- 0:00:46
266500 -- (-879.843) (-882.425) [-881.400] (-879.850) * (-881.236) (-882.782) (-879.950) [-883.119] -- 0:00:46
267000 -- (-880.119) [-880.426] (-879.545) (-879.645) * [-880.885] (-886.593) (-880.176) (-882.603) -- 0:00:46
267500 -- (-880.454) [-879.655] (-880.976) (-887.199) * [-881.099] (-880.200) (-880.550) (-880.410) -- 0:00:46
268000 -- (-881.951) (-880.897) [-881.165] (-882.256) * (-881.024) [-880.070] (-881.697) (-882.401) -- 0:00:46
268500 -- (-882.026) [-882.093] (-880.346) (-886.647) * [-881.741] (-880.978) (-879.645) (-886.338) -- 0:00:46
269000 -- (-880.026) (-882.987) (-880.428) [-881.279] * (-882.190) [-882.546] (-880.732) (-883.353) -- 0:00:46
269500 -- (-879.841) [-881.776] (-883.298) (-881.312) * (-881.063) (-880.798) (-881.101) [-879.825] -- 0:00:46
270000 -- (-882.211) (-881.514) (-883.018) [-879.908] * (-880.079) (-883.047) [-883.254] (-881.288) -- 0:00:45
Average standard deviation of split frequencies: 0.017610
270500 -- (-879.708) [-879.864] (-880.747) (-882.287) * (-881.286) (-880.340) (-888.855) [-881.800] -- 0:00:45
271000 -- (-882.010) (-882.210) (-882.269) [-881.492] * (-882.541) [-879.934] (-884.695) (-880.361) -- 0:00:45
271500 -- [-880.075] (-882.574) (-881.818) (-880.236) * (-880.353) [-880.400] (-881.847) (-886.570) -- 0:00:45
272000 -- (-881.688) (-881.828) [-881.338] (-884.739) * (-880.706) (-882.760) [-881.416] (-881.946) -- 0:00:45
272500 -- (-880.413) [-880.750] (-881.562) (-880.939) * [-880.523] (-881.051) (-882.162) (-880.931) -- 0:00:45
273000 -- [-881.501] (-882.216) (-889.469) (-880.825) * (-882.811) [-882.513] (-879.751) (-881.298) -- 0:00:45
273500 -- [-882.208] (-881.683) (-885.653) (-882.370) * (-881.800) (-883.410) (-882.631) [-880.565] -- 0:00:45
274000 -- (-884.062) (-880.166) [-879.859] (-881.826) * [-882.103] (-881.917) (-883.188) (-883.851) -- 0:00:45
274500 -- (-880.865) (-880.166) [-880.890] (-881.826) * [-880.440] (-880.935) (-880.498) (-881.649) -- 0:00:44
275000 -- (-882.543) (-880.351) [-880.334] (-880.682) * (-880.321) (-882.295) [-880.461] (-890.595) -- 0:00:44
Average standard deviation of split frequencies: 0.016985
275500 -- (-881.584) (-879.506) (-886.693) [-880.681] * (-880.298) (-881.383) [-880.455] (-881.369) -- 0:00:44
276000 -- (-882.896) [-881.277] (-881.138) (-881.014) * (-880.452) [-880.056] (-881.878) (-880.718) -- 0:00:44
276500 -- [-884.277] (-880.845) (-883.092) (-882.433) * [-879.280] (-881.806) (-880.572) (-883.466) -- 0:00:44
277000 -- (-881.409) (-883.360) [-880.933] (-880.943) * (-885.969) [-880.071] (-880.767) (-882.038) -- 0:00:44
277500 -- [-882.624] (-881.726) (-882.073) (-880.560) * (-882.379) (-881.729) (-879.679) [-883.092] -- 0:00:44
278000 -- (-880.382) [-881.891] (-879.538) (-880.541) * (-882.871) [-882.774] (-883.351) (-883.262) -- 0:00:44
278500 -- (-880.093) [-883.908] (-879.939) (-879.715) * (-885.378) (-885.345) (-881.507) [-882.675] -- 0:00:44
279000 -- (-882.567) [-886.983] (-879.556) (-879.666) * (-883.913) (-883.423) [-880.119] (-880.330) -- 0:00:43
279500 -- [-881.373] (-882.559) (-880.983) (-879.497) * (-880.382) (-881.707) [-881.085] (-883.283) -- 0:00:43
280000 -- (-879.885) (-883.626) (-881.090) [-879.707] * (-881.564) [-881.873] (-880.401) (-880.659) -- 0:00:43
Average standard deviation of split frequencies: 0.016236
280500 -- (-882.669) [-883.792] (-881.599) (-879.635) * (-883.361) (-881.061) [-880.037] (-880.224) -- 0:00:46
281000 -- (-879.557) (-882.234) (-880.817) [-886.574] * (-881.440) (-882.944) (-883.794) [-880.576] -- 0:00:46
281500 -- (-879.987) (-886.324) [-880.821] (-882.195) * [-881.117] (-882.112) (-880.757) (-880.435) -- 0:00:45
282000 -- (-880.814) [-882.341] (-881.456) (-883.758) * [-886.458] (-882.048) (-881.267) (-881.222) -- 0:00:45
282500 -- [-883.563] (-881.659) (-880.617) (-886.327) * (-881.153) (-882.749) (-881.122) [-880.783] -- 0:00:45
283000 -- (-880.833) [-879.698] (-882.339) (-880.399) * (-881.289) (-880.519) (-881.181) [-880.719] -- 0:00:45
283500 -- (-881.415) (-879.414) (-880.707) [-881.165] * (-880.297) [-880.560] (-880.515) (-881.198) -- 0:00:45
284000 -- (-881.761) [-879.876] (-884.135) (-882.149) * (-887.424) (-883.184) (-881.344) [-882.225] -- 0:00:45
284500 -- (-880.762) (-880.695) [-886.801] (-886.749) * (-885.838) [-883.072] (-882.490) (-881.827) -- 0:00:45
285000 -- [-882.590] (-880.766) (-882.425) (-888.556) * (-884.002) (-881.549) (-883.250) [-880.405] -- 0:00:45
Average standard deviation of split frequencies: 0.016136
285500 -- (-883.470) (-880.787) [-884.601] (-882.013) * (-881.718) (-881.254) [-882.384] (-880.082) -- 0:00:45
286000 -- (-887.991) (-885.330) (-882.812) [-881.879] * (-880.713) (-880.865) (-882.269) [-880.567] -- 0:00:44
286500 -- (-881.424) (-884.281) (-882.056) [-884.412] * [-879.990] (-881.103) (-881.938) (-882.641) -- 0:00:44
287000 -- (-882.094) (-882.994) (-881.657) [-881.456] * (-879.951) (-882.631) (-879.511) [-881.594] -- 0:00:44
287500 -- [-882.098] (-880.513) (-882.369) (-881.891) * [-882.516] (-880.456) (-882.553) (-880.635) -- 0:00:44
288000 -- [-879.798] (-883.054) (-882.622) (-880.357) * [-883.601] (-881.818) (-886.160) (-881.819) -- 0:00:44
288500 -- (-884.272) (-881.827) [-882.953] (-885.226) * (-880.110) [-882.110] (-885.142) (-879.715) -- 0:00:44
289000 -- [-883.070] (-881.661) (-883.060) (-882.825) * (-880.858) (-886.069) [-885.570] (-883.139) -- 0:00:44
289500 -- (-883.647) (-879.315) [-884.189] (-885.378) * (-880.528) (-885.293) [-880.813] (-881.379) -- 0:00:44
290000 -- [-880.263] (-883.077) (-881.579) (-886.201) * (-881.070) (-884.314) [-883.329] (-883.515) -- 0:00:44
Average standard deviation of split frequencies: 0.014957
290500 -- (-880.872) (-883.790) (-882.997) [-886.187] * (-883.756) (-884.206) [-879.612] (-879.936) -- 0:00:43
291000 -- [-881.622] (-882.794) (-884.419) (-887.629) * [-884.032] (-882.798) (-885.635) (-880.176) -- 0:00:43
291500 -- (-880.794) (-880.700) [-886.348] (-886.264) * (-880.418) (-882.844) [-881.642] (-879.898) -- 0:00:43
292000 -- (-881.871) (-882.283) (-885.130) [-880.887] * (-879.955) (-882.709) [-881.678] (-881.514) -- 0:00:43
292500 -- (-882.192) (-881.964) [-880.077] (-883.225) * (-887.340) (-881.700) [-880.148] (-880.187) -- 0:00:43
293000 -- (-886.284) (-881.228) [-880.890] (-880.728) * (-881.661) (-882.878) [-882.665] (-880.412) -- 0:00:43
293500 -- [-883.882] (-880.762) (-884.104) (-880.878) * (-880.692) (-882.840) [-880.283] (-880.698) -- 0:00:43
294000 -- (-884.842) [-881.936] (-880.283) (-881.232) * (-882.091) [-880.621] (-881.184) (-880.891) -- 0:00:43
294500 -- (-886.740) [-882.733] (-881.582) (-883.444) * (-881.095) [-880.601] (-881.897) (-880.348) -- 0:00:43
295000 -- (-882.388) (-881.869) (-882.030) [-883.874] * (-883.207) (-882.234) (-880.249) [-880.425] -- 0:00:43
Average standard deviation of split frequencies: 0.015738
295500 -- (-882.466) (-881.612) (-883.019) [-881.574] * (-880.324) (-880.240) (-881.609) [-879.880] -- 0:00:42
296000 -- [-882.548] (-879.966) (-882.089) (-881.396) * [-880.376] (-883.236) (-882.546) (-879.502) -- 0:00:42
296500 -- (-883.488) [-880.759] (-880.460) (-879.730) * [-885.513] (-882.286) (-883.444) (-879.410) -- 0:00:42
297000 -- (-881.734) [-880.978] (-882.968) (-883.433) * [-879.404] (-880.853) (-882.975) (-882.719) -- 0:00:42
297500 -- (-883.423) [-880.658] (-889.841) (-881.117) * (-880.622) (-880.001) [-881.176] (-882.083) -- 0:00:44
298000 -- (-880.111) (-881.295) (-882.251) [-887.149] * (-879.437) (-880.667) (-881.381) [-881.210] -- 0:00:44
298500 -- (-879.996) (-881.338) [-881.766] (-885.799) * (-880.024) [-881.434] (-879.848) (-880.092) -- 0:00:44
299000 -- (-879.718) (-879.691) (-880.841) [-880.148] * [-879.822] (-884.155) (-881.386) (-880.619) -- 0:00:44
299500 -- (-882.527) [-882.166] (-881.114) (-880.408) * [-880.820] (-882.303) (-881.324) (-879.630) -- 0:00:44
300000 -- (-881.440) (-886.394) (-881.750) [-880.015] * (-882.589) (-882.817) [-881.246] (-880.895) -- 0:00:44
Average standard deviation of split frequencies: 0.016509
300500 -- (-881.540) (-882.093) (-881.267) [-879.471] * (-882.089) (-880.664) [-880.586] (-880.141) -- 0:00:44
301000 -- (-882.919) [-883.585] (-881.225) (-881.942) * (-879.951) (-881.661) (-881.986) [-880.256] -- 0:00:44
301500 -- [-881.680] (-883.590) (-879.841) (-880.927) * (-880.551) (-880.824) (-883.507) [-880.017] -- 0:00:44
302000 -- (-881.329) [-884.625] (-881.184) (-879.849) * (-881.339) (-880.758) [-881.938] (-889.725) -- 0:00:43
302500 -- (-882.101) [-881.987] (-879.755) (-880.485) * (-880.535) (-881.067) (-882.098) [-883.435] -- 0:00:43
303000 -- (-882.428) (-882.261) [-880.990] (-880.410) * (-880.224) [-885.424] (-881.128) (-882.975) -- 0:00:43
303500 -- (-883.969) (-883.062) (-883.955) [-881.259] * (-882.604) [-880.080] (-885.304) (-881.840) -- 0:00:43
304000 -- (-885.996) (-888.973) [-883.897] (-885.702) * (-880.655) (-880.775) (-887.516) [-881.564] -- 0:00:43
304500 -- (-884.489) (-885.490) [-883.217] (-885.669) * [-880.671] (-882.893) (-888.011) (-880.508) -- 0:00:43
305000 -- (-882.871) [-883.200] (-882.841) (-888.950) * (-880.193) (-880.607) [-882.574] (-880.552) -- 0:00:43
Average standard deviation of split frequencies: 0.016040
305500 -- (-881.809) (-881.241) [-880.136] (-883.142) * (-879.980) (-880.625) [-882.129] (-882.744) -- 0:00:43
306000 -- (-883.512) [-880.484] (-880.082) (-880.909) * (-880.090) (-883.033) (-880.668) [-882.650] -- 0:00:43
306500 -- (-880.301) (-880.936) (-882.795) [-883.279] * (-886.095) (-882.755) (-879.752) [-881.986] -- 0:00:42
307000 -- (-880.367) [-882.064] (-882.096) (-881.372) * [-881.156] (-883.453) (-881.150) (-882.694) -- 0:00:42
307500 -- (-882.586) [-879.579] (-884.996) (-881.516) * [-882.367] (-881.539) (-879.736) (-879.986) -- 0:00:42
308000 -- (-883.324) (-879.643) (-882.228) [-882.014] * [-880.700] (-880.888) (-880.324) (-880.931) -- 0:00:42
308500 -- [-880.359] (-880.869) (-881.705) (-879.881) * (-880.114) (-882.402) [-880.009] (-880.252) -- 0:00:42
309000 -- (-880.025) [-882.582] (-881.090) (-881.727) * [-881.421] (-885.221) (-880.119) (-882.290) -- 0:00:42
309500 -- [-880.118] (-880.908) (-881.753) (-882.693) * (-882.195) (-884.217) [-879.714] (-882.912) -- 0:00:42
310000 -- (-880.651) (-880.128) (-882.772) [-879.992] * (-882.325) (-884.229) (-879.729) [-880.331] -- 0:00:42
Average standard deviation of split frequencies: 0.015263
310500 -- (-881.000) (-880.944) (-891.025) [-880.815] * (-883.860) (-884.222) [-881.224] (-879.834) -- 0:00:42
311000 -- (-880.892) (-882.694) (-880.637) [-881.088] * (-884.525) [-881.652] (-881.849) (-886.010) -- 0:00:42
311500 -- (-883.262) (-880.281) [-881.852] (-882.310) * (-881.774) (-884.955) [-881.174] (-882.149) -- 0:00:41
312000 -- (-883.356) (-881.009) (-881.075) [-881.231] * (-880.656) (-881.202) [-879.619] (-881.660) -- 0:00:41
312500 -- (-881.692) (-879.923) [-881.090] (-883.059) * (-881.401) (-881.704) [-884.547] (-883.148) -- 0:00:41
313000 -- (-882.527) (-882.807) (-882.466) [-885.604] * [-882.311] (-880.897) (-887.250) (-881.807) -- 0:00:41
313500 -- (-884.480) (-879.998) [-879.639] (-882.903) * (-884.559) [-881.098] (-884.887) (-882.685) -- 0:00:43
314000 -- [-885.962] (-881.554) (-884.901) (-882.228) * [-884.279] (-880.117) (-881.903) (-882.877) -- 0:00:43
314500 -- (-887.359) [-880.993] (-879.588) (-883.513) * (-880.390) (-881.138) [-882.048] (-888.373) -- 0:00:43
315000 -- (-885.907) (-880.768) [-880.130] (-882.176) * [-879.722] (-882.126) (-880.091) (-885.103) -- 0:00:43
Average standard deviation of split frequencies: 0.013953
315500 -- (-881.902) (-882.120) (-880.997) [-881.079] * (-880.593) (-881.656) [-879.818] (-882.311) -- 0:00:43
316000 -- (-880.748) (-882.045) (-880.858) [-881.418] * [-881.733] (-882.765) (-880.065) (-881.184) -- 0:00:43
316500 -- (-881.485) (-884.033) [-882.052] (-881.254) * (-881.550) [-880.854] (-882.051) (-881.652) -- 0:00:43
317000 -- (-881.489) (-883.848) [-879.981] (-881.650) * (-880.612) [-880.002] (-883.875) (-881.781) -- 0:00:43
317500 -- (-882.257) (-881.209) [-879.521] (-882.371) * (-882.952) (-880.799) [-879.274] (-884.440) -- 0:00:42
318000 -- (-883.667) (-881.251) [-879.472] (-881.384) * (-882.683) (-881.823) (-881.944) [-880.864] -- 0:00:42
318500 -- (-892.414) (-880.085) (-880.369) [-882.956] * [-881.270] (-883.967) (-882.021) (-882.564) -- 0:00:42
319000 -- (-888.355) (-881.326) [-880.584] (-881.374) * [-882.101] (-882.329) (-885.894) (-879.991) -- 0:00:42
319500 -- (-883.820) (-880.736) (-889.751) [-880.785] * [-883.284] (-882.208) (-881.208) (-882.285) -- 0:00:42
320000 -- (-883.456) (-882.601) (-881.768) [-880.639] * (-879.402) (-883.372) [-883.719] (-882.143) -- 0:00:42
Average standard deviation of split frequencies: 0.014268
320500 -- [-881.436] (-881.133) (-882.141) (-883.695) * (-883.180) [-884.488] (-883.013) (-882.522) -- 0:00:42
321000 -- (-879.293) (-882.332) (-883.069) [-880.597] * (-882.547) (-883.535) (-881.357) [-880.004] -- 0:00:42
321500 -- (-880.810) (-896.545) (-879.834) [-884.106] * (-881.494) (-880.591) (-881.544) [-879.398] -- 0:00:42
322000 -- [-880.096] (-881.334) (-883.833) (-881.931) * [-885.162] (-880.793) (-880.028) (-886.470) -- 0:00:42
322500 -- [-880.096] (-881.873) (-881.384) (-890.542) * (-889.185) (-880.772) (-881.137) [-880.562] -- 0:00:42
323000 -- (-880.294) [-881.962] (-882.011) (-881.515) * (-882.680) (-882.749) (-882.712) [-880.093] -- 0:00:41
323500 -- (-880.740) (-881.050) (-883.524) [-881.456] * (-882.231) [-883.833] (-884.460) (-882.201) -- 0:00:41
324000 -- (-882.605) (-879.958) (-880.533) [-880.662] * (-882.367) (-882.057) [-880.481] (-884.449) -- 0:00:41
324500 -- [-880.794] (-881.230) (-879.687) (-880.862) * [-881.358] (-882.106) (-882.949) (-884.011) -- 0:00:41
325000 -- (-880.563) (-880.180) [-879.870] (-884.026) * (-879.849) [-881.425] (-880.268) (-883.396) -- 0:00:41
Average standard deviation of split frequencies: 0.013014
325500 -- [-880.083] (-882.774) (-881.233) (-882.271) * [-879.817] (-882.344) (-881.566) (-882.875) -- 0:00:41
326000 -- (-881.554) [-884.008] (-879.969) (-879.449) * (-881.255) (-880.975) (-881.051) [-882.694] -- 0:00:41
326500 -- (-882.084) (-881.985) [-880.867] (-879.732) * (-881.420) (-882.062) (-882.661) [-882.391] -- 0:00:41
327000 -- (-883.209) (-883.276) [-879.583] (-883.274) * (-882.020) (-883.001) (-880.678) [-880.743] -- 0:00:41
327500 -- [-882.938] (-882.982) (-881.027) (-882.112) * (-881.430) (-883.483) [-880.339] (-881.503) -- 0:00:41
328000 -- (-884.151) (-883.926) [-881.364] (-881.843) * [-884.245] (-883.679) (-884.336) (-883.474) -- 0:00:40
328500 -- (-882.170) [-883.516] (-881.844) (-880.028) * (-888.379) (-882.334) (-885.390) [-880.512] -- 0:00:40
329000 -- (-882.175) (-885.157) (-881.011) [-880.218] * (-889.583) [-880.128] (-882.845) (-882.375) -- 0:00:40
329500 -- (-882.052) (-886.164) (-885.972) [-880.097] * (-885.572) (-880.173) (-881.093) [-881.511] -- 0:00:40
330000 -- (-884.973) (-883.767) (-881.953) [-880.838] * (-881.873) [-879.620] (-880.307) (-884.708) -- 0:00:40
Average standard deviation of split frequencies: 0.012076
330500 -- (-884.395) (-882.492) [-888.094] (-881.584) * (-882.902) (-881.127) [-882.778] (-881.808) -- 0:00:42
331000 -- [-880.391] (-882.628) (-882.407) (-890.824) * (-885.231) (-882.452) [-883.986] (-879.652) -- 0:00:42
331500 -- (-880.418) [-880.644] (-881.864) (-883.141) * [-881.790] (-880.906) (-883.839) (-881.005) -- 0:00:42
332000 -- (-884.876) (-883.989) (-885.259) [-879.980] * [-885.967] (-881.100) (-880.692) (-879.554) -- 0:00:42
332500 -- (-881.442) (-881.345) (-886.329) [-880.170] * (-885.660) (-880.892) [-881.480] (-880.700) -- 0:00:42
333000 -- [-880.035] (-881.557) (-881.863) (-883.283) * (-881.512) (-879.784) (-882.480) [-883.399] -- 0:00:42
333500 -- (-882.808) [-881.368] (-882.736) (-880.902) * (-884.139) (-880.907) (-885.249) [-879.791] -- 0:00:41
334000 -- (-887.478) [-881.368] (-883.083) (-884.326) * (-881.116) [-881.337] (-881.382) (-879.923) -- 0:00:41
334500 -- (-882.232) [-881.427] (-882.715) (-883.626) * [-880.791] (-890.801) (-881.862) (-881.256) -- 0:00:41
335000 -- [-883.027] (-882.607) (-881.439) (-880.773) * (-884.117) (-888.096) [-883.018] (-880.728) -- 0:00:41
Average standard deviation of split frequencies: 0.012297
335500 -- (-880.259) (-883.917) (-880.564) [-881.685] * (-880.626) [-887.347] (-880.494) (-882.751) -- 0:00:41
336000 -- (-880.855) (-880.189) [-887.764] (-882.280) * (-881.687) (-882.912) [-879.982] (-879.509) -- 0:00:41
336500 -- (-881.135) (-881.049) [-882.962] (-883.805) * (-882.119) [-880.086] (-879.942) (-887.761) -- 0:00:41
337000 -- [-879.711] (-879.801) (-881.092) (-882.220) * (-882.344) [-881.671] (-880.128) (-879.501) -- 0:00:41
337500 -- [-879.765] (-880.581) (-881.283) (-880.737) * (-881.454) (-880.001) [-880.999] (-879.853) -- 0:00:41
338000 -- (-880.359) (-880.210) [-883.874] (-881.750) * (-883.803) (-880.105) (-881.542) [-881.319] -- 0:00:41
338500 -- (-881.430) [-880.041] (-881.078) (-882.344) * (-883.352) [-881.529] (-881.852) (-883.008) -- 0:00:41
339000 -- (-880.266) (-882.077) [-887.649] (-880.935) * (-888.714) [-882.026] (-882.549) (-880.923) -- 0:00:40
339500 -- (-884.792) (-880.310) [-881.101] (-880.926) * (-888.620) (-882.513) (-882.000) [-882.558] -- 0:00:40
340000 -- (-885.088) [-885.647] (-881.237) (-881.498) * (-879.899) (-879.977) [-880.395] (-881.664) -- 0:00:40
Average standard deviation of split frequencies: 0.011640
340500 -- (-888.025) (-882.349) (-880.116) [-880.418] * (-880.967) [-881.067] (-880.267) (-880.728) -- 0:00:40
341000 -- (-882.091) [-879.870] (-886.417) (-880.098) * (-880.203) [-882.695] (-880.309) (-881.115) -- 0:00:40
341500 -- (-881.097) (-880.379) [-880.671] (-880.500) * [-880.196] (-882.842) (-881.130) (-880.441) -- 0:00:40
342000 -- (-881.923) (-881.156) [-882.639] (-883.059) * [-880.204] (-881.329) (-879.911) (-883.622) -- 0:00:40
342500 -- (-881.726) (-884.764) [-881.131] (-883.859) * (-882.162) (-880.106) (-883.066) [-880.958] -- 0:00:40
343000 -- [-880.067] (-884.468) (-882.181) (-883.128) * [-882.128] (-881.093) (-885.356) (-881.937) -- 0:00:40
343500 -- (-882.285) (-884.975) (-881.569) [-881.419] * (-880.705) (-882.325) (-883.550) [-881.822] -- 0:00:40
344000 -- (-880.161) (-881.841) [-883.189] (-879.915) * (-883.135) (-884.302) [-883.163] (-887.302) -- 0:00:40
344500 -- (-885.991) (-881.642) [-880.455] (-879.887) * (-882.056) [-879.427] (-880.047) (-883.010) -- 0:00:39
345000 -- (-882.344) (-881.755) (-880.475) [-881.654] * [-881.635] (-879.795) (-881.698) (-882.979) -- 0:00:39
Average standard deviation of split frequencies: 0.011884
345500 -- (-882.335) (-887.754) [-881.053] (-880.654) * (-881.143) (-880.164) (-881.540) [-880.185] -- 0:00:39
346000 -- (-882.590) (-883.399) (-881.837) [-879.930] * [-882.789] (-880.550) (-882.300) (-881.504) -- 0:00:39
346500 -- (-880.907) (-881.833) (-881.475) [-880.728] * (-879.489) (-879.936) (-882.920) [-882.207] -- 0:00:41
347000 -- [-884.951] (-883.588) (-882.023) (-879.941) * [-879.796] (-883.117) (-882.354) (-882.956) -- 0:00:41
347500 -- (-880.831) (-885.512) [-880.375] (-884.434) * (-882.761) (-880.550) [-881.785] (-880.003) -- 0:00:41
348000 -- (-880.385) (-881.196) [-882.121] (-883.567) * (-882.381) (-881.705) (-881.305) [-881.065] -- 0:00:41
348500 -- (-881.130) [-882.121] (-886.070) (-882.693) * [-881.343] (-880.690) (-880.412) (-882.002) -- 0:00:41
349000 -- [-884.143] (-880.981) (-879.343) (-880.019) * (-882.474) [-880.535] (-880.730) (-880.420) -- 0:00:41
349500 -- (-883.066) [-879.573] (-880.695) (-879.912) * (-882.435) (-883.639) (-881.391) [-880.794] -- 0:00:40
350000 -- (-882.388) (-880.011) (-882.644) [-880.147] * (-882.823) (-881.840) [-887.156] (-881.072) -- 0:00:40
Average standard deviation of split frequencies: 0.012099
350500 -- (-882.388) (-880.167) (-881.462) [-880.018] * [-880.782] (-882.259) (-882.178) (-880.931) -- 0:00:40
351000 -- (-881.631) (-881.055) [-881.852] (-881.078) * (-881.053) (-885.920) [-880.955] (-883.232) -- 0:00:40
351500 -- (-881.168) (-883.013) (-880.970) [-881.172] * (-886.253) (-880.428) (-880.253) [-880.818] -- 0:00:40
352000 -- (-880.319) (-882.224) [-884.472] (-882.318) * (-885.164) (-880.432) (-881.430) [-880.259] -- 0:00:40
352500 -- (-880.116) [-884.273] (-882.629) (-882.737) * (-880.144) (-880.379) (-881.998) [-879.711] -- 0:00:40
353000 -- [-884.034] (-885.048) (-883.308) (-881.496) * (-882.579) [-881.225] (-882.428) (-879.958) -- 0:00:40
353500 -- (-881.720) (-880.578) [-879.261] (-881.597) * (-883.726) (-880.830) [-880.620] (-881.256) -- 0:00:40
354000 -- (-882.319) (-883.573) [-879.873] (-882.314) * (-882.470) (-879.862) [-881.071] (-879.928) -- 0:00:40
354500 -- (-882.471) [-883.181] (-881.768) (-881.968) * [-880.954] (-882.022) (-881.841) (-882.092) -- 0:00:40
355000 -- [-880.943] (-882.179) (-881.290) (-879.520) * (-884.975) (-882.482) [-881.755] (-881.522) -- 0:00:39
Average standard deviation of split frequencies: 0.012065
355500 -- (-881.457) (-886.612) [-879.531] (-879.755) * (-885.974) (-882.166) [-879.938] (-881.791) -- 0:00:39
356000 -- [-881.972] (-884.621) (-880.800) (-880.490) * (-880.624) (-881.665) (-881.863) [-882.777] -- 0:00:39
356500 -- [-883.025] (-882.895) (-880.904) (-882.470) * (-880.615) (-883.371) (-882.109) [-883.103] -- 0:00:39
357000 -- (-882.108) (-884.242) (-880.337) [-881.706] * [-879.730] (-882.464) (-884.594) (-883.582) -- 0:00:39
357500 -- (-881.831) (-881.632) [-881.154] (-880.619) * [-881.569] (-884.845) (-881.549) (-879.797) -- 0:00:39
358000 -- (-886.295) (-880.908) (-881.405) [-880.537] * (-881.779) (-880.274) (-880.132) [-881.014] -- 0:00:39
358500 -- (-883.745) (-881.113) [-883.030] (-884.620) * [-880.742] (-884.950) (-883.185) (-881.174) -- 0:00:39
359000 -- [-882.765] (-880.996) (-881.912) (-884.430) * (-879.775) (-882.014) [-881.293] (-882.035) -- 0:00:39
359500 -- (-880.910) (-881.337) (-881.052) [-879.745] * (-880.383) (-884.591) [-880.540] (-881.890) -- 0:00:39
360000 -- [-881.173] (-882.126) (-881.504) (-881.569) * (-880.166) (-880.160) (-882.505) [-883.982] -- 0:00:39
Average standard deviation of split frequencies: 0.012071
360500 -- (-879.498) [-881.260] (-881.564) (-881.424) * (-879.279) [-882.031] (-880.530) (-884.053) -- 0:00:39
361000 -- (-880.114) (-883.551) [-879.807] (-879.730) * (-879.764) [-880.243] (-881.977) (-882.579) -- 0:00:38
361500 -- (-880.336) [-881.465] (-883.091) (-880.069) * (-883.502) (-884.744) [-882.166] (-881.480) -- 0:00:38
362000 -- (-880.358) (-880.100) [-879.546] (-880.525) * [-879.707] (-887.038) (-882.861) (-881.726) -- 0:00:38
362500 -- (-881.289) (-880.567) [-880.094] (-881.269) * [-880.130] (-883.424) (-881.255) (-884.868) -- 0:00:38
363000 -- [-883.117] (-880.805) (-879.752) (-884.256) * (-880.442) (-885.206) [-883.853] (-881.233) -- 0:00:38
363500 -- (-882.109) (-881.339) (-882.144) [-881.308] * (-880.341) (-880.918) [-880.884] (-880.042) -- 0:00:40
364000 -- (-881.555) (-880.416) (-881.747) [-885.068] * (-882.840) (-883.349) [-880.091] (-882.048) -- 0:00:40
364500 -- (-881.705) (-881.041) [-880.965] (-881.836) * (-881.176) (-880.508) (-881.637) [-881.765] -- 0:00:40
365000 -- [-884.933] (-882.727) (-884.318) (-880.430) * [-882.237] (-881.906) (-882.173) (-882.780) -- 0:00:40
Average standard deviation of split frequencies: 0.011895
365500 -- (-882.475) (-883.712) (-882.825) [-881.919] * (-883.557) (-881.398) (-880.768) [-883.724] -- 0:00:39
366000 -- [-881.366] (-884.026) (-881.641) (-884.651) * (-885.122) (-882.025) (-880.855) [-881.115] -- 0:00:39
366500 -- (-880.752) (-884.889) [-880.735] (-882.445) * (-881.687) (-881.817) [-880.236] (-880.064) -- 0:00:39
367000 -- (-881.017) (-884.331) (-881.517) [-883.128] * (-882.177) (-880.288) [-880.642] (-882.449) -- 0:00:39
367500 -- (-883.002) (-879.835) (-885.323) [-883.730] * (-883.114) [-880.423] (-882.882) (-880.838) -- 0:00:39
368000 -- [-880.471] (-880.237) (-881.733) (-885.787) * (-884.306) (-880.106) [-883.550] (-880.972) -- 0:00:39
368500 -- (-880.665) [-881.442] (-879.505) (-881.444) * (-880.336) [-882.936] (-880.743) (-883.451) -- 0:00:39
369000 -- (-888.588) [-880.140] (-881.252) (-880.826) * (-881.562) [-884.261] (-882.459) (-883.825) -- 0:00:39
369500 -- (-886.182) (-880.277) [-880.769] (-880.078) * (-881.930) (-880.964) [-880.607] (-882.202) -- 0:00:39
370000 -- (-882.487) [-883.425] (-879.597) (-880.035) * (-882.319) [-881.669] (-882.349) (-881.326) -- 0:00:39
Average standard deviation of split frequencies: 0.011147
370500 -- [-880.547] (-880.181) (-880.576) (-880.320) * [-881.687] (-880.243) (-884.091) (-882.812) -- 0:00:39
371000 -- (-881.381) (-880.374) [-879.616] (-881.785) * [-880.828] (-880.090) (-879.955) (-881.325) -- 0:00:38
371500 -- (-884.507) [-880.340] (-880.507) (-885.362) * (-883.984) (-884.405) [-881.289] (-882.629) -- 0:00:38
372000 -- (-883.214) (-881.430) (-882.715) [-880.684] * [-885.745] (-881.831) (-880.091) (-882.178) -- 0:00:38
372500 -- (-880.618) (-880.147) (-885.158) [-879.930] * (-883.999) [-882.611] (-880.991) (-880.055) -- 0:00:38
373000 -- (-880.340) (-879.258) (-882.417) [-882.635] * [-885.086] (-885.580) (-881.788) (-879.690) -- 0:00:38
373500 -- (-880.716) [-880.146] (-881.904) (-880.504) * (-882.209) [-884.164] (-881.172) (-880.477) -- 0:00:38
374000 -- [-885.028] (-879.969) (-884.393) (-880.571) * [-882.860] (-886.459) (-879.578) (-893.827) -- 0:00:38
374500 -- (-882.567) (-880.836) (-885.697) [-881.556] * (-883.785) (-882.187) [-880.117] (-884.654) -- 0:00:38
375000 -- [-881.914] (-881.661) (-882.381) (-880.466) * (-880.588) (-882.160) (-880.591) [-884.028] -- 0:00:38
Average standard deviation of split frequencies: 0.011947
375500 -- [-883.189] (-886.305) (-880.247) (-879.557) * [-880.655] (-885.686) (-879.701) (-881.259) -- 0:00:38
376000 -- (-881.339) (-880.781) [-880.011] (-879.875) * [-884.020] (-886.144) (-879.415) (-881.420) -- 0:00:38
376500 -- (-892.204) (-880.381) [-880.737] (-882.513) * (-880.841) [-879.399] (-879.643) (-885.586) -- 0:00:38
377000 -- (-884.050) [-880.634] (-884.246) (-879.866) * (-880.740) (-880.476) (-880.518) [-879.701] -- 0:00:38
377500 -- (-880.377) [-880.686] (-884.923) (-880.941) * (-879.854) (-883.099) [-879.523] (-881.988) -- 0:00:37
378000 -- (-880.623) (-879.836) [-884.011] (-879.978) * (-880.357) [-883.152] (-879.375) (-881.425) -- 0:00:37
378500 -- (-880.602) [-879.792] (-883.075) (-881.027) * [-882.151] (-881.183) (-879.486) (-881.015) -- 0:00:37
379000 -- (-879.661) [-879.646] (-884.682) (-880.083) * (-880.287) (-885.790) [-879.650] (-880.841) -- 0:00:37
379500 -- [-880.770] (-882.918) (-883.473) (-881.213) * (-879.417) (-880.393) [-879.389] (-881.814) -- 0:00:37
380000 -- (-880.265) [-883.853] (-886.727) (-882.453) * [-880.776] (-879.941) (-880.665) (-884.017) -- 0:00:39
Average standard deviation of split frequencies: 0.011510
380500 -- [-880.745] (-883.666) (-885.282) (-880.084) * (-883.035) [-880.985] (-880.071) (-882.513) -- 0:00:39
381000 -- (-882.628) (-881.320) (-882.722) [-881.182] * (-881.980) [-881.038] (-879.970) (-886.306) -- 0:00:38
381500 -- [-880.032] (-882.607) (-880.294) (-880.991) * (-882.601) (-880.307) (-881.680) [-880.804] -- 0:00:38
382000 -- (-884.660) [-881.888] (-880.640) (-879.847) * (-882.065) [-882.921] (-891.022) (-886.221) -- 0:00:38
382500 -- [-882.711] (-883.141) (-881.312) (-882.167) * (-880.643) [-881.748] (-880.696) (-881.022) -- 0:00:38
383000 -- [-881.771] (-882.813) (-883.126) (-882.715) * (-884.751) (-883.164) (-883.502) [-880.138] -- 0:00:38
383500 -- (-881.272) (-880.641) [-881.037] (-885.520) * (-883.284) (-883.617) (-882.459) [-879.444] -- 0:00:38
384000 -- [-880.814] (-880.274) (-883.678) (-883.198) * (-882.972) (-882.209) (-880.332) [-882.714] -- 0:00:38
384500 -- [-881.062] (-879.662) (-885.873) (-887.493) * (-880.840) (-882.224) (-881.758) [-880.811] -- 0:00:38
385000 -- (-881.280) (-881.038) (-885.496) [-883.002] * (-879.256) (-882.197) (-884.267) [-884.643] -- 0:00:38
Average standard deviation of split frequencies: 0.012213
385500 -- (-881.297) (-882.179) [-882.786] (-884.460) * (-883.600) (-881.497) (-881.503) [-882.022] -- 0:00:38
386000 -- (-880.146) [-883.888] (-880.648) (-882.994) * [-882.556] (-883.544) (-881.938) (-883.151) -- 0:00:38
386500 -- [-880.391] (-879.999) (-880.127) (-881.142) * (-885.723) (-882.332) [-882.602] (-881.065) -- 0:00:38
387000 -- (-880.371) (-880.301) (-880.938) [-889.641] * (-886.671) (-882.644) [-884.879] (-881.632) -- 0:00:38
387500 -- [-881.465] (-881.845) (-880.344) (-886.842) * [-880.349] (-883.272) (-880.300) (-881.624) -- 0:00:37
388000 -- [-883.704] (-884.501) (-881.819) (-881.932) * (-884.220) (-882.934) [-881.225] (-881.111) -- 0:00:37
388500 -- (-881.547) [-883.455] (-884.356) (-881.838) * (-881.483) (-882.475) [-881.860] (-881.895) -- 0:00:37
389000 -- (-882.385) [-881.347] (-884.362) (-883.306) * [-883.613] (-881.125) (-881.746) (-883.415) -- 0:00:37
389500 -- (-883.011) (-884.030) [-879.174] (-883.719) * [-882.744] (-885.850) (-880.899) (-886.360) -- 0:00:37
390000 -- [-881.056] (-879.981) (-879.506) (-881.924) * (-884.500) [-885.070] (-880.682) (-884.256) -- 0:00:37
Average standard deviation of split frequencies: 0.012268
390500 -- (-879.792) (-879.892) [-880.496] (-880.890) * (-885.107) (-881.920) [-881.208] (-886.188) -- 0:00:37
391000 -- (-882.307) (-879.389) (-881.473) [-882.514] * [-882.680] (-885.329) (-879.778) (-881.299) -- 0:00:37
391500 -- (-882.885) (-881.359) (-879.923) [-879.858] * (-882.957) (-883.252) [-879.771] (-881.453) -- 0:00:37
392000 -- (-883.221) [-880.409] (-881.643) (-880.632) * (-880.601) (-882.308) [-880.916] (-880.007) -- 0:00:37
392500 -- [-883.337] (-880.530) (-879.658) (-879.784) * (-881.829) [-880.580] (-880.383) (-880.797) -- 0:00:37
393000 -- (-880.866) (-885.228) [-880.619] (-884.156) * (-885.765) (-881.953) [-879.811] (-880.894) -- 0:00:37
393500 -- (-880.797) (-882.484) [-881.796] (-881.126) * (-884.550) (-881.644) (-882.834) [-885.285] -- 0:00:36
394000 -- (-884.356) (-883.181) [-882.040] (-882.250) * [-881.553] (-883.361) (-880.166) (-882.037) -- 0:00:36
394500 -- (-885.126) (-883.884) [-880.870] (-881.389) * [-880.073] (-880.808) (-885.637) (-882.001) -- 0:00:36
395000 -- [-880.284] (-884.031) (-882.562) (-880.964) * (-882.164) (-881.632) [-881.233] (-882.743) -- 0:00:36
Average standard deviation of split frequencies: 0.012499
395500 -- [-879.769] (-888.857) (-882.541) (-882.875) * (-882.561) (-880.095) (-882.732) [-880.719] -- 0:00:36
396000 -- (-879.878) (-885.312) [-880.966] (-881.761) * [-881.180] (-882.452) (-880.307) (-882.266) -- 0:00:38
396500 -- [-882.410] (-884.591) (-882.165) (-880.819) * (-881.749) (-879.702) (-880.440) [-881.306] -- 0:00:38
397000 -- (-881.496) (-880.915) [-880.759] (-881.987) * (-883.512) (-883.232) [-880.380] (-881.628) -- 0:00:37
397500 -- (-885.522) [-880.658] (-880.512) (-881.693) * (-879.471) (-882.416) [-882.054] (-884.110) -- 0:00:37
398000 -- (-881.579) (-882.861) [-881.281] (-881.742) * (-881.737) (-880.544) (-880.544) [-881.028] -- 0:00:37
398500 -- (-880.014) [-881.727] (-880.726) (-879.808) * (-880.735) (-879.459) (-880.631) [-879.990] -- 0:00:37
399000 -- [-880.297] (-882.193) (-885.857) (-882.223) * (-879.699) (-880.871) [-883.704] (-879.680) -- 0:00:37
399500 -- (-881.733) (-880.689) (-881.643) [-881.348] * (-882.480) [-881.420] (-882.196) (-885.301) -- 0:00:37
400000 -- (-889.190) (-881.385) (-886.728) [-882.950] * (-883.879) [-883.042] (-882.009) (-883.795) -- 0:00:37
Average standard deviation of split frequencies: 0.011889
400500 -- (-887.478) (-881.799) (-882.741) [-884.263] * (-883.378) [-882.412] (-884.553) (-881.590) -- 0:00:37
401000 -- (-882.579) [-884.872] (-883.615) (-880.128) * (-882.639) [-883.967] (-882.743) (-881.844) -- 0:00:37
401500 -- (-883.376) (-881.484) [-882.761] (-883.049) * (-883.870) [-882.144] (-881.006) (-882.271) -- 0:00:37
402000 -- (-883.028) [-881.638] (-881.480) (-880.313) * (-882.132) (-880.975) [-879.844] (-881.216) -- 0:00:37
402500 -- [-879.788] (-882.793) (-881.633) (-879.721) * [-882.406] (-881.874) (-883.122) (-881.619) -- 0:00:37
403000 -- (-880.434) (-880.635) [-880.627] (-880.540) * (-880.281) (-886.285) (-881.331) [-879.843] -- 0:00:37
403500 -- (-882.004) [-881.043] (-882.504) (-882.386) * (-882.307) [-883.738] (-882.294) (-882.357) -- 0:00:36
404000 -- (-885.392) (-880.402) [-888.449] (-882.424) * (-879.642) (-887.474) (-881.214) [-879.841] -- 0:00:36
404500 -- [-886.318] (-882.255) (-884.047) (-880.984) * (-880.913) [-880.647] (-880.967) (-880.833) -- 0:00:36
405000 -- [-881.341] (-883.545) (-883.205) (-888.260) * (-880.468) (-880.060) (-880.406) [-879.916] -- 0:00:36
Average standard deviation of split frequencies: 0.011428
405500 -- [-879.991] (-882.687) (-882.742) (-884.926) * (-881.098) (-881.054) [-881.315] (-889.054) -- 0:00:36
406000 -- (-879.861) (-884.258) (-881.423) [-883.538] * (-881.479) (-882.148) [-882.934] (-883.293) -- 0:00:36
406500 -- (-883.405) [-880.086] (-881.419) (-886.611) * (-881.476) (-884.938) (-879.874) [-884.365] -- 0:00:36
407000 -- [-883.346] (-881.991) (-881.446) (-884.355) * (-880.278) (-880.327) [-883.220] (-880.653) -- 0:00:36
407500 -- (-882.619) (-886.303) [-881.767] (-886.314) * (-881.279) (-880.243) (-882.847) [-880.161] -- 0:00:36
408000 -- (-883.016) (-882.655) [-882.639] (-882.139) * [-881.424] (-886.073) (-880.298) (-881.849) -- 0:00:36
408500 -- (-880.483) (-887.969) [-882.546] (-883.370) * (-886.852) (-883.021) [-881.272] (-882.686) -- 0:00:36
409000 -- (-879.575) (-884.305) (-880.625) [-881.886] * [-882.690] (-882.554) (-882.441) (-882.982) -- 0:00:36
409500 -- (-882.873) (-887.659) [-882.733] (-883.011) * [-880.666] (-882.473) (-883.650) (-881.898) -- 0:00:36
410000 -- (-884.195) (-881.400) (-886.594) [-880.882] * [-880.163] (-882.715) (-884.333) (-881.334) -- 0:00:35
Average standard deviation of split frequencies: 0.010841
410500 -- (-882.423) (-883.320) [-882.590] (-881.489) * (-881.895) [-887.303] (-881.503) (-882.783) -- 0:00:35
411000 -- [-879.934] (-880.039) (-880.012) (-881.177) * (-881.143) (-885.905) [-882.020] (-884.998) -- 0:00:35
411500 -- [-879.924] (-880.824) (-880.320) (-885.468) * [-880.196] (-884.789) (-882.220) (-884.339) -- 0:00:35
412000 -- [-880.322] (-880.078) (-880.612) (-882.238) * [-880.106] (-887.553) (-881.819) (-880.157) -- 0:00:35
412500 -- (-880.640) [-880.094] (-881.353) (-880.467) * (-885.103) (-884.315) (-882.503) [-879.641] -- 0:00:37
413000 -- (-884.779) [-881.639] (-881.511) (-881.023) * (-879.892) [-883.749] (-880.192) (-879.367) -- 0:00:36
413500 -- (-882.543) (-880.484) [-882.835] (-881.140) * (-883.187) (-880.609) (-881.028) [-880.661] -- 0:00:36
414000 -- (-883.090) [-880.407] (-880.596) (-879.485) * (-881.748) [-883.273] (-880.093) (-879.829) -- 0:00:36
414500 -- (-880.332) (-881.280) [-879.419] (-880.999) * (-882.739) (-880.100) (-879.686) [-882.436] -- 0:00:36
415000 -- (-880.078) (-879.813) [-882.739] (-883.680) * (-881.304) (-879.610) (-882.228) [-881.411] -- 0:00:36
Average standard deviation of split frequencies: 0.009695
415500 -- (-879.520) (-880.476) (-886.445) [-882.259] * (-884.536) (-883.342) [-880.657] (-880.917) -- 0:00:36
416000 -- (-880.388) (-880.779) (-883.287) [-883.568] * (-881.497) [-880.869] (-880.178) (-882.019) -- 0:00:36
416500 -- (-880.241) [-882.351] (-894.568) (-883.237) * (-881.779) [-880.077] (-880.143) (-882.341) -- 0:00:36
417000 -- (-888.418) (-883.084) (-882.500) [-883.034] * (-884.395) (-881.115) [-879.860] (-881.014) -- 0:00:36
417500 -- (-882.511) (-885.080) [-882.464] (-883.535) * [-881.055] (-882.130) (-879.467) (-882.529) -- 0:00:36
418000 -- [-880.269] (-881.792) (-883.006) (-880.036) * (-880.584) (-879.869) [-880.292] (-880.419) -- 0:00:36
418500 -- (-879.384) (-880.700) (-880.382) [-880.358] * (-881.014) [-887.484] (-881.887) (-879.947) -- 0:00:36
419000 -- [-883.696] (-882.937) (-891.921) (-880.275) * (-880.536) (-882.579) (-881.522) [-879.234] -- 0:00:36
419500 -- (-880.398) (-882.560) (-886.893) [-881.194] * (-880.615) (-880.757) (-882.134) [-879.826] -- 0:00:35
420000 -- (-882.672) (-888.443) [-881.380] (-881.024) * [-880.300] (-879.971) (-880.444) (-881.528) -- 0:00:35
Average standard deviation of split frequencies: 0.008701
420500 -- [-883.197] (-882.691) (-881.434) (-881.400) * (-879.760) (-880.706) [-882.675] (-883.608) -- 0:00:35
421000 -- [-882.898] (-879.510) (-880.579) (-882.692) * (-883.804) (-882.742) (-881.669) [-882.070] -- 0:00:35
421500 -- (-885.574) [-880.369] (-880.205) (-882.540) * (-881.215) [-882.554] (-881.837) (-879.457) -- 0:00:35
422000 -- (-884.129) (-880.554) (-881.559) [-880.922] * (-884.196) (-882.291) (-881.220) [-883.265] -- 0:00:35
422500 -- [-883.266] (-884.293) (-880.153) (-890.100) * (-883.705) (-883.378) [-879.695] (-881.338) -- 0:00:35
423000 -- (-886.713) [-881.771] (-880.473) (-885.124) * (-885.389) (-880.708) [-880.198] (-879.862) -- 0:00:35
423500 -- (-883.126) (-880.694) [-880.326] (-883.203) * (-884.782) (-881.772) (-881.605) [-880.195] -- 0:00:35
424000 -- (-883.176) [-881.293] (-880.688) (-883.907) * (-880.620) [-885.318] (-881.571) (-883.080) -- 0:00:35
424500 -- (-881.466) (-881.922) (-879.396) [-882.083] * [-880.157] (-880.545) (-881.752) (-880.627) -- 0:00:35
425000 -- (-882.614) (-880.933) [-879.432] (-882.075) * (-881.892) (-882.111) (-882.557) [-882.208] -- 0:00:35
Average standard deviation of split frequencies: 0.009283
425500 -- (-887.043) (-881.277) [-884.445] (-883.913) * (-883.910) [-879.913] (-891.011) (-881.526) -- 0:00:35
426000 -- (-887.944) [-880.419] (-884.047) (-883.131) * (-881.705) [-882.225] (-886.185) (-882.052) -- 0:00:35
426500 -- (-882.248) (-879.387) [-884.400] (-884.031) * (-885.890) (-882.908) (-882.577) [-883.503] -- 0:00:34
427000 -- [-879.878] (-880.728) (-882.365) (-881.282) * [-882.348] (-882.741) (-883.179) (-882.239) -- 0:00:34
427500 -- (-881.385) [-880.041] (-880.352) (-881.243) * [-882.030] (-887.053) (-882.384) (-880.576) -- 0:00:34
428000 -- (-881.419) [-879.960] (-881.045) (-881.913) * (-884.516) (-883.607) (-883.699) [-881.324] -- 0:00:34
428500 -- (-884.090) (-879.623) [-879.732] (-880.693) * (-881.377) [-880.802] (-884.995) (-884.848) -- 0:00:34
429000 -- (-884.158) (-883.071) (-880.652) [-881.557] * (-882.514) [-886.019] (-883.429) (-882.008) -- 0:00:34
429500 -- [-880.189] (-881.711) (-880.410) (-881.051) * (-883.090) (-882.255) [-880.787] (-883.080) -- 0:00:35
430000 -- (-883.789) (-881.315) [-880.246] (-880.797) * (-880.001) [-880.019] (-881.853) (-880.388) -- 0:00:35
Average standard deviation of split frequencies: 0.009272
430500 -- (-882.430) [-883.590] (-879.676) (-879.765) * (-879.786) [-880.028] (-886.046) (-880.336) -- 0:00:35
431000 -- (-883.508) [-882.030] (-880.292) (-879.881) * (-879.762) [-883.056] (-882.111) (-880.431) -- 0:00:35
431500 -- (-881.935) [-882.301] (-881.206) (-879.869) * (-884.963) (-886.843) [-879.299] (-880.211) -- 0:00:35
432000 -- [-881.980] (-882.060) (-880.689) (-880.352) * (-886.980) [-881.905] (-882.972) (-882.407) -- 0:00:35
432500 -- (-883.930) (-881.130) [-880.561] (-879.540) * [-881.573] (-884.492) (-883.070) (-882.440) -- 0:00:35
433000 -- (-883.411) (-880.290) [-884.015] (-881.145) * (-881.894) (-884.070) (-881.628) [-881.360] -- 0:00:35
433500 -- [-886.608] (-880.974) (-881.239) (-882.558) * (-882.007) [-881.146] (-879.721) (-880.597) -- 0:00:35
434000 -- [-885.516] (-881.784) (-882.711) (-882.633) * (-880.568) (-881.416) (-880.468) [-882.669] -- 0:00:35
434500 -- [-882.600] (-881.123) (-883.078) (-881.945) * (-880.914) [-880.592] (-883.345) (-882.533) -- 0:00:35
435000 -- (-880.840) (-882.066) (-883.069) [-879.431] * (-880.270) (-879.316) (-887.521) [-882.091] -- 0:00:35
Average standard deviation of split frequencies: 0.008852
435500 -- (-879.300) (-881.740) (-883.476) [-880.387] * [-880.123] (-879.316) (-882.252) (-886.595) -- 0:00:34
436000 -- (-879.602) [-881.795] (-883.288) (-880.102) * (-880.996) (-880.197) (-884.979) [-882.607] -- 0:00:34
436500 -- (-882.154) [-881.759] (-881.926) (-881.535) * [-881.339] (-879.926) (-881.078) (-882.787) -- 0:00:34
437000 -- (-881.887) (-881.898) [-880.781] (-879.831) * [-880.015] (-880.957) (-883.809) (-880.880) -- 0:00:34
437500 -- [-882.920] (-883.259) (-881.603) (-883.802) * (-880.555) (-882.457) (-883.497) [-881.282] -- 0:00:34
438000 -- (-880.081) (-882.344) (-880.327) [-884.987] * [-880.682] (-881.768) (-882.047) (-882.119) -- 0:00:34
438500 -- (-880.504) [-882.966] (-880.322) (-882.439) * (-880.409) [-880.855] (-882.358) (-885.287) -- 0:00:34
439000 -- [-882.324] (-880.835) (-881.884) (-881.672) * (-887.483) (-880.392) [-882.748] (-881.128) -- 0:00:34
439500 -- [-880.017] (-879.432) (-879.546) (-880.603) * (-883.334) (-880.391) (-880.025) [-881.380] -- 0:00:34
440000 -- (-880.400) [-880.800] (-882.231) (-880.128) * [-880.714] (-885.535) (-880.295) (-883.035) -- 0:00:34
Average standard deviation of split frequencies: 0.009561
440500 -- (-882.054) (-880.632) [-880.724] (-883.766) * (-881.522) [-885.858] (-882.107) (-883.793) -- 0:00:34
441000 -- [-880.817] (-881.008) (-884.892) (-881.229) * [-886.906] (-880.960) (-880.100) (-881.683) -- 0:00:34
441500 -- (-882.170) (-883.471) (-880.052) [-881.934] * (-884.593) (-880.216) (-882.161) [-882.294] -- 0:00:34
442000 -- [-880.977] (-881.546) (-884.154) (-882.527) * (-883.352) (-879.647) (-881.172) [-881.747] -- 0:00:34
442500 -- (-880.733) (-883.879) [-881.301] (-882.593) * (-883.479) (-879.978) [-880.968] (-879.355) -- 0:00:34
443000 -- (-879.759) [-881.955] (-882.268) (-884.012) * (-880.702) (-880.610) [-881.313] (-885.236) -- 0:00:33
443500 -- (-881.124) (-885.623) [-880.385] (-882.407) * (-881.284) (-880.889) [-880.098] (-880.534) -- 0:00:33
444000 -- (-880.396) (-884.195) [-881.519] (-883.310) * (-882.982) [-882.218] (-881.886) (-880.557) -- 0:00:33
444500 -- [-884.045] (-882.347) (-881.146) (-882.452) * (-879.945) (-880.355) [-880.266] (-882.743) -- 0:00:33
445000 -- (-880.864) (-885.226) [-882.717] (-882.767) * [-880.904] (-880.519) (-884.194) (-881.072) -- 0:00:33
Average standard deviation of split frequencies: 0.009388
445500 -- (-883.101) (-883.392) (-880.874) [-885.479] * (-880.072) (-881.115) [-881.085] (-880.816) -- 0:00:34
446000 -- [-880.442] (-881.599) (-889.172) (-880.561) * (-889.808) (-881.637) (-882.248) [-881.301] -- 0:00:34
446500 -- (-883.164) [-882.983] (-879.783) (-880.944) * (-883.015) (-879.839) (-880.771) [-882.198] -- 0:00:34
447000 -- [-879.342] (-884.361) (-879.928) (-881.534) * [-882.601] (-881.068) (-882.164) (-880.424) -- 0:00:34
447500 -- (-880.777) (-882.518) (-883.757) [-881.696] * (-880.391) [-881.158] (-880.871) (-881.383) -- 0:00:34
448000 -- (-879.265) [-879.593] (-881.282) (-883.946) * [-880.046] (-879.953) (-884.032) (-881.643) -- 0:00:34
448500 -- (-880.174) (-884.503) (-882.764) [-881.714] * (-880.798) (-883.035) [-883.219] (-883.388) -- 0:00:34
449000 -- (-883.393) (-888.600) [-879.457] (-881.561) * [-882.859] (-882.146) (-882.284) (-885.363) -- 0:00:34
449500 -- (-881.644) (-880.940) (-882.769) [-879.752] * (-881.190) (-880.488) [-882.830] (-880.143) -- 0:00:34
450000 -- [-882.825] (-880.072) (-882.621) (-880.948) * (-881.535) (-879.790) (-883.417) [-879.926] -- 0:00:34
Average standard deviation of split frequencies: 0.009968
450500 -- (-885.941) [-882.342] (-881.486) (-880.999) * (-883.070) (-880.549) [-880.893] (-880.691) -- 0:00:34
451000 -- (-885.103) (-880.062) (-881.323) [-880.699] * (-881.713) (-880.826) (-881.125) [-880.287] -- 0:00:34
451500 -- [-881.801] (-882.014) (-880.513) (-879.773) * (-882.354) (-880.120) (-883.671) [-881.485] -- 0:00:34
452000 -- (-880.620) [-881.383] (-880.181) (-881.794) * (-882.817) (-884.265) (-883.710) [-880.898] -- 0:00:33
452500 -- [-880.020] (-882.127) (-879.855) (-881.691) * [-880.196] (-881.008) (-884.222) (-880.596) -- 0:00:33
453000 -- (-880.279) [-880.163] (-882.158) (-881.007) * (-880.252) (-882.404) [-881.079] (-884.721) -- 0:00:33
453500 -- (-885.307) (-882.106) (-882.873) [-881.642] * [-882.562] (-881.127) (-884.636) (-886.677) -- 0:00:33
454000 -- (-882.452) (-881.839) [-879.597] (-882.590) * (-883.240) (-882.702) [-881.715] (-884.898) -- 0:00:33
454500 -- [-883.268] (-882.960) (-879.592) (-882.535) * (-881.801) (-886.117) (-883.708) [-885.039] -- 0:00:33
455000 -- [-882.953] (-879.856) (-879.948) (-883.144) * (-880.601) (-881.259) [-881.087] (-883.236) -- 0:00:33
Average standard deviation of split frequencies: 0.010155
455500 -- [-881.061] (-879.521) (-883.916) (-886.084) * (-887.221) (-881.356) (-881.556) [-885.170] -- 0:00:33
456000 -- (-881.140) (-884.106) [-880.336] (-882.732) * [-882.508] (-882.082) (-881.082) (-883.323) -- 0:00:33
456500 -- [-880.854] (-892.358) (-879.703) (-883.357) * (-885.507) (-880.016) (-880.373) [-880.877] -- 0:00:33
457000 -- (-882.917) (-883.786) [-882.873] (-883.254) * (-884.923) [-880.168] (-884.001) (-881.538) -- 0:00:33
457500 -- (-880.258) (-886.710) (-883.671) [-885.746] * (-881.889) (-879.745) (-883.707) [-884.216] -- 0:00:33
458000 -- [-880.005] (-884.191) (-884.189) (-882.507) * [-879.910] (-880.375) (-883.042) (-886.186) -- 0:00:33
458500 -- (-881.019) (-881.405) (-887.780) [-883.978] * [-879.705] (-883.320) (-880.861) (-881.749) -- 0:00:33
459000 -- [-880.170] (-879.725) (-881.455) (-882.380) * [-880.351] (-881.333) (-881.962) (-882.810) -- 0:00:33
459500 -- (-883.202) (-880.040) (-888.639) [-880.355] * (-880.609) [-880.764] (-880.918) (-882.839) -- 0:00:32
460000 -- (-882.573) [-879.551] (-886.187) (-881.073) * [-880.674] (-880.672) (-881.416) (-881.907) -- 0:00:32
Average standard deviation of split frequencies: 0.009932
460500 -- (-882.844) [-881.076] (-882.880) (-883.675) * (-881.106) (-880.594) (-881.021) [-880.418] -- 0:00:32
461000 -- [-881.605] (-879.547) (-880.844) (-881.005) * (-879.976) [-879.442] (-884.249) (-883.888) -- 0:00:32
461500 -- (-880.498) (-881.668) (-883.585) [-882.156] * (-882.920) [-880.335] (-880.935) (-881.167) -- 0:00:32
462000 -- (-881.189) (-883.725) [-881.701] (-883.402) * (-881.746) [-880.604] (-880.671) (-881.348) -- 0:00:32
462500 -- [-883.267] (-882.921) (-881.911) (-880.454) * (-882.594) (-883.039) (-881.687) [-882.533] -- 0:00:33
463000 -- (-885.290) (-881.492) (-879.339) [-881.769] * (-885.728) (-882.352) [-880.328] (-882.995) -- 0:00:33
463500 -- (-884.227) [-881.027] (-879.335) (-885.558) * [-880.733] (-882.076) (-883.064) (-882.648) -- 0:00:33
464000 -- [-884.634] (-880.984) (-879.499) (-879.907) * (-881.880) [-881.722] (-887.058) (-884.200) -- 0:00:33
464500 -- (-884.327) (-882.902) [-881.571] (-880.040) * (-881.300) (-880.259) (-884.666) [-881.969] -- 0:00:33
465000 -- [-880.280] (-879.760) (-884.871) (-881.127) * (-879.912) (-882.277) [-880.583] (-882.409) -- 0:00:33
Average standard deviation of split frequencies: 0.009283
465500 -- [-879.831] (-881.715) (-887.056) (-882.307) * (-881.025) [-880.029] (-880.330) (-882.307) -- 0:00:33
466000 -- [-881.456] (-882.604) (-888.108) (-890.046) * [-880.811] (-879.699) (-883.503) (-881.716) -- 0:00:33
466500 -- (-882.057) [-883.869] (-879.906) (-883.309) * (-880.842) [-880.481] (-881.567) (-880.734) -- 0:00:33
467000 -- (-881.445) (-880.281) [-881.065] (-881.531) * [-879.706] (-879.444) (-882.096) (-880.389) -- 0:00:33
467500 -- (-883.212) [-880.218] (-882.671) (-887.046) * [-879.641] (-885.634) (-885.919) (-884.778) -- 0:00:33
468000 -- (-880.983) (-881.570) [-882.095] (-882.128) * [-880.581] (-884.065) (-882.823) (-880.452) -- 0:00:32
468500 -- (-886.672) (-882.530) (-883.386) [-881.439] * (-881.933) (-885.557) (-882.031) [-882.871] -- 0:00:32
469000 -- [-882.309] (-881.164) (-884.341) (-879.344) * (-882.665) (-884.907) [-882.063] (-882.790) -- 0:00:32
469500 -- (-881.840) (-880.484) (-882.421) [-881.046] * (-883.752) (-880.519) [-881.059] (-884.071) -- 0:00:32
470000 -- (-880.274) (-880.084) [-881.486] (-882.395) * (-886.044) (-881.444) [-881.413] (-880.198) -- 0:00:32
Average standard deviation of split frequencies: 0.009132
470500 -- (-885.489) [-880.872] (-884.705) (-881.588) * (-885.084) (-881.857) [-880.599] (-879.564) -- 0:00:32
471000 -- (-880.969) [-881.321] (-883.344) (-880.129) * (-880.856) (-879.694) [-884.949] (-880.300) -- 0:00:32
471500 -- (-885.382) (-883.123) [-888.913] (-884.653) * (-881.359) (-880.411) [-881.944] (-881.440) -- 0:00:32
472000 -- (-881.930) (-889.659) [-883.612] (-884.739) * [-881.431] (-882.285) (-881.830) (-880.698) -- 0:00:32
472500 -- [-881.748] (-880.891) (-882.318) (-881.266) * [-880.902] (-883.749) (-880.877) (-880.160) -- 0:00:32
473000 -- [-881.565] (-881.180) (-884.209) (-883.624) * [-885.821] (-883.547) (-881.045) (-881.442) -- 0:00:32
473500 -- (-882.848) (-882.766) (-880.682) [-881.526] * (-881.648) (-885.068) (-883.406) [-880.825] -- 0:00:32
474000 -- [-880.566] (-883.177) (-880.102) (-880.759) * (-883.005) (-879.979) [-881.191] (-881.842) -- 0:00:32
474500 -- (-880.772) (-883.219) (-880.910) [-882.350] * (-883.227) (-880.692) [-880.514] (-880.128) -- 0:00:32
475000 -- [-880.463] (-881.615) (-883.842) (-883.108) * (-882.254) (-880.539) [-881.651] (-882.938) -- 0:00:32
Average standard deviation of split frequencies: 0.008331
475500 -- [-881.800] (-880.518) (-884.398) (-884.094) * [-881.018] (-880.400) (-885.376) (-882.890) -- 0:00:31
476000 -- (-881.253) [-880.347] (-883.802) (-882.693) * [-880.858] (-879.711) (-884.490) (-882.505) -- 0:00:31
476500 -- (-880.418) (-882.580) [-880.207] (-881.025) * (-886.394) (-886.791) [-881.570] (-882.671) -- 0:00:31
477000 -- (-880.099) (-881.313) (-882.042) [-880.122] * [-880.671] (-887.130) (-880.199) (-880.120) -- 0:00:31
477500 -- (-880.893) (-890.503) (-881.780) [-886.153] * (-880.402) (-887.167) [-885.456] (-883.812) -- 0:00:31
478000 -- [-881.094] (-883.212) (-881.974) (-882.065) * (-883.418) (-880.694) [-881.517] (-880.074) -- 0:00:31
478500 -- (-881.650) [-881.350] (-879.415) (-884.095) * (-879.984) (-882.199) [-881.622] (-881.191) -- 0:00:31
479000 -- (-881.235) (-881.007) [-881.476] (-882.426) * [-880.534] (-881.939) (-880.447) (-881.935) -- 0:00:32
479500 -- (-879.388) [-881.049] (-881.200) (-881.529) * (-880.354) [-880.920] (-881.315) (-882.418) -- 0:00:32
480000 -- [-881.301] (-880.915) (-879.567) (-884.437) * (-880.984) (-880.534) [-881.960] (-880.018) -- 0:00:32
Average standard deviation of split frequencies: 0.008365
480500 -- (-882.445) [-880.915] (-880.680) (-880.837) * [-881.185] (-880.257) (-880.420) (-882.622) -- 0:00:32
481000 -- (-881.755) (-881.991) (-880.793) [-883.168] * [-880.026] (-880.266) (-881.886) (-879.939) -- 0:00:32
481500 -- (-881.345) (-881.786) (-881.806) [-880.858] * [-881.489] (-882.184) (-881.028) (-882.271) -- 0:00:32
482000 -- (-885.132) (-881.873) [-881.584] (-881.579) * (-881.457) (-880.369) [-886.471] (-884.812) -- 0:00:32
482500 -- (-885.803) [-884.361] (-881.963) (-881.959) * [-881.167] (-882.372) (-883.777) (-885.779) -- 0:00:32
483000 -- (-879.205) (-881.322) (-882.700) [-880.119] * [-879.816] (-881.928) (-883.706) (-882.909) -- 0:00:32
483500 -- (-883.532) (-881.340) [-879.960] (-880.948) * (-880.164) (-882.269) (-880.978) [-882.371] -- 0:00:32
484000 -- (-880.409) (-880.274) [-885.972] (-880.607) * (-881.417) (-880.350) (-884.542) [-881.201] -- 0:00:31
484500 -- (-881.860) [-880.105] (-882.558) (-880.431) * (-879.698) (-883.916) (-882.573) [-885.723] -- 0:00:31
485000 -- (-880.342) (-883.686) [-883.468] (-880.115) * [-879.575] (-880.362) (-881.152) (-880.100) -- 0:00:31
Average standard deviation of split frequencies: 0.008958
485500 -- (-880.317) (-885.767) (-880.616) [-882.420] * (-880.621) (-890.396) (-880.527) [-880.502] -- 0:00:31
486000 -- (-884.818) (-881.614) [-881.311] (-882.274) * [-882.027] (-892.378) (-884.167) (-881.014) -- 0:00:31
486500 -- [-882.171] (-882.033) (-880.739) (-881.078) * [-880.467] (-885.770) (-879.941) (-879.594) -- 0:00:31
487000 -- (-880.445) [-881.850] (-883.619) (-879.313) * (-881.299) (-884.157) [-881.552] (-882.392) -- 0:00:31
487500 -- (-882.872) [-884.116] (-881.497) (-881.550) * (-882.637) (-882.512) (-885.129) [-882.592] -- 0:00:31
488000 -- (-882.229) [-881.723] (-881.687) (-880.423) * (-883.015) (-879.585) [-880.451] (-881.220) -- 0:00:31
488500 -- (-883.714) [-881.391] (-881.940) (-882.190) * (-883.855) [-880.645] (-880.384) (-882.113) -- 0:00:31
489000 -- [-881.509] (-881.285) (-881.482) (-883.505) * (-882.096) (-881.408) [-883.059] (-880.778) -- 0:00:31
489500 -- (-883.767) [-881.075] (-882.607) (-880.303) * (-880.137) (-881.305) [-881.410] (-881.654) -- 0:00:31
490000 -- (-879.769) (-881.157) (-880.447) [-880.504] * (-880.487) (-881.800) [-881.296] (-881.796) -- 0:00:31
Average standard deviation of split frequencies: 0.009438
490500 -- (-880.977) [-883.627] (-882.100) (-880.998) * (-881.892) (-886.605) (-883.988) [-884.103] -- 0:00:31
491000 -- [-882.035] (-880.996) (-881.511) (-882.533) * (-882.973) (-885.291) [-881.174] (-882.524) -- 0:00:31
491500 -- (-882.411) (-883.040) (-883.128) [-885.163] * (-883.289) (-880.414) [-883.612] (-882.602) -- 0:00:31
492000 -- (-881.859) (-883.320) (-880.582) [-880.414] * (-883.900) (-880.831) (-882.217) [-880.723] -- 0:00:30
492500 -- (-880.273) [-880.358] (-885.556) (-881.519) * (-884.496) (-882.398) [-881.124] (-880.817) -- 0:00:30
493000 -- [-880.690] (-881.257) (-882.462) (-880.030) * [-882.390] (-883.162) (-884.630) (-881.156) -- 0:00:30
493500 -- (-882.190) (-883.414) (-880.506) [-880.935] * (-882.082) (-879.854) (-881.488) [-881.571] -- 0:00:30
494000 -- (-882.074) (-882.127) [-883.360] (-880.817) * (-882.707) [-882.388] (-881.956) (-880.975) -- 0:00:30
494500 -- (-879.864) [-880.981] (-883.262) (-882.063) * (-881.712) (-880.376) [-880.680] (-882.889) -- 0:00:30
495000 -- (-881.492) (-884.473) (-881.030) [-880.604] * (-879.744) (-883.213) (-880.739) [-882.473] -- 0:00:30
Average standard deviation of split frequencies: 0.009672
495500 -- (-882.411) [-881.478] (-880.311) (-883.204) * [-879.831] (-883.943) (-881.040) (-881.891) -- 0:00:31
496000 -- (-883.536) (-881.772) (-879.506) [-882.220] * (-879.959) [-883.290] (-885.365) (-882.400) -- 0:00:31
496500 -- (-882.751) [-883.176] (-879.526) (-881.884) * [-879.932] (-880.287) (-882.131) (-880.792) -- 0:00:31
497000 -- (-880.960) (-882.974) (-881.195) [-879.668] * (-880.492) [-879.877] (-880.145) (-881.363) -- 0:00:31
497500 -- (-880.591) (-881.619) (-880.519) [-881.390] * (-881.857) [-879.744] (-880.883) (-882.569) -- 0:00:31
498000 -- (-884.204) (-881.328) [-880.523] (-882.666) * (-882.789) (-879.398) [-882.230] (-880.292) -- 0:00:31
498500 -- [-882.764] (-880.413) (-879.998) (-882.140) * [-880.837] (-880.598) (-881.553) (-880.730) -- 0:00:31
499000 -- (-881.599) [-881.138] (-880.032) (-881.217) * (-879.307) (-880.924) (-883.831) [-880.124] -- 0:00:31
499500 -- [-881.313] (-883.348) (-880.632) (-880.323) * (-882.400) (-880.422) (-880.581) [-882.656] -- 0:00:31
500000 -- (-880.326) [-882.032] (-882.630) (-881.763) * (-879.526) (-880.487) [-884.147] (-884.299) -- 0:00:31
Average standard deviation of split frequencies: 0.010412
500500 -- [-882.163] (-883.794) (-880.069) (-882.675) * [-882.798] (-880.600) (-883.316) (-882.048) -- 0:00:30
501000 -- (-882.163) (-882.396) (-884.835) [-885.381] * [-880.451] (-883.957) (-886.668) (-880.199) -- 0:00:30
501500 -- (-883.622) (-879.512) [-879.670] (-882.027) * (-883.947) (-881.333) (-882.048) [-879.759] -- 0:00:30
502000 -- (-881.809) [-879.469] (-880.809) (-881.863) * [-884.016] (-881.446) (-881.845) (-879.748) -- 0:00:30
502500 -- (-881.242) [-881.213] (-884.409) (-880.165) * (-880.703) (-880.928) (-881.710) [-880.952] -- 0:00:30
503000 -- [-883.071] (-882.795) (-882.704) (-880.041) * (-884.623) (-880.380) [-882.751] (-881.767) -- 0:00:30
503500 -- (-885.278) (-882.841) [-880.897] (-879.665) * (-880.228) (-883.963) [-879.797] (-881.170) -- 0:00:30
504000 -- (-880.493) (-881.284) [-882.301] (-882.468) * (-882.179) [-880.532] (-880.520) (-881.249) -- 0:00:30
504500 -- (-880.968) [-880.332] (-882.344) (-882.182) * (-884.138) (-879.581) [-880.533] (-881.440) -- 0:00:30
505000 -- (-881.408) [-880.987] (-881.394) (-882.608) * (-880.200) [-879.571] (-880.554) (-886.480) -- 0:00:30
Average standard deviation of split frequencies: 0.010029
505500 -- (-884.143) [-880.860] (-880.562) (-883.008) * (-881.187) [-879.736] (-880.332) (-886.459) -- 0:00:30
506000 -- (-883.254) (-879.553) [-881.200] (-881.036) * [-886.122] (-882.494) (-881.112) (-883.438) -- 0:00:30
506500 -- [-881.973] (-881.138) (-880.312) (-883.494) * (-885.740) [-881.541] (-886.015) (-882.530) -- 0:00:30
507000 -- (-882.887) [-880.307] (-881.334) (-880.355) * [-882.715] (-881.103) (-884.137) (-882.413) -- 0:00:30
507500 -- (-884.675) (-882.222) [-880.994] (-881.989) * (-882.025) (-882.119) (-880.933) [-884.202] -- 0:00:30
508000 -- (-884.013) [-882.658] (-881.878) (-881.836) * (-881.784) (-881.369) [-880.253] (-879.923) -- 0:00:30
508500 -- (-887.198) (-882.038) (-881.962) [-880.810] * (-884.188) (-880.580) [-882.179] (-880.475) -- 0:00:29
509000 -- (-888.570) [-880.284] (-881.475) (-880.327) * (-879.831) [-882.156] (-880.711) (-884.094) -- 0:00:29
509500 -- (-883.741) (-880.005) [-882.620] (-880.282) * (-879.978) (-880.024) [-883.269] (-883.045) -- 0:00:29
510000 -- [-879.691] (-881.492) (-884.820) (-880.739) * (-880.679) (-879.960) (-882.250) [-882.785] -- 0:00:29
Average standard deviation of split frequencies: 0.009828
510500 -- (-879.819) (-880.963) [-882.509] (-880.341) * [-881.815] (-881.639) (-880.129) (-882.643) -- 0:00:29
511000 -- (-881.502) (-880.209) [-881.331] (-883.143) * (-882.731) [-882.042] (-887.838) (-879.409) -- 0:00:29
511500 -- (-882.541) [-883.290] (-884.883) (-883.980) * [-879.794] (-881.983) (-884.740) (-885.761) -- 0:00:30
512000 -- [-883.186] (-885.019) (-882.217) (-884.605) * (-880.806) (-881.229) [-880.027] (-883.057) -- 0:00:30
512500 -- (-881.162) (-880.148) (-882.230) [-884.944] * (-882.494) (-882.662) [-882.091] (-881.095) -- 0:00:30
513000 -- [-881.385] (-882.731) (-880.880) (-880.690) * (-881.477) (-884.401) (-881.464) [-880.993] -- 0:00:30
513500 -- (-884.148) [-881.650] (-880.383) (-879.897) * (-881.733) (-884.466) (-879.440) [-882.233] -- 0:00:30
514000 -- (-880.964) (-880.220) (-881.868) [-880.634] * (-881.332) (-886.330) (-880.040) [-882.480] -- 0:00:30
514500 -- [-881.850] (-882.780) (-879.899) (-882.204) * [-879.976] (-884.832) (-880.832) (-882.253) -- 0:00:30
515000 -- (-881.686) [-880.875] (-881.136) (-880.280) * [-879.955] (-889.820) (-880.813) (-882.990) -- 0:00:30
Average standard deviation of split frequencies: 0.009727
515500 -- (-879.777) (-882.310) [-883.371] (-880.300) * (-883.355) (-883.537) (-881.725) [-881.267] -- 0:00:30
516000 -- (-880.304) [-882.314] (-882.229) (-882.230) * (-880.324) (-882.841) (-879.815) [-883.763] -- 0:00:30
516500 -- [-880.478] (-879.758) (-885.327) (-882.842) * (-882.057) (-880.547) (-882.364) [-883.017] -- 0:00:29
517000 -- (-880.479) (-886.674) [-881.388] (-882.305) * [-881.245] (-883.170) (-884.604) (-883.219) -- 0:00:29
517500 -- (-881.010) (-885.898) [-880.092] (-883.581) * (-887.153) (-883.023) [-885.177] (-884.525) -- 0:00:29
518000 -- (-882.716) (-880.624) [-880.444] (-883.596) * (-890.340) (-882.510) [-881.131] (-883.078) -- 0:00:29
518500 -- (-884.419) (-883.799) (-880.570) [-880.665] * (-884.188) (-879.713) (-880.812) [-881.980] -- 0:00:29
519000 -- (-880.740) (-880.357) (-881.040) [-882.347] * (-881.611) [-879.552] (-880.579) (-880.210) -- 0:00:29
519500 -- (-881.503) (-879.999) (-883.440) [-881.459] * [-879.409] (-881.610) (-881.287) (-879.536) -- 0:00:29
520000 -- (-880.371) [-882.599] (-880.272) (-880.225) * (-880.074) (-882.124) [-882.370] (-879.610) -- 0:00:29
Average standard deviation of split frequencies: 0.010066
520500 -- (-881.514) (-882.462) (-879.440) [-880.856] * (-881.734) (-880.698) (-881.006) [-880.140] -- 0:00:29
521000 -- (-884.233) (-879.693) [-879.655] (-880.903) * (-881.073) [-880.394] (-882.165) (-885.090) -- 0:00:29
521500 -- (-883.653) (-880.961) [-883.491] (-884.887) * [-881.728] (-884.810) (-882.006) (-886.069) -- 0:00:29
522000 -- (-882.673) (-880.083) (-883.029) [-881.509] * [-882.592] (-882.005) (-887.758) (-883.464) -- 0:00:29
522500 -- [-880.600] (-882.199) (-881.622) (-885.517) * (-880.732) [-880.644] (-883.836) (-883.760) -- 0:00:29
523000 -- (-880.174) (-883.761) (-880.334) [-881.172] * [-880.621] (-880.952) (-884.614) (-880.408) -- 0:00:29
523500 -- (-880.833) [-881.001] (-880.376) (-884.827) * (-881.109) (-882.272) [-888.319] (-886.330) -- 0:00:29
524000 -- [-882.248] (-881.198) (-880.697) (-880.216) * (-881.829) (-880.795) (-882.762) [-881.762] -- 0:00:29
524500 -- [-880.245] (-881.825) (-881.526) (-880.976) * [-880.680] (-883.789) (-880.018) (-880.463) -- 0:00:29
525000 -- [-879.941] (-880.694) (-879.946) (-881.561) * (-882.758) [-883.085] (-881.727) (-880.023) -- 0:00:28
Average standard deviation of split frequencies: 0.009595
525500 -- (-880.507) (-882.056) (-879.524) [-881.355] * (-880.376) (-881.263) (-884.962) [-879.599] -- 0:00:28
526000 -- (-880.190) [-881.819] (-882.526) (-883.489) * [-880.258] (-883.685) (-880.973) (-880.655) -- 0:00:28
526500 -- (-882.831) (-883.643) [-880.063] (-881.619) * [-879.609] (-879.658) (-882.966) (-880.159) -- 0:00:28
527000 -- (-886.296) (-883.660) (-880.478) [-881.481] * (-879.820) (-881.822) (-883.273) [-882.862] -- 0:00:28
527500 -- (-881.046) [-885.247] (-881.389) (-881.578) * (-880.955) (-881.822) (-880.460) [-880.355] -- 0:00:28
528000 -- [-880.928] (-880.351) (-883.500) (-882.565) * [-880.346] (-880.778) (-879.994) (-882.639) -- 0:00:29
528500 -- [-879.386] (-883.175) (-885.763) (-881.889) * [-880.045] (-879.982) (-880.873) (-879.834) -- 0:00:29
529000 -- (-879.388) (-882.249) [-882.189] (-884.198) * (-881.307) (-880.577) (-880.285) [-880.128] -- 0:00:29
529500 -- (-882.890) (-884.704) [-881.997] (-882.703) * [-881.539] (-881.100) (-882.006) (-882.070) -- 0:00:29
530000 -- (-883.461) (-884.053) (-882.171) [-882.554] * (-880.672) (-880.230) (-881.931) [-884.673] -- 0:00:29
Average standard deviation of split frequencies: 0.010085
530500 -- (-884.043) (-883.024) [-880.338] (-881.653) * [-881.890] (-880.129) (-882.562) (-885.024) -- 0:00:29
531000 -- (-880.355) (-883.858) (-880.415) [-882.277] * (-881.925) [-881.761] (-881.092) (-881.342) -- 0:00:29
531500 -- (-880.260) (-881.325) [-881.192] (-883.275) * (-882.451) (-882.783) (-882.987) [-880.673] -- 0:00:29
532000 -- (-879.964) (-882.598) (-881.752) [-880.789] * (-880.417) [-880.445] (-879.887) (-881.426) -- 0:00:29
532500 -- (-882.950) (-884.158) (-883.720) [-880.131] * (-882.276) (-880.977) (-882.721) [-880.489] -- 0:00:28
533000 -- (-882.714) (-880.200) [-883.734] (-880.555) * (-879.893) [-880.883] (-881.972) (-879.973) -- 0:00:28
533500 -- (-884.606) (-882.424) [-884.584] (-880.750) * (-883.554) (-881.077) (-880.975) [-885.283] -- 0:00:28
534000 -- (-881.432) [-881.157] (-884.517) (-881.040) * [-881.768] (-884.318) (-881.230) (-880.754) -- 0:00:28
534500 -- (-886.024) (-881.373) (-880.740) [-881.813] * (-880.536) (-886.606) [-880.714] (-880.618) -- 0:00:28
535000 -- [-883.594] (-884.395) (-880.573) (-880.108) * [-881.633] (-884.276) (-885.264) (-879.864) -- 0:00:28
Average standard deviation of split frequencies: 0.010945
535500 -- (-883.852) (-884.177) (-880.320) [-882.462] * (-883.803) [-882.256] (-882.489) (-886.146) -- 0:00:28
536000 -- (-880.217) (-884.816) (-880.594) [-884.386] * (-880.404) (-880.798) (-882.326) [-882.284] -- 0:00:28
536500 -- (-882.910) (-881.972) (-882.064) [-881.704] * (-880.619) (-883.011) [-879.300] (-880.177) -- 0:00:28
537000 -- (-882.048) [-880.747] (-880.626) (-882.312) * (-883.945) [-882.489] (-884.629) (-881.210) -- 0:00:28
537500 -- (-882.138) (-882.308) [-883.274] (-883.489) * (-888.427) [-880.495] (-890.355) (-886.698) -- 0:00:28
538000 -- (-885.950) [-882.090] (-880.223) (-881.195) * (-883.457) [-879.598] (-880.435) (-881.499) -- 0:00:28
538500 -- (-884.718) (-882.042) [-879.477] (-881.511) * (-888.397) [-880.042] (-882.655) (-881.625) -- 0:00:28
539000 -- (-880.899) [-881.110] (-879.484) (-881.008) * (-883.570) [-880.959] (-880.700) (-881.304) -- 0:00:28
539500 -- (-882.010) (-882.590) [-880.761] (-881.456) * (-885.152) (-881.081) (-881.915) [-880.963] -- 0:00:28
540000 -- (-880.656) (-880.838) [-881.016] (-880.557) * (-880.955) (-882.126) (-882.402) [-883.640] -- 0:00:28
Average standard deviation of split frequencies: 0.010850
540500 -- (-883.264) (-882.273) [-880.539] (-880.243) * (-883.110) [-880.504] (-882.552) (-882.565) -- 0:00:28
541000 -- [-883.350] (-880.557) (-880.224) (-883.166) * (-879.971) [-882.573] (-880.583) (-884.225) -- 0:00:27
541500 -- (-885.138) [-882.115] (-882.358) (-883.232) * (-879.661) (-881.199) (-881.104) [-882.173] -- 0:00:27
542000 -- (-881.047) (-881.051) (-883.372) [-882.212] * [-881.269] (-880.930) (-884.290) (-879.424) -- 0:00:27
542500 -- (-882.532) (-880.418) [-880.433] (-880.565) * [-880.291] (-883.726) (-883.501) (-882.007) -- 0:00:27
543000 -- (-882.762) [-883.298] (-889.219) (-880.401) * (-884.298) [-883.377] (-882.374) (-880.068) -- 0:00:27
543500 -- (-882.221) (-880.932) [-879.220] (-880.341) * (-880.291) [-880.457] (-882.415) (-881.052) -- 0:00:27
544000 -- (-881.696) (-882.223) [-880.824] (-881.362) * [-881.387] (-882.939) (-881.128) (-881.382) -- 0:00:27
544500 -- (-883.080) [-882.046] (-880.468) (-883.003) * [-881.352] (-882.771) (-881.751) (-883.466) -- 0:00:28
545000 -- (-881.710) (-883.369) [-879.835] (-885.672) * (-880.281) [-880.447] (-885.410) (-881.437) -- 0:00:28
Average standard deviation of split frequencies: 0.010696
545500 -- (-882.969) [-881.699] (-879.609) (-881.733) * [-881.304] (-882.222) (-881.802) (-884.086) -- 0:00:28
546000 -- (-880.428) (-880.532) [-883.853] (-882.781) * [-881.967] (-884.351) (-880.416) (-887.163) -- 0:00:28
546500 -- (-881.734) (-879.697) (-883.489) [-880.697] * (-880.381) [-884.406] (-879.301) (-881.427) -- 0:00:28
547000 -- (-884.660) (-880.784) (-883.782) [-884.084] * (-880.019) (-880.058) (-879.387) [-884.757] -- 0:00:28
547500 -- (-883.040) (-883.422) [-883.475] (-881.803) * (-883.228) (-881.262) (-881.461) [-884.127] -- 0:00:28
548000 -- (-883.293) (-882.886) [-880.661] (-882.835) * (-881.435) [-882.345] (-881.438) (-880.251) -- 0:00:28
548500 -- [-882.908] (-882.358) (-882.942) (-879.712) * (-881.134) [-883.485] (-881.407) (-881.160) -- 0:00:27
549000 -- (-880.895) (-882.112) [-883.985] (-881.083) * [-881.796] (-880.390) (-882.472) (-879.524) -- 0:00:27
549500 -- [-879.980] (-886.483) (-882.943) (-881.037) * (-880.982) (-880.387) (-882.415) [-879.658] -- 0:00:27
550000 -- (-882.229) (-884.082) [-881.513] (-880.733) * (-882.780) [-881.426] (-881.835) (-885.086) -- 0:00:27
Average standard deviation of split frequencies: 0.010843
550500 -- (-880.716) (-887.569) (-881.993) [-882.006] * [-881.956] (-885.338) (-882.116) (-881.976) -- 0:00:27
551000 -- [-881.832] (-879.970) (-880.381) (-882.874) * (-881.916) (-885.838) [-880.683] (-882.482) -- 0:00:27
551500 -- (-881.205) (-888.009) (-880.657) [-883.319] * (-881.093) (-882.995) (-880.004) [-882.434] -- 0:00:27
552000 -- (-884.148) (-884.537) [-882.269] (-883.381) * (-880.146) (-882.089) [-879.561] (-880.564) -- 0:00:27
552500 -- (-881.925) (-883.803) [-882.668] (-882.037) * [-882.997] (-885.327) (-879.930) (-881.785) -- 0:00:27
553000 -- (-881.791) (-882.462) (-882.055) [-879.540] * [-880.882] (-882.331) (-880.331) (-883.436) -- 0:00:27
553500 -- (-885.558) (-883.276) (-881.933) [-881.281] * [-880.645] (-881.405) (-879.790) (-882.521) -- 0:00:27
554000 -- [-884.527] (-882.143) (-881.716) (-881.913) * (-880.882) (-881.382) [-879.553] (-882.615) -- 0:00:27
554500 -- (-880.390) (-883.174) (-881.176) [-880.778] * (-880.696) (-883.728) [-880.714] (-882.519) -- 0:00:27
555000 -- [-879.438] (-881.133) (-885.254) (-880.294) * [-879.913] (-880.590) (-883.968) (-881.398) -- 0:00:27
Average standard deviation of split frequencies: 0.011210
555500 -- [-882.295] (-881.375) (-880.444) (-881.033) * (-879.890) (-882.376) [-882.123] (-880.801) -- 0:00:27
556000 -- (-881.572) (-888.582) (-882.215) [-880.256] * (-881.203) (-881.752) (-881.412) [-879.608] -- 0:00:27
556500 -- (-881.159) (-882.262) [-879.904] (-882.641) * (-881.654) (-880.707) (-885.011) [-882.811] -- 0:00:27
557000 -- [-882.402] (-883.624) (-883.994) (-881.288) * [-882.544] (-880.896) (-881.382) (-882.503) -- 0:00:27
557500 -- (-881.690) [-880.500] (-880.546) (-881.283) * (-883.585) (-880.599) [-879.828] (-882.557) -- 0:00:26
558000 -- [-880.732] (-892.230) (-880.276) (-880.114) * [-883.658] (-881.905) (-880.090) (-885.073) -- 0:00:26
558500 -- (-880.878) (-881.464) [-880.574] (-883.730) * (-882.558) [-879.830] (-880.464) (-880.713) -- 0:00:26
559000 -- [-881.403] (-882.715) (-882.123) (-885.361) * [-880.930] (-880.837) (-880.191) (-880.483) -- 0:00:26
559500 -- (-881.810) (-880.967) (-883.008) [-880.771] * (-883.150) (-883.645) (-882.502) [-884.279] -- 0:00:26
560000 -- (-881.860) [-882.126] (-881.849) (-880.116) * (-881.640) (-883.570) [-879.552] (-880.037) -- 0:00:26
Average standard deviation of split frequencies: 0.010884
560500 -- (-882.574) [-881.465] (-880.385) (-881.751) * (-880.805) (-883.747) [-880.485] (-880.201) -- 0:00:26
561000 -- (-882.608) (-880.570) (-882.022) [-881.215] * (-882.047) (-880.808) (-881.377) [-880.672] -- 0:00:27
561500 -- (-880.972) [-879.980] (-881.609) (-882.006) * [-880.590] (-881.490) (-888.079) (-881.168) -- 0:00:27
562000 -- (-881.755) (-880.535) (-880.876) [-882.162] * (-884.781) [-880.962] (-882.092) (-883.821) -- 0:00:27
562500 -- (-881.996) [-882.207] (-881.428) (-884.605) * (-882.123) (-886.044) [-881.644] (-880.557) -- 0:00:27
563000 -- (-881.791) [-881.389] (-881.347) (-881.374) * (-879.216) [-880.428] (-880.007) (-883.586) -- 0:00:27
563500 -- (-881.064) (-880.578) (-880.878) [-879.895] * (-881.156) [-880.680] (-883.227) (-883.135) -- 0:00:27
564000 -- (-881.837) (-881.389) (-880.847) [-880.866] * (-880.815) [-880.503] (-882.883) (-882.055) -- 0:00:27
564500 -- (-882.537) (-880.589) (-879.766) [-881.220] * [-880.675] (-879.887) (-881.249) (-881.224) -- 0:00:27
565000 -- (-884.651) [-879.946] (-880.994) (-884.374) * [-880.453] (-882.161) (-882.782) (-882.434) -- 0:00:26
Average standard deviation of split frequencies: 0.010735
565500 -- (-882.049) (-879.888) [-880.055] (-883.137) * [-880.066] (-883.064) (-881.574) (-884.315) -- 0:00:26
566000 -- (-886.261) (-880.662) [-880.098] (-879.600) * (-880.345) (-881.062) [-881.002] (-882.602) -- 0:00:26
566500 -- (-881.826) [-884.598] (-879.952) (-880.292) * (-880.267) (-884.548) [-879.957] (-881.183) -- 0:00:26
567000 -- (-882.007) (-883.287) (-883.122) [-880.302] * [-881.312] (-880.776) (-879.961) (-883.134) -- 0:00:26
567500 -- (-881.386) (-880.438) (-883.142) [-881.623] * (-882.271) [-884.973] (-881.667) (-879.781) -- 0:00:26
568000 -- (-883.979) [-880.035] (-880.926) (-881.338) * (-883.640) (-881.356) (-879.978) [-882.569] -- 0:00:26
568500 -- (-880.020) [-879.326] (-883.538) (-881.734) * (-883.466) (-882.561) [-881.159] (-881.573) -- 0:00:26
569000 -- [-879.979] (-879.331) (-880.217) (-888.256) * (-881.923) [-882.553] (-883.777) (-880.100) -- 0:00:26
569500 -- [-880.891] (-880.039) (-882.292) (-884.190) * (-880.906) (-880.757) (-886.791) [-884.336] -- 0:00:26
570000 -- (-880.864) (-879.458) [-881.330] (-883.696) * (-879.500) (-882.458) [-882.225] (-883.669) -- 0:00:26
Average standard deviation of split frequencies: 0.010693
570500 -- (-881.925) [-880.926] (-881.198) (-882.469) * [-880.489] (-883.247) (-882.656) (-888.517) -- 0:00:26
571000 -- (-881.008) [-879.557] (-883.713) (-886.015) * (-880.310) (-882.118) [-882.125] (-882.716) -- 0:00:26
571500 -- (-880.876) (-879.683) (-881.239) [-883.767] * (-881.275) (-880.150) [-881.770] (-882.475) -- 0:00:26
572000 -- [-882.062] (-884.102) (-880.797) (-881.301) * (-883.983) (-881.534) [-883.223] (-880.454) -- 0:00:26
572500 -- (-883.992) (-881.241) (-879.715) [-883.738] * (-882.033) (-880.438) (-881.207) [-879.830] -- 0:00:26
573000 -- (-881.797) (-882.121) [-882.091] (-881.931) * (-882.365) (-880.922) (-883.678) [-881.001] -- 0:00:26
573500 -- (-883.919) [-881.226] (-883.504) (-888.658) * (-880.747) [-881.072] (-883.007) (-881.560) -- 0:00:26
574000 -- (-883.930) [-881.582] (-882.198) (-884.759) * (-880.740) [-882.953] (-882.473) (-882.017) -- 0:00:25
574500 -- (-884.431) (-883.292) (-882.729) [-883.421] * (-882.131) (-886.637) (-880.999) [-880.199] -- 0:00:25
575000 -- (-882.633) (-880.410) [-880.722] (-883.416) * (-884.959) (-879.808) [-880.438] (-882.099) -- 0:00:25
Average standard deviation of split frequencies: 0.010503
575500 -- (-880.169) (-881.370) (-880.936) [-882.896] * (-880.406) [-881.406] (-881.245) (-882.890) -- 0:00:25
576000 -- (-885.806) (-883.171) [-882.898] (-883.379) * (-880.168) [-880.768] (-882.933) (-879.903) -- 0:00:25
576500 -- (-882.481) (-884.111) [-879.653] (-880.367) * (-879.904) (-879.502) (-881.299) [-880.421] -- 0:00:25
577000 -- [-879.873] (-885.688) (-881.960) (-880.175) * [-881.616] (-879.500) (-881.157) (-883.949) -- 0:00:26
577500 -- (-883.055) [-881.493] (-881.583) (-884.655) * (-881.370) [-880.250] (-884.142) (-883.408) -- 0:00:26
578000 -- (-882.435) [-880.916] (-881.148) (-881.310) * (-881.847) (-881.480) (-883.618) [-879.729] -- 0:00:26
578500 -- [-882.121] (-880.051) (-882.462) (-882.095) * (-882.931) (-880.346) [-880.243] (-880.038) -- 0:00:26
579000 -- (-882.030) (-882.034) (-880.945) [-882.187] * (-882.477) (-884.189) (-883.570) [-881.591] -- 0:00:26
579500 -- (-881.138) (-882.363) (-883.975) [-882.591] * [-880.955] (-882.265) (-882.338) (-880.145) -- 0:00:26
580000 -- [-879.754] (-884.580) (-882.748) (-880.793) * (-881.906) [-880.514] (-886.787) (-880.476) -- 0:00:26
Average standard deviation of split frequencies: 0.010124
580500 -- (-881.468) (-882.718) [-884.967] (-880.841) * (-881.360) (-880.122) (-881.920) [-881.377] -- 0:00:26
581000 -- (-884.052) (-882.325) (-881.018) [-884.563] * (-882.079) [-882.958] (-884.091) (-880.252) -- 0:00:25
581500 -- [-884.343] (-879.618) (-881.328) (-881.871) * (-879.934) [-881.408] (-879.896) (-882.506) -- 0:00:25
582000 -- (-883.309) (-880.936) (-881.107) [-880.533] * (-879.861) (-881.737) (-879.982) [-880.815] -- 0:00:25
582500 -- (-880.979) [-881.235] (-880.614) (-880.521) * (-880.643) (-888.011) (-880.652) [-883.089] -- 0:00:25
583000 -- [-879.433] (-883.678) (-882.992) (-879.401) * [-881.337] (-882.682) (-881.330) (-881.833) -- 0:00:25
583500 -- (-883.044) (-883.885) (-880.523) [-880.807] * (-884.203) (-886.785) (-880.076) [-879.416] -- 0:00:25
584000 -- (-880.919) (-879.795) [-880.359] (-880.283) * [-880.824] (-883.919) (-880.307) (-879.934) -- 0:00:25
584500 -- (-881.371) [-880.086] (-882.462) (-884.292) * (-884.386) (-880.619) [-881.358] (-881.018) -- 0:00:25
585000 -- (-880.845) (-880.754) [-881.053] (-882.268) * [-880.330] (-880.898) (-880.672) (-879.415) -- 0:00:25
Average standard deviation of split frequencies: 0.009795
585500 -- (-884.718) [-880.128] (-883.694) (-881.200) * (-881.544) (-882.492) [-879.930] (-881.929) -- 0:00:25
586000 -- (-882.507) (-880.159) (-880.730) [-880.910] * (-885.528) [-880.704] (-880.423) (-882.702) -- 0:00:25
586500 -- (-884.306) (-880.645) [-880.501] (-880.487) * (-879.847) [-881.619] (-880.410) (-882.320) -- 0:00:25
587000 -- (-885.861) (-880.069) (-879.983) [-881.739] * (-879.923) [-880.416] (-880.697) (-881.282) -- 0:00:25
587500 -- (-880.122) [-883.523] (-880.643) (-880.253) * (-879.837) (-882.213) [-880.738] (-881.702) -- 0:00:25
588000 -- (-880.122) (-881.615) (-880.851) [-882.321] * [-883.288] (-883.299) (-881.895) (-882.240) -- 0:00:25
588500 -- (-880.643) (-882.609) [-884.115] (-881.347) * (-881.595) [-880.493] (-881.394) (-881.747) -- 0:00:25
589000 -- (-882.647) (-882.898) [-884.124] (-879.677) * [-881.933] (-880.635) (-879.664) (-886.400) -- 0:00:25
589500 -- [-884.898] (-880.782) (-881.646) (-885.219) * [-879.693] (-881.306) (-879.916) (-882.990) -- 0:00:25
590000 -- [-882.201] (-882.122) (-881.521) (-880.099) * [-879.718] (-881.413) (-882.396) (-881.886) -- 0:00:25
Average standard deviation of split frequencies: 0.010242
590500 -- (-881.308) (-881.997) (-880.581) [-880.610] * [-881.338] (-880.366) (-884.367) (-887.223) -- 0:00:24
591000 -- (-880.354) (-880.934) [-880.166] (-880.340) * (-880.740) (-880.687) [-881.168] (-884.309) -- 0:00:24
591500 -- (-882.458) [-880.815] (-880.813) (-881.289) * (-880.024) (-883.932) [-879.603] (-886.198) -- 0:00:24
592000 -- [-880.046] (-881.457) (-880.213) (-882.893) * (-883.439) (-881.002) [-879.343] (-885.144) -- 0:00:24
592500 -- (-880.763) (-880.194) [-882.890] (-883.810) * (-880.392) (-881.210) [-881.808] (-882.609) -- 0:00:24
593000 -- [-880.977] (-884.031) (-881.378) (-879.723) * [-880.329] (-882.380) (-884.369) (-881.885) -- 0:00:24
593500 -- [-880.489] (-880.652) (-880.514) (-883.202) * (-882.038) [-880.292] (-882.213) (-887.860) -- 0:00:25
594000 -- [-880.267] (-881.207) (-881.252) (-888.699) * [-880.173] (-880.073) (-883.408) (-881.852) -- 0:00:25
594500 -- (-884.946) (-884.807) [-880.927] (-880.022) * (-880.726) (-881.727) [-883.200] (-884.724) -- 0:00:25
595000 -- (-884.930) [-881.279] (-880.418) (-882.261) * (-883.364) (-880.876) [-881.077] (-883.002) -- 0:00:25
Average standard deviation of split frequencies: 0.010236
595500 -- (-880.354) [-880.360] (-881.924) (-882.081) * (-887.305) [-880.953] (-879.318) (-881.446) -- 0:00:25
596000 -- [-880.518] (-881.060) (-880.928) (-883.118) * (-880.247) (-882.388) (-879.318) [-881.421] -- 0:00:25
596500 -- (-882.219) [-881.062] (-880.605) (-881.182) * (-880.639) (-881.713) [-879.294] (-884.137) -- 0:00:25
597000 -- (-879.556) [-879.489] (-881.463) (-883.026) * (-883.876) (-881.770) (-879.294) [-880.057] -- 0:00:24
597500 -- [-879.414] (-879.489) (-885.769) (-880.609) * (-883.176) [-882.105] (-879.620) (-883.461) -- 0:00:24
598000 -- [-881.743] (-880.503) (-879.291) (-880.870) * [-882.715] (-881.445) (-880.673) (-882.563) -- 0:00:24
598500 -- [-881.695] (-882.558) (-882.407) (-880.798) * (-882.620) (-881.981) (-881.741) [-881.651] -- 0:00:24
599000 -- (-880.114) [-880.603] (-882.115) (-881.105) * (-881.535) (-882.019) [-880.318] (-881.378) -- 0:00:24
599500 -- (-881.849) (-880.139) [-879.859] (-879.856) * (-883.097) (-880.413) [-879.750] (-884.839) -- 0:00:24
600000 -- (-882.137) (-881.512) (-879.468) [-881.337] * (-882.641) (-881.453) (-881.547) [-880.302] -- 0:00:24
Average standard deviation of split frequencies: 0.010433
600500 -- (-884.343) (-880.755) (-879.370) [-883.535] * (-883.713) [-879.864] (-879.813) (-881.367) -- 0:00:24
601000 -- (-879.805) (-882.184) (-883.051) [-884.991] * (-880.344) [-881.074] (-880.828) (-881.538) -- 0:00:24
601500 -- (-879.945) (-882.957) (-879.562) [-881.695] * (-880.569) (-883.119) [-880.916] (-880.616) -- 0:00:24
602000 -- (-883.815) (-882.410) (-881.158) [-882.371] * (-881.132) (-880.164) [-883.930] (-881.903) -- 0:00:24
602500 -- (-881.910) (-882.607) (-882.473) [-882.040] * [-879.992] (-882.462) (-881.375) (-880.935) -- 0:00:24
603000 -- (-880.247) (-880.810) (-881.123) [-880.847] * (-882.159) (-887.602) (-880.356) [-880.779] -- 0:00:24
603500 -- [-879.801] (-880.991) (-884.875) (-883.569) * (-882.216) (-882.336) (-881.805) [-882.682] -- 0:00:24
604000 -- [-887.715] (-884.019) (-881.497) (-880.699) * (-880.231) (-885.315) (-880.594) [-883.906] -- 0:00:24
604500 -- (-882.741) (-883.570) [-879.834] (-883.313) * (-881.322) [-881.467] (-885.729) (-885.216) -- 0:00:24
605000 -- (-879.817) (-884.852) [-879.874] (-880.972) * (-879.462) (-883.267) [-880.997] (-883.623) -- 0:00:24
Average standard deviation of split frequencies: 0.010479
605500 -- (-885.256) (-882.472) (-881.143) [-882.403] * (-880.565) [-882.810] (-880.897) (-880.189) -- 0:00:24
606000 -- [-880.491] (-881.241) (-885.699) (-887.678) * (-882.422) (-880.060) [-882.637] (-881.086) -- 0:00:24
606500 -- [-880.124] (-882.731) (-884.048) (-885.239) * [-880.550] (-880.008) (-880.075) (-879.873) -- 0:00:24
607000 -- (-882.400) [-881.000] (-880.528) (-885.182) * (-879.532) (-880.133) [-883.085] (-881.707) -- 0:00:23
607500 -- (-879.891) (-880.698) [-880.182] (-880.344) * (-879.910) (-880.762) [-882.556] (-884.462) -- 0:00:23
608000 -- (-880.969) [-880.257] (-880.869) (-883.218) * (-882.614) [-882.015] (-884.014) (-881.727) -- 0:00:23
608500 -- (-881.444) (-883.112) (-881.028) [-881.718] * (-882.891) (-880.464) [-880.593] (-879.934) -- 0:00:23
609000 -- [-884.141] (-883.341) (-884.172) (-879.802) * (-883.576) [-884.480] (-883.732) (-882.047) -- 0:00:23
609500 -- [-882.879] (-884.712) (-884.104) (-879.919) * (-884.270) [-880.692] (-880.401) (-883.154) -- 0:00:24
610000 -- [-883.411] (-883.714) (-882.619) (-879.858) * (-881.679) [-880.436] (-880.068) (-880.914) -- 0:00:24
Average standard deviation of split frequencies: 0.010217
610500 -- (-883.876) (-883.042) (-880.128) [-879.482] * (-881.475) [-881.289] (-884.408) (-881.676) -- 0:00:24
611000 -- (-881.570) (-887.300) (-884.074) [-881.794] * [-880.074] (-882.492) (-882.178) (-881.000) -- 0:00:24
611500 -- [-880.408] (-881.205) (-882.164) (-882.409) * (-881.506) (-879.487) (-882.615) [-880.455] -- 0:00:24
612000 -- (-880.071) (-881.503) (-880.309) [-879.943] * [-884.796] (-881.067) (-880.839) (-880.819) -- 0:00:24
612500 -- (-881.245) (-882.156) [-880.985] (-882.131) * [-879.473] (-885.499) (-880.440) (-883.718) -- 0:00:24
613000 -- (-880.960) (-882.943) [-881.809] (-882.541) * (-881.100) (-885.510) [-880.933] (-880.343) -- 0:00:23
613500 -- (-882.334) [-883.270] (-881.789) (-881.576) * (-881.052) (-883.734) [-880.049] (-881.506) -- 0:00:23
614000 -- (-880.775) (-884.998) (-883.650) [-881.816] * (-880.973) [-880.483] (-884.633) (-880.067) -- 0:00:23
614500 -- [-881.669] (-882.155) (-880.760) (-883.012) * (-882.861) (-880.988) (-881.385) [-881.304] -- 0:00:23
615000 -- [-880.575] (-882.792) (-880.205) (-881.547) * (-882.595) (-882.945) [-880.559] (-881.649) -- 0:00:23
Average standard deviation of split frequencies: 0.010399
615500 -- (-883.596) (-883.242) [-881.462] (-882.178) * (-880.006) (-882.519) (-879.799) [-879.940] -- 0:00:23
616000 -- (-886.457) (-881.948) (-883.485) [-881.390] * (-882.537) [-881.875] (-880.766) (-879.940) -- 0:00:23
616500 -- (-881.808) (-882.249) (-884.748) [-881.568] * (-881.255) (-882.832) [-883.557] (-881.430) -- 0:00:23
617000 -- (-880.783) (-881.790) [-882.759] (-882.880) * [-883.635] (-881.177) (-884.486) (-881.339) -- 0:00:23
617500 -- (-882.829) (-882.059) [-885.578] (-879.658) * (-887.606) (-882.846) [-880.039] (-879.610) -- 0:00:23
618000 -- (-882.201) (-882.530) (-891.477) [-881.348] * (-880.248) (-882.911) (-880.923) [-881.965] -- 0:00:23
618500 -- [-881.935] (-881.027) (-882.957) (-882.597) * (-882.913) (-882.976) [-879.931] (-882.871) -- 0:00:23
619000 -- (-882.225) (-884.943) [-881.918] (-883.084) * (-882.376) [-882.822] (-879.792) (-882.119) -- 0:00:23
619500 -- (-882.936) [-883.077] (-880.822) (-882.994) * (-882.210) (-883.424) [-880.928] (-881.577) -- 0:00:23
620000 -- (-881.287) (-884.804) (-882.557) [-885.051] * [-881.282] (-882.971) (-880.928) (-880.231) -- 0:00:23
Average standard deviation of split frequencies: 0.010320
620500 -- (-883.103) (-882.050) [-881.036] (-883.160) * (-882.049) (-883.494) [-880.623] (-879.964) -- 0:00:23
621000 -- (-881.505) [-881.229] (-884.305) (-883.630) * (-884.427) (-883.103) (-880.068) [-879.914] -- 0:00:23
621500 -- [-881.147] (-881.464) (-883.705) (-881.163) * (-880.049) (-881.718) (-883.560) [-882.327] -- 0:00:23
622000 -- (-883.763) (-879.499) [-884.159] (-881.419) * [-881.101] (-881.017) (-880.985) (-882.827) -- 0:00:23
622500 -- [-879.960] (-879.884) (-883.826) (-881.268) * (-881.134) (-880.978) (-882.136) [-882.856] -- 0:00:23
623000 -- (-881.027) (-886.478) (-885.059) [-882.599] * (-880.255) (-879.962) (-882.791) [-880.755] -- 0:00:22
623500 -- [-881.417] (-880.261) (-882.401) (-882.860) * [-879.704] (-880.495) (-882.893) (-882.779) -- 0:00:22
624000 -- [-882.640] (-879.791) (-882.468) (-879.887) * [-882.969] (-880.912) (-882.473) (-881.920) -- 0:00:22
624500 -- (-884.016) (-880.806) [-880.613] (-880.141) * (-884.168) [-879.763] (-882.859) (-885.382) -- 0:00:22
625000 -- (-882.222) (-883.505) (-882.511) [-879.472] * [-882.013] (-881.826) (-884.359) (-881.733) -- 0:00:22
Average standard deviation of split frequencies: 0.010454
625500 -- (-880.943) (-882.971) (-880.828) [-881.682] * (-881.657) (-881.992) (-883.825) [-883.065] -- 0:00:22
626000 -- (-882.247) [-883.755] (-882.475) (-880.861) * (-880.843) [-880.761] (-882.917) (-882.239) -- 0:00:23
626500 -- (-880.163) (-882.098) (-886.473) [-881.663] * (-880.293) (-883.518) (-883.963) [-882.215] -- 0:00:23
627000 -- [-879.742] (-883.834) (-882.348) (-882.629) * (-881.016) (-879.801) [-880.908] (-881.552) -- 0:00:23
627500 -- (-881.269) [-881.731] (-881.380) (-881.492) * [-881.026] (-882.922) (-880.033) (-883.371) -- 0:00:23
628000 -- (-883.519) (-885.945) (-882.109) [-879.835] * (-882.048) (-882.856) (-880.786) [-881.321] -- 0:00:23
628500 -- (-881.069) (-888.428) (-883.015) [-879.736] * (-886.127) (-880.941) [-882.043] (-883.270) -- 0:00:23
629000 -- (-880.418) (-886.073) (-882.149) [-880.860] * (-883.881) (-882.104) (-881.064) [-881.245] -- 0:00:23
629500 -- (-882.263) (-880.984) [-880.459] (-880.835) * (-882.199) [-884.917] (-880.923) (-880.669) -- 0:00:22
630000 -- (-882.673) [-879.507] (-883.194) (-881.257) * (-883.049) [-882.452] (-879.567) (-880.877) -- 0:00:22
Average standard deviation of split frequencies: 0.010860
630500 -- (-880.584) (-880.164) (-883.796) [-881.180] * [-880.589] (-880.726) (-881.442) (-882.055) -- 0:00:22
631000 -- (-884.160) (-882.444) (-884.277) [-879.852] * (-881.477) (-882.181) [-881.094] (-879.987) -- 0:00:22
631500 -- (-881.045) [-879.970] (-880.975) (-881.828) * (-884.081) (-883.289) (-881.737) [-879.730] -- 0:00:22
632000 -- (-879.489) (-880.128) (-882.204) [-882.049] * (-880.590) (-884.319) [-883.429] (-886.298) -- 0:00:22
632500 -- (-879.980) (-883.188) (-884.428) [-880.701] * [-880.532] (-881.517) (-885.060) (-882.244) -- 0:00:22
633000 -- (-883.464) (-880.789) [-881.491] (-884.274) * (-881.899) (-881.507) [-881.788] (-884.129) -- 0:00:22
633500 -- (-880.191) [-882.778] (-881.547) (-881.961) * (-879.746) (-879.591) (-880.148) [-882.448] -- 0:00:22
634000 -- (-881.345) (-881.361) (-883.289) [-879.947] * (-883.483) [-880.514] (-881.274) (-880.912) -- 0:00:22
634500 -- (-880.949) (-881.706) (-883.058) [-880.069] * [-881.892] (-882.022) (-883.026) (-881.383) -- 0:00:22
635000 -- [-881.663] (-881.637) (-882.194) (-880.784) * (-884.056) (-884.028) (-881.153) [-881.295] -- 0:00:22
Average standard deviation of split frequencies: 0.010813
635500 -- (-881.751) [-881.917] (-881.338) (-880.023) * [-886.617] (-884.638) (-882.751) (-880.840) -- 0:00:22
636000 -- [-880.487] (-884.836) (-883.763) (-882.842) * (-880.153) (-882.580) [-880.774] (-883.524) -- 0:00:22
636500 -- (-880.357) [-879.558] (-882.277) (-882.031) * [-882.349] (-885.152) (-883.729) (-885.044) -- 0:00:22
637000 -- (-880.089) (-880.622) [-880.661] (-880.472) * (-883.809) (-884.031) (-880.642) [-881.289] -- 0:00:22
637500 -- (-883.971) [-880.847] (-880.902) (-882.170) * (-881.644) [-885.185] (-883.528) (-882.165) -- 0:00:22
638000 -- (-882.306) (-884.402) (-881.428) [-884.947] * (-880.330) (-885.338) (-881.363) [-880.571] -- 0:00:22
638500 -- (-886.875) (-883.478) [-881.810] (-882.987) * (-879.701) (-882.218) (-880.330) [-880.849] -- 0:00:22
639000 -- [-881.310] (-881.479) (-882.985) (-882.451) * (-881.933) [-880.863] (-880.561) (-883.921) -- 0:00:22
639500 -- (-881.792) [-880.207] (-881.125) (-880.069) * (-880.830) (-882.035) (-881.780) [-880.090] -- 0:00:21
640000 -- [-880.321] (-886.438) (-881.513) (-882.072) * (-882.083) [-881.176] (-884.240) (-882.414) -- 0:00:21
Average standard deviation of split frequencies: 0.010171
640500 -- (-880.087) (-880.793) [-882.023] (-880.303) * (-879.537) (-881.785) (-884.006) [-879.958] -- 0:00:21
641000 -- (-882.313) [-882.138] (-881.227) (-882.625) * [-880.965] (-880.320) (-886.067) (-879.874) -- 0:00:21
641500 -- (-881.474) (-882.573) [-880.409] (-883.855) * (-885.901) (-881.853) (-882.108) [-880.632] -- 0:00:21
642000 -- (-882.436) [-881.052] (-883.633) (-880.715) * (-886.465) (-881.005) [-879.794] (-880.653) -- 0:00:21
642500 -- (-882.377) (-882.944) [-882.803] (-886.734) * [-881.074] (-881.392) (-879.712) (-884.899) -- 0:00:22
643000 -- (-880.312) (-880.692) [-882.155] (-887.940) * (-881.619) [-881.707] (-879.253) (-880.097) -- 0:00:22
643500 -- [-883.107] (-879.889) (-879.369) (-884.131) * (-882.855) (-881.560) (-879.253) [-880.920] -- 0:00:22
644000 -- [-882.067] (-881.481) (-879.823) (-881.136) * (-880.653) (-879.488) (-884.342) [-881.274] -- 0:00:22
644500 -- [-884.411] (-880.467) (-880.038) (-884.206) * (-881.079) (-879.892) (-883.151) [-882.054] -- 0:00:22
645000 -- (-886.965) (-880.382) (-882.262) [-883.395] * (-880.934) (-882.829) [-882.858] (-880.973) -- 0:00:22
Average standard deviation of split frequencies: 0.010002
645500 -- (-879.526) (-880.639) (-881.800) [-886.353] * (-881.077) (-879.968) (-883.477) [-880.057] -- 0:00:21
646000 -- (-880.726) (-880.274) [-881.115] (-883.997) * [-880.265] (-880.048) (-881.250) (-880.487) -- 0:00:21
646500 -- [-881.495] (-881.915) (-881.199) (-881.542) * (-881.273) (-880.774) (-882.178) [-880.088] -- 0:00:21
647000 -- [-880.663] (-882.492) (-880.986) (-881.393) * [-879.560] (-881.787) (-880.190) (-880.043) -- 0:00:21
647500 -- (-880.867) (-881.081) (-883.887) [-881.101] * (-882.193) [-883.552] (-881.234) (-881.506) -- 0:00:21
648000 -- (-881.401) [-880.512] (-886.828) (-881.054) * (-880.664) (-880.086) (-880.155) [-879.697] -- 0:00:21
648500 -- (-880.474) [-879.773] (-885.109) (-880.727) * (-883.741) (-880.301) [-880.937] (-880.774) -- 0:00:21
649000 -- [-883.811] (-882.815) (-884.347) (-882.243) * (-885.520) (-881.486) [-881.375] (-884.959) -- 0:00:21
649500 -- (-881.637) (-879.532) (-885.110) [-884.260] * (-883.024) [-881.875] (-883.167) (-880.865) -- 0:00:21
650000 -- [-882.586] (-882.167) (-883.497) (-882.356) * (-880.469) (-880.528) [-883.237] (-884.742) -- 0:00:21
Average standard deviation of split frequencies: 0.009930
650500 -- [-880.804] (-880.842) (-886.510) (-881.486) * (-880.317) (-881.589) [-883.771] (-882.274) -- 0:00:21
651000 -- [-880.281] (-882.268) (-884.821) (-881.852) * [-880.320] (-881.502) (-883.760) (-880.436) -- 0:00:21
651500 -- (-881.068) [-880.184] (-881.453) (-884.602) * (-881.325) (-881.486) (-880.050) [-880.158] -- 0:00:21
652000 -- (-881.523) (-881.989) [-881.705] (-880.757) * (-885.199) (-880.864) (-880.463) [-880.723] -- 0:00:21
652500 -- (-881.311) (-882.174) (-883.935) [-882.082] * (-890.301) (-880.609) (-881.036) [-880.295] -- 0:00:21
653000 -- (-881.697) (-880.941) [-882.116] (-881.935) * (-881.373) [-882.076] (-882.952) (-881.960) -- 0:00:21
653500 -- (-881.966) (-883.074) (-881.652) [-881.528] * (-882.701) (-886.396) [-886.632] (-880.593) -- 0:00:21
654000 -- [-882.378] (-882.431) (-882.137) (-881.327) * (-883.767) (-885.534) (-892.586) [-880.890] -- 0:00:21
654500 -- [-882.072] (-880.397) (-881.444) (-883.768) * [-881.462] (-880.526) (-880.950) (-881.670) -- 0:00:21
655000 -- [-886.400] (-879.582) (-881.132) (-883.297) * [-879.667] (-879.673) (-880.784) (-881.774) -- 0:00:21
Average standard deviation of split frequencies: 0.009638
655500 -- (-880.106) (-882.310) [-882.356] (-883.243) * [-879.472] (-883.167) (-882.662) (-880.243) -- 0:00:21
656000 -- (-881.050) (-884.788) (-880.707) [-881.223] * [-880.670] (-882.691) (-881.108) (-884.412) -- 0:00:20
656500 -- (-879.474) (-881.429) [-881.758] (-880.122) * (-882.153) (-879.909) (-879.589) [-882.529] -- 0:00:20
657000 -- (-879.684) (-881.769) (-880.965) [-879.903] * [-885.175] (-884.089) (-880.392) (-884.360) -- 0:00:20
657500 -- (-879.654) (-883.711) [-879.419] (-879.705) * [-880.169] (-884.095) (-881.886) (-879.896) -- 0:00:20
658000 -- (-881.119) [-879.723] (-879.969) (-881.808) * (-880.218) (-881.118) [-881.781] (-879.765) -- 0:00:20
658500 -- (-879.365) (-881.590) (-881.691) [-880.424] * [-883.395] (-880.814) (-882.423) (-879.827) -- 0:00:21
659000 -- [-880.251] (-880.666) (-880.018) (-879.720) * (-887.429) (-886.992) [-881.336] (-881.026) -- 0:00:21
659500 -- (-880.004) (-884.052) [-879.476] (-879.764) * (-882.426) (-885.439) [-882.176] (-881.909) -- 0:00:21
660000 -- (-880.373) (-884.210) (-889.119) [-879.724] * [-881.811] (-881.755) (-881.153) (-881.565) -- 0:00:21
Average standard deviation of split frequencies: 0.009318
660500 -- (-880.452) (-884.946) [-884.526] (-880.053) * [-881.467] (-883.796) (-882.222) (-882.192) -- 0:00:21
661000 -- (-880.280) (-883.054) [-880.297] (-880.603) * (-880.069) [-881.534] (-885.248) (-879.776) -- 0:00:21
661500 -- [-882.756] (-882.067) (-885.134) (-881.319) * [-881.400] (-880.935) (-881.079) (-880.833) -- 0:00:20
662000 -- (-881.170) (-879.836) (-881.755) [-886.227] * (-883.264) (-880.671) [-882.890] (-879.906) -- 0:00:20
662500 -- [-880.616] (-879.561) (-884.375) (-885.343) * (-880.090) (-880.640) [-882.473] (-880.863) -- 0:00:20
663000 -- (-880.284) (-883.467) (-886.359) [-881.700] * [-879.960] (-880.673) (-881.972) (-881.318) -- 0:00:20
663500 -- [-881.750] (-883.854) (-881.663) (-885.772) * [-881.897] (-880.304) (-880.054) (-880.777) -- 0:00:20
664000 -- [-879.993] (-881.601) (-881.269) (-882.273) * (-881.869) (-881.548) [-883.187] (-884.400) -- 0:00:20
664500 -- [-880.380] (-882.273) (-882.225) (-882.517) * [-883.168] (-881.880) (-882.858) (-884.601) -- 0:00:20
665000 -- [-882.802] (-880.541) (-883.334) (-882.541) * (-881.756) [-883.031] (-880.605) (-880.911) -- 0:00:20
Average standard deviation of split frequencies: 0.008869
665500 -- (-881.431) (-882.650) (-881.727) [-879.951] * (-880.150) (-880.987) [-881.089] (-882.738) -- 0:00:20
666000 -- (-880.570) (-879.854) [-881.743] (-881.339) * (-881.119) (-880.903) (-880.983) [-883.906] -- 0:00:20
666500 -- (-881.468) [-880.540] (-882.179) (-880.190) * (-882.062) (-882.253) [-881.269] (-880.676) -- 0:00:20
667000 -- (-880.949) [-885.107] (-881.059) (-881.297) * (-882.195) (-880.626) [-880.668] (-885.098) -- 0:00:20
667500 -- (-880.606) (-881.681) (-881.334) [-880.160] * (-881.155) [-880.230] (-882.399) (-882.106) -- 0:00:20
668000 -- (-884.416) [-882.194] (-880.233) (-881.057) * (-881.951) (-883.774) (-879.714) [-882.027] -- 0:00:20
668500 -- (-885.411) (-883.883) (-882.843) [-879.946] * [-884.840] (-884.961) (-881.520) (-882.614) -- 0:00:20
669000 -- (-885.518) (-882.213) (-881.989) [-880.274] * [-881.098] (-881.177) (-883.843) (-887.713) -- 0:00:20
669500 -- (-882.551) (-885.555) (-881.612) [-882.435] * [-885.069] (-880.959) (-881.105) (-882.018) -- 0:00:20
670000 -- [-882.033] (-879.511) (-880.051) (-882.823) * [-880.733] (-880.159) (-883.008) (-884.279) -- 0:00:20
Average standard deviation of split frequencies: 0.008874
670500 -- [-880.973] (-882.271) (-880.203) (-881.103) * [-881.205] (-880.340) (-882.778) (-883.558) -- 0:00:20
671000 -- (-880.863) [-881.197] (-882.737) (-881.365) * (-881.612) [-881.489] (-881.828) (-879.706) -- 0:00:20
671500 -- [-883.309] (-882.421) (-883.326) (-883.231) * (-880.730) (-881.961) [-881.033] (-881.733) -- 0:00:20
672000 -- [-881.414] (-880.081) (-881.971) (-880.949) * (-883.108) [-883.224] (-880.556) (-880.273) -- 0:00:20
672500 -- (-881.343) (-880.281) (-881.160) [-880.275] * (-884.208) (-880.306) (-882.965) [-882.194] -- 0:00:19
673000 -- (-884.225) (-881.730) (-880.300) [-879.978] * (-882.015) (-880.749) [-881.339] (-882.795) -- 0:00:19
673500 -- (-880.489) [-882.762] (-881.328) (-882.152) * (-882.165) (-880.996) (-879.782) [-880.331] -- 0:00:19
674000 -- (-882.477) (-880.140) (-881.018) [-881.862] * (-880.427) (-884.301) [-883.845] (-880.249) -- 0:00:19
674500 -- (-882.446) [-882.820] (-881.452) (-880.388) * (-881.808) [-879.860] (-884.725) (-881.151) -- 0:00:20
675000 -- (-881.391) [-881.960] (-881.316) (-881.080) * [-881.204] (-881.033) (-883.161) (-881.294) -- 0:00:20
Average standard deviation of split frequencies: 0.009196
675500 -- [-879.642] (-880.091) (-881.594) (-883.286) * (-881.694) [-880.536] (-883.275) (-881.128) -- 0:00:20
676000 -- (-883.632) (-879.994) (-883.194) [-881.791] * (-885.585) [-881.671] (-884.949) (-883.101) -- 0:00:20
676500 -- (-883.544) [-880.257] (-882.318) (-884.023) * (-881.311) (-883.924) (-882.582) [-880.612] -- 0:00:20
677000 -- (-880.719) (-881.338) (-884.861) [-880.204] * [-880.732] (-882.899) (-883.104) (-881.653) -- 0:00:20
677500 -- (-880.083) (-883.377) [-882.494] (-882.144) * (-882.486) (-881.026) [-884.985] (-882.793) -- 0:00:19
678000 -- (-880.259) (-884.073) [-882.421] (-879.833) * [-881.865] (-881.213) (-881.493) (-880.828) -- 0:00:19
678500 -- (-880.754) (-883.419) [-882.041] (-880.342) * (-883.835) (-880.705) (-880.704) [-879.785] -- 0:00:19
679000 -- (-880.387) [-883.393] (-879.972) (-880.341) * (-882.158) (-880.790) (-883.102) [-882.145] -- 0:00:19
679500 -- [-885.629] (-884.592) (-880.476) (-879.964) * (-882.580) (-882.671) [-880.875] (-880.982) -- 0:00:19
680000 -- (-882.011) [-883.973] (-883.335) (-880.259) * (-880.694) [-883.063] (-879.914) (-880.228) -- 0:00:19
Average standard deviation of split frequencies: 0.009263
680500 -- (-882.067) (-880.479) [-880.585] (-882.931) * (-884.408) (-880.217) [-880.497] (-883.588) -- 0:00:19
681000 -- (-882.620) (-880.792) (-881.921) [-881.956] * (-882.623) (-881.029) (-880.205) [-881.319] -- 0:00:19
681500 -- [-879.764] (-881.148) (-880.446) (-882.867) * [-883.746] (-880.470) (-882.230) (-880.474) -- 0:00:19
682000 -- (-880.165) (-883.375) [-880.535] (-881.345) * [-880.946] (-883.034) (-883.573) (-881.036) -- 0:00:19
682500 -- (-883.113) (-882.019) [-880.554] (-882.504) * [-880.371] (-882.280) (-884.811) (-881.420) -- 0:00:19
683000 -- (-881.995) (-884.062) (-880.487) [-886.131] * [-883.255] (-884.079) (-890.882) (-881.909) -- 0:00:19
683500 -- [-882.296] (-882.664) (-881.295) (-881.347) * (-879.724) (-883.593) [-883.576] (-886.429) -- 0:00:19
684000 -- (-880.361) (-882.307) (-881.362) [-881.797] * (-884.044) [-881.404] (-880.294) (-885.986) -- 0:00:19
684500 -- [-885.993] (-881.843) (-881.641) (-883.378) * [-880.874] (-881.481) (-883.450) (-881.398) -- 0:00:19
685000 -- (-881.670) (-885.048) [-882.569] (-881.378) * (-881.703) (-881.491) (-881.206) [-881.587] -- 0:00:19
Average standard deviation of split frequencies: 0.008890
685500 -- (-880.180) (-884.199) [-881.463] (-886.091) * (-881.145) (-883.751) (-883.177) [-879.287] -- 0:00:19
686000 -- (-880.094) [-884.545] (-884.460) (-881.091) * (-880.521) [-886.607] (-882.563) (-879.614) -- 0:00:19
686500 -- (-880.199) (-883.381) [-882.333] (-882.151) * [-880.673] (-880.957) (-883.788) (-880.936) -- 0:00:19
687000 -- (-880.101) [-880.274] (-881.571) (-881.538) * (-882.789) (-880.833) [-882.790] (-879.594) -- 0:00:19
687500 -- (-881.616) (-881.815) (-885.358) [-885.164] * (-884.322) [-880.337] (-884.028) (-880.684) -- 0:00:19
688000 -- (-882.351) [-883.577] (-881.500) (-881.797) * (-884.652) [-884.523] (-882.614) (-881.132) -- 0:00:19
688500 -- (-880.274) (-880.353) (-880.688) [-882.220] * (-882.293) (-883.804) (-882.678) [-879.727] -- 0:00:19
689000 -- (-882.684) (-880.913) [-879.575] (-884.093) * (-880.998) (-880.452) (-883.497) [-879.934] -- 0:00:18
689500 -- (-883.744) (-880.213) (-880.646) [-881.014] * [-883.465] (-880.079) (-880.804) (-881.169) -- 0:00:18
690000 -- (-884.339) [-879.574] (-881.113) (-880.923) * (-882.171) [-880.500] (-880.857) (-881.787) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- [-880.429] (-880.540) (-882.249) (-881.972) * [-881.666] (-883.219) (-882.067) (-880.879) -- 0:00:19
691000 -- (-880.327) [-881.686] (-881.352) (-879.918) * [-884.934] (-880.094) (-881.239) (-880.007) -- 0:00:19
691500 -- [-880.898] (-883.234) (-881.073) (-880.110) * (-883.451) [-880.932] (-881.041) (-880.056) -- 0:00:19
692000 -- [-881.084] (-883.857) (-880.630) (-880.123) * (-881.606) (-883.858) (-882.526) [-881.289] -- 0:00:19
692500 -- [-882.420] (-882.351) (-880.570) (-881.990) * [-881.150] (-882.019) (-882.592) (-880.967) -- 0:00:19
693000 -- (-882.381) (-881.385) [-881.086] (-882.202) * (-880.899) [-882.467] (-881.210) (-880.497) -- 0:00:19
693500 -- (-886.484) [-880.917] (-883.354) (-880.663) * (-885.269) [-881.894] (-879.923) (-879.875) -- 0:00:19
694000 -- (-882.390) [-881.248] (-880.708) (-880.569) * (-882.750) (-884.315) (-882.467) [-881.274] -- 0:00:18
694500 -- (-881.809) [-883.174] (-879.326) (-881.775) * (-881.040) (-881.767) (-881.872) [-883.224] -- 0:00:18
695000 -- (-882.196) (-880.434) (-879.530) [-880.645] * (-882.379) [-880.378] (-880.963) (-881.899) -- 0:00:18
Average standard deviation of split frequencies: 0.008636
695500 -- (-881.606) [-880.329] (-880.544) (-883.028) * (-883.213) [-883.489] (-882.432) (-881.627) -- 0:00:18
696000 -- (-882.164) (-880.294) [-879.840] (-880.191) * (-882.695) (-881.577) (-881.200) [-881.612] -- 0:00:18
696500 -- [-881.432] (-882.073) (-879.847) (-884.558) * (-880.216) (-882.782) (-880.761) [-884.004] -- 0:00:18
697000 -- (-884.892) (-882.674) [-879.845] (-880.424) * [-881.405] (-881.852) (-881.615) (-882.220) -- 0:00:18
697500 -- (-881.537) (-882.637) (-879.420) [-881.519] * (-880.650) (-880.577) [-880.104] (-884.427) -- 0:00:18
698000 -- (-882.642) [-882.294] (-880.056) (-881.587) * (-883.203) (-882.503) [-882.772] (-883.900) -- 0:00:18
698500 -- [-880.073] (-881.853) (-880.110) (-880.471) * (-885.020) (-883.738) [-879.365] (-880.873) -- 0:00:18
699000 -- (-880.321) [-881.379] (-883.111) (-882.295) * (-885.363) (-882.562) (-879.439) [-885.729] -- 0:00:18
699500 -- (-884.733) [-883.174] (-881.886) (-879.829) * (-884.668) [-881.311] (-882.034) (-884.500) -- 0:00:18
700000 -- (-883.183) [-884.740] (-886.821) (-885.004) * (-881.618) [-880.945] (-879.560) (-881.941) -- 0:00:18
Average standard deviation of split frequencies: 0.008284
700500 -- [-881.454] (-879.899) (-881.994) (-883.966) * [-881.082] (-879.509) (-879.592) (-886.528) -- 0:00:18
701000 -- (-882.075) (-880.257) (-881.085) [-882.224] * (-883.122) (-882.239) [-879.735] (-884.546) -- 0:00:18
701500 -- (-882.373) [-880.233] (-884.174) (-880.333) * (-881.626) (-881.180) [-883.426] (-880.571) -- 0:00:18
702000 -- [-881.829] (-883.724) (-888.570) (-881.667) * (-882.181) (-880.161) (-887.333) [-880.921] -- 0:00:18
702500 -- (-886.440) (-882.784) [-881.656] (-881.684) * (-879.825) [-881.192] (-882.830) (-882.032) -- 0:00:18
703000 -- (-881.667) (-880.834) [-881.415] (-883.075) * (-881.525) [-881.275] (-882.365) (-887.210) -- 0:00:18
703500 -- (-881.341) (-880.744) (-879.837) [-881.584] * [-881.042] (-881.861) (-882.138) (-882.275) -- 0:00:18
704000 -- (-888.502) (-880.338) (-882.048) [-884.624] * (-881.142) [-881.075] (-883.230) (-886.515) -- 0:00:18
704500 -- (-882.553) (-884.024) [-880.203] (-881.253) * (-880.382) (-879.828) [-883.958] (-881.801) -- 0:00:18
705000 -- (-882.322) (-887.159) (-880.047) [-881.188] * [-880.474] (-880.325) (-880.927) (-884.448) -- 0:00:17
Average standard deviation of split frequencies: 0.008366
705500 -- [-881.625] (-880.898) (-882.094) (-881.085) * (-880.753) (-880.347) (-879.897) [-881.717] -- 0:00:17
706000 -- (-880.238) (-880.545) [-882.542] (-882.672) * (-881.208) [-880.016] (-880.637) (-880.504) -- 0:00:17
706500 -- [-879.834] (-880.482) (-887.192) (-880.757) * (-882.553) (-880.662) [-881.306] (-880.534) -- 0:00:17
707000 -- (-881.118) [-880.495] (-883.038) (-881.212) * [-882.413] (-886.215) (-884.797) (-880.816) -- 0:00:17
707500 -- (-880.799) (-884.168) (-881.355) [-883.860] * (-882.990) (-883.777) [-883.461] (-885.838) -- 0:00:18
708000 -- (-880.810) (-885.675) [-881.230] (-879.479) * (-881.387) (-887.302) (-883.181) [-880.114] -- 0:00:18
708500 -- [-880.693] (-883.167) (-883.701) (-879.693) * (-881.806) (-882.060) (-886.854) [-883.365] -- 0:00:18
709000 -- (-879.824) (-881.164) [-882.418] (-883.656) * (-879.948) (-882.531) [-881.626] (-882.467) -- 0:00:18
709500 -- [-881.888] (-882.479) (-879.541) (-881.064) * (-879.910) (-882.495) (-881.002) [-884.291] -- 0:00:18
710000 -- (-884.313) (-882.096) (-883.049) [-881.242] * (-880.369) [-885.142] (-880.339) (-884.372) -- 0:00:17
Average standard deviation of split frequencies: 0.008540
710500 -- (-884.601) (-882.487) (-886.212) [-881.473] * (-880.378) (-880.979) (-879.917) [-880.534] -- 0:00:17
711000 -- (-882.099) (-881.234) [-882.680] (-881.835) * (-880.278) (-879.550) (-881.789) [-879.241] -- 0:00:17
711500 -- [-879.972] (-886.714) (-880.220) (-881.084) * [-880.877] (-881.057) (-882.286) (-881.080) -- 0:00:17
712000 -- [-880.111] (-884.150) (-880.095) (-883.089) * (-890.758) (-880.757) (-880.809) [-882.733] -- 0:00:17
712500 -- [-880.185] (-882.803) (-880.314) (-880.416) * (-882.043) (-882.521) (-882.820) [-880.371] -- 0:00:17
713000 -- (-884.163) (-880.948) (-881.537) [-881.264] * (-882.586) (-881.318) (-882.871) [-879.480] -- 0:00:17
713500 -- (-880.537) [-880.680] (-880.131) (-880.363) * [-881.685] (-882.352) (-887.874) (-879.450) -- 0:00:17
714000 -- [-880.003] (-880.622) (-880.795) (-880.627) * (-881.767) [-879.713] (-880.421) (-881.745) -- 0:00:17
714500 -- [-879.968] (-882.957) (-881.426) (-880.702) * [-883.071] (-879.538) (-880.484) (-880.891) -- 0:00:17
715000 -- (-881.573) (-882.928) [-880.197] (-879.763) * (-881.654) (-881.597) [-881.804] (-883.309) -- 0:00:17
Average standard deviation of split frequencies: 0.008765
715500 -- (-882.593) (-882.194) (-879.797) [-881.139] * (-882.818) (-883.067) [-880.308] (-882.992) -- 0:00:17
716000 -- (-881.953) (-882.980) [-884.116] (-880.753) * (-879.981) (-881.134) (-880.425) [-881.346] -- 0:00:17
716500 -- (-883.606) (-883.708) (-883.579) [-882.735] * (-881.372) (-886.283) (-880.908) [-881.155] -- 0:00:17
717000 -- (-882.744) (-880.787) (-880.655) [-880.429] * (-879.469) (-882.429) [-882.333] (-881.576) -- 0:00:17
717500 -- (-881.087) (-880.354) [-880.166] (-882.101) * [-883.243] (-884.263) (-880.415) (-888.812) -- 0:00:17
718000 -- [-880.118] (-880.501) (-882.332) (-883.275) * [-884.186] (-885.187) (-881.780) (-881.546) -- 0:00:17
718500 -- (-879.984) (-879.983) [-879.954] (-884.161) * (-881.632) (-881.474) [-881.921] (-880.365) -- 0:00:17
719000 -- (-882.881) [-880.510] (-881.515) (-885.564) * [-881.183] (-880.255) (-886.481) (-880.381) -- 0:00:17
719500 -- (-881.103) [-882.220] (-881.805) (-880.167) * [-883.067] (-880.650) (-881.854) (-882.358) -- 0:00:17
720000 -- (-880.530) (-880.069) [-881.945] (-880.206) * (-880.275) (-882.860) [-880.744] (-880.312) -- 0:00:17
Average standard deviation of split frequencies: 0.008912
720500 -- [-882.239] (-882.467) (-882.612) (-879.501) * (-882.002) [-880.024] (-881.243) (-881.518) -- 0:00:17
721000 -- (-882.085) (-879.815) [-881.218] (-880.868) * [-880.776] (-880.968) (-879.797) (-881.042) -- 0:00:17
721500 -- (-883.483) (-883.230) (-887.141) [-884.385] * [-879.928] (-881.316) (-880.156) (-882.336) -- 0:00:16
722000 -- (-882.474) (-881.537) (-882.346) [-881.490] * (-880.421) (-880.106) (-879.796) [-883.532] -- 0:00:16
722500 -- (-883.751) (-881.411) [-881.638] (-883.316) * (-883.483) (-881.742) [-881.225] (-884.149) -- 0:00:16
723000 -- (-879.853) (-881.916) (-880.761) [-883.034] * (-882.433) (-880.497) (-880.624) [-884.388] -- 0:00:16
723500 -- (-881.184) [-881.160] (-881.958) (-882.487) * (-881.982) [-882.250] (-881.712) (-883.978) -- 0:00:16
724000 -- [-884.006] (-881.089) (-882.219) (-882.015) * (-881.027) (-880.560) [-880.930] (-883.331) -- 0:00:17
724500 -- (-885.489) [-880.955] (-881.633) (-882.223) * [-882.097] (-880.189) (-880.422) (-880.530) -- 0:00:17
725000 -- (-886.704) (-879.923) (-880.217) [-881.774] * [-881.336] (-887.919) (-882.420) (-881.249) -- 0:00:17
Average standard deviation of split frequencies: 0.009253
725500 -- (-881.892) [-882.477] (-882.493) (-881.650) * [-885.637] (-883.096) (-880.696) (-885.640) -- 0:00:17
726000 -- (-880.268) [-882.866] (-882.270) (-883.548) * [-879.790] (-886.243) (-884.239) (-883.064) -- 0:00:16
726500 -- [-882.358] (-881.487) (-882.385) (-880.664) * [-880.670] (-888.637) (-882.115) (-881.017) -- 0:00:16
727000 -- (-881.443) (-880.531) (-883.325) [-882.403] * [-880.358] (-881.201) (-880.585) (-882.741) -- 0:00:16
727500 -- (-880.323) (-880.787) (-880.298) [-880.883] * (-880.929) [-883.988] (-886.605) (-881.643) -- 0:00:16
728000 -- (-880.412) (-882.184) [-881.106] (-881.139) * (-882.421) [-880.619] (-881.228) (-882.576) -- 0:00:16
728500 -- (-884.018) [-881.086] (-884.569) (-882.201) * (-880.549) (-882.146) (-880.466) [-879.590] -- 0:00:16
729000 -- (-881.096) [-881.759] (-883.607) (-881.368) * (-881.500) [-888.854] (-882.464) (-880.542) -- 0:00:16
729500 -- (-881.146) (-881.182) (-880.156) [-881.366] * (-880.953) (-880.742) (-884.480) [-880.121] -- 0:00:16
730000 -- [-881.511] (-881.143) (-880.855) (-880.653) * (-882.572) (-880.540) (-883.617) [-882.204] -- 0:00:16
Average standard deviation of split frequencies: 0.008750
730500 -- [-879.657] (-881.649) (-884.474) (-882.910) * (-880.707) (-882.344) [-883.420] (-880.495) -- 0:00:16
731000 -- (-881.517) (-885.988) [-883.566] (-883.720) * (-884.682) (-879.731) (-880.733) [-880.370] -- 0:00:16
731500 -- (-880.455) [-883.559] (-881.132) (-881.853) * (-882.534) (-881.242) (-880.346) [-882.212] -- 0:00:16
732000 -- (-879.527) [-881.944] (-880.719) (-880.686) * (-881.922) (-881.028) [-883.333] (-881.304) -- 0:00:16
732500 -- [-882.836] (-882.251) (-879.995) (-881.507) * (-880.426) (-881.201) [-881.063] (-879.992) -- 0:00:16
733000 -- (-883.881) (-880.254) (-881.048) [-879.470] * (-883.773) (-880.807) [-881.820] (-880.135) -- 0:00:16
733500 -- [-880.085] (-881.851) (-880.520) (-883.733) * (-882.431) [-879.852] (-879.502) (-882.060) -- 0:00:16
734000 -- (-886.011) [-880.625] (-881.109) (-883.195) * [-881.266] (-884.166) (-881.068) (-883.577) -- 0:00:16
734500 -- [-881.102] (-885.371) (-880.939) (-883.828) * (-881.240) [-883.128] (-882.512) (-880.663) -- 0:00:16
735000 -- [-881.136] (-881.189) (-880.523) (-881.234) * (-880.715) (-882.110) [-880.710] (-879.825) -- 0:00:16
Average standard deviation of split frequencies: 0.009007
735500 -- [-880.441] (-880.510) (-880.414) (-883.168) * (-880.163) [-882.868] (-880.943) (-881.359) -- 0:00:16
736000 -- [-881.141] (-883.022) (-880.818) (-884.453) * (-880.703) (-879.743) [-879.828] (-880.781) -- 0:00:16
736500 -- (-882.389) [-881.329] (-881.910) (-882.442) * (-882.247) (-879.722) (-879.795) [-879.291] -- 0:00:16
737000 -- (-883.515) (-883.643) (-882.664) [-880.773] * (-881.230) [-881.584] (-880.353) (-881.613) -- 0:00:16
737500 -- [-881.835] (-883.936) (-880.980) (-884.354) * (-883.502) (-879.701) [-879.836] (-883.439) -- 0:00:16
738000 -- (-883.031) [-881.405] (-889.000) (-883.531) * (-882.410) (-880.297) [-879.816] (-882.238) -- 0:00:15
738500 -- (-884.112) (-882.966) (-880.451) [-879.292] * (-882.649) (-879.963) (-880.913) [-879.868] -- 0:00:15
739000 -- [-880.233] (-884.551) (-880.192) (-879.860) * (-884.935) [-883.222] (-884.750) (-881.734) -- 0:00:15
739500 -- [-880.368] (-881.795) (-884.973) (-883.537) * (-881.097) (-880.993) [-880.009] (-882.601) -- 0:00:15
740000 -- (-880.249) (-883.906) (-881.237) [-882.706] * (-882.784) (-880.056) (-882.529) [-883.341] -- 0:00:15
Average standard deviation of split frequencies: 0.008791
740500 -- (-884.029) (-882.753) [-881.688] (-881.300) * (-882.532) (-880.079) (-882.912) [-881.181] -- 0:00:16
741000 -- (-880.309) (-884.459) [-882.054] (-882.250) * (-881.146) (-880.780) (-880.375) [-880.638] -- 0:00:16
741500 -- (-881.336) (-883.415) [-882.311] (-881.404) * [-882.690] (-881.777) (-882.268) (-880.460) -- 0:00:16
742000 -- [-880.178] (-882.069) (-884.664) (-881.061) * (-883.473) [-880.794] (-881.741) (-880.855) -- 0:00:15
742500 -- (-880.060) [-882.151] (-881.579) (-883.714) * (-882.241) [-883.367] (-883.468) (-880.202) -- 0:00:15
743000 -- (-885.678) [-881.031] (-884.415) (-882.902) * (-883.242) (-885.935) (-879.976) [-881.113] -- 0:00:15
743500 -- (-880.374) (-880.501) (-884.685) [-883.540] * (-880.825) [-885.354] (-882.997) (-884.189) -- 0:00:15
744000 -- (-879.342) [-880.722] (-884.016) (-882.749) * [-881.605] (-882.704) (-882.495) (-888.797) -- 0:00:15
744500 -- (-884.220) (-879.951) (-881.887) [-880.914] * (-881.303) (-883.014) [-884.537] (-882.785) -- 0:00:15
745000 -- (-882.268) (-880.180) [-881.172] (-880.472) * (-879.366) (-881.112) (-885.119) [-881.777] -- 0:00:15
Average standard deviation of split frequencies: 0.009005
745500 -- (-881.359) (-886.846) [-880.075] (-879.649) * [-880.018] (-879.358) (-882.532) (-881.129) -- 0:00:15
746000 -- (-881.105) (-883.269) (-880.002) [-881.794] * (-880.985) (-880.249) [-880.377] (-881.371) -- 0:00:15
746500 -- [-880.007] (-880.457) (-881.458) (-881.898) * (-881.457) (-879.798) (-879.850) [-881.536] -- 0:00:15
747000 -- (-883.611) [-881.070] (-880.434) (-882.000) * (-884.294) (-881.269) [-880.403] (-883.101) -- 0:00:15
747500 -- (-884.059) (-881.784) (-880.645) [-882.039] * (-882.339) (-880.436) (-880.748) [-880.818] -- 0:00:15
748000 -- (-880.443) [-880.544] (-882.221) (-880.576) * (-884.523) (-881.282) [-885.978] (-881.296) -- 0:00:15
748500 -- [-880.807] (-881.091) (-879.807) (-880.063) * (-880.259) [-879.556] (-884.579) (-883.173) -- 0:00:15
749000 -- (-880.090) (-880.398) (-887.310) [-881.726] * [-881.261] (-881.371) (-884.054) (-881.522) -- 0:00:15
749500 -- (-882.076) [-879.405] (-882.189) (-881.666) * [-881.898] (-881.055) (-883.000) (-883.278) -- 0:00:15
750000 -- [-880.050] (-882.213) (-882.079) (-881.789) * [-879.872] (-880.533) (-881.773) (-881.719) -- 0:00:15
Average standard deviation of split frequencies: 0.008752
750500 -- (-884.990) (-886.329) (-883.002) [-881.455] * (-880.231) [-880.402] (-881.563) (-881.376) -- 0:00:15
751000 -- [-880.657] (-882.671) (-882.816) (-880.707) * (-882.340) (-880.614) [-881.080] (-880.140) -- 0:00:15
751500 -- (-881.584) (-883.958) (-883.393) [-880.707] * [-881.241] (-880.011) (-881.354) (-883.120) -- 0:00:15
752000 -- (-881.308) (-884.865) [-880.645] (-880.717) * (-882.059) (-879.994) [-880.708] (-882.636) -- 0:00:15
752500 -- [-883.498] (-881.034) (-880.702) (-884.765) * (-883.353) [-880.407] (-881.098) (-881.106) -- 0:00:15
753000 -- (-880.001) [-881.732] (-880.770) (-881.487) * (-879.238) (-880.114) [-880.453] (-881.242) -- 0:00:15
753500 -- (-883.694) (-881.055) [-882.587] (-880.414) * (-882.965) [-880.150] (-883.809) (-884.225) -- 0:00:15
754000 -- (-881.401) (-881.254) [-880.560] (-880.187) * (-881.843) [-880.269] (-879.331) (-882.237) -- 0:00:15
754500 -- [-881.745] (-882.994) (-881.417) (-882.194) * (-881.942) [-881.686] (-880.671) (-882.116) -- 0:00:14
755000 -- (-884.119) [-881.597] (-889.034) (-880.074) * (-883.119) (-882.216) (-881.926) [-884.443] -- 0:00:14
Average standard deviation of split frequencies: 0.008730
755500 -- (-882.890) [-881.614] (-882.394) (-882.767) * (-881.729) [-880.840] (-881.623) (-884.447) -- 0:00:14
756000 -- [-882.627] (-884.922) (-880.882) (-884.256) * [-882.059] (-880.763) (-882.591) (-882.117) -- 0:00:14
756500 -- [-885.391] (-881.660) (-880.731) (-881.284) * (-881.037) (-883.213) (-881.039) [-881.477] -- 0:00:14
757000 -- (-881.760) (-880.863) [-881.475] (-880.434) * (-881.728) (-880.842) (-885.886) [-880.586] -- 0:00:14
757500 -- (-881.873) (-880.555) [-879.550] (-881.320) * (-882.308) [-883.722] (-883.683) (-879.883) -- 0:00:15
758000 -- (-882.000) (-881.939) [-883.095] (-884.736) * [-881.084] (-881.492) (-880.917) (-880.364) -- 0:00:15
758500 -- (-882.374) [-881.008] (-879.916) (-880.255) * (-886.479) (-882.641) [-879.982] (-882.504) -- 0:00:14
759000 -- (-883.823) (-883.734) (-880.931) [-879.918] * (-879.632) [-887.407] (-880.197) (-879.997) -- 0:00:14
759500 -- (-883.012) [-880.112] (-881.172) (-880.312) * (-881.915) (-885.165) (-880.387) [-880.048] -- 0:00:14
760000 -- (-881.776) (-879.642) [-881.398] (-879.564) * (-883.219) [-881.254] (-881.954) (-881.428) -- 0:00:14
Average standard deviation of split frequencies: 0.008909
760500 -- (-881.926) [-880.274] (-879.918) (-881.824) * (-880.480) (-882.692) (-880.657) [-879.412] -- 0:00:14
761000 -- (-882.510) (-880.987) [-881.268] (-882.472) * (-880.240) (-879.397) (-881.503) [-883.102] -- 0:00:14
761500 -- (-884.017) [-883.248] (-881.317) (-881.117) * (-883.202) [-882.837] (-881.316) (-881.856) -- 0:00:14
762000 -- [-884.227] (-880.507) (-882.972) (-880.014) * [-879.689] (-881.606) (-887.617) (-879.823) -- 0:00:14
762500 -- (-879.995) [-880.929] (-880.811) (-879.644) * (-880.475) (-882.607) [-881.021] (-879.972) -- 0:00:14
763000 -- (-879.773) (-881.665) [-881.368] (-883.498) * (-880.857) [-883.269] (-880.785) (-884.775) -- 0:00:14
763500 -- (-879.525) (-890.546) [-885.539] (-885.521) * (-881.958) (-883.638) (-881.099) [-880.757] -- 0:00:14
764000 -- (-880.100) (-881.437) [-880.940] (-883.566) * (-881.683) (-881.592) [-884.000] (-880.034) -- 0:00:14
764500 -- (-879.885) (-880.864) [-882.595] (-882.663) * [-882.081] (-880.375) (-881.201) (-883.890) -- 0:00:14
765000 -- (-882.604) (-880.644) (-881.784) [-881.372] * [-880.636] (-881.949) (-880.548) (-882.530) -- 0:00:14
Average standard deviation of split frequencies: 0.008462
765500 -- (-881.488) (-883.414) [-882.376] (-882.751) * (-880.508) [-879.994] (-880.022) (-882.227) -- 0:00:14
766000 -- (-881.017) (-881.225) [-887.817] (-885.582) * (-883.127) [-879.611] (-889.474) (-881.468) -- 0:00:14
766500 -- (-883.364) [-882.319] (-880.281) (-885.214) * (-880.651) (-880.203) [-881.059] (-885.607) -- 0:00:14
767000 -- (-880.858) (-880.953) (-880.357) [-882.394] * (-881.080) (-880.863) [-882.095] (-885.162) -- 0:00:14
767500 -- [-882.472] (-881.983) (-880.798) (-883.758) * (-880.822) (-883.206) (-880.528) [-882.094] -- 0:00:14
768000 -- [-880.705] (-881.755) (-883.315) (-882.691) * (-881.665) (-880.648) [-880.050] (-883.188) -- 0:00:14
768500 -- (-879.472) (-880.612) [-881.369] (-881.665) * (-883.247) (-880.639) [-879.608] (-882.974) -- 0:00:14
769000 -- [-879.315] (-881.585) (-880.282) (-880.437) * (-882.051) (-880.978) [-881.864] (-882.554) -- 0:00:14
769500 -- [-883.477] (-881.632) (-881.182) (-881.918) * (-880.011) (-882.598) [-879.896] (-886.148) -- 0:00:14
770000 -- (-881.427) [-880.495] (-885.012) (-887.120) * (-884.477) (-880.379) [-883.366] (-882.139) -- 0:00:14
Average standard deviation of split frequencies: 0.008411
770500 -- [-880.848] (-880.618) (-879.969) (-881.236) * (-882.679) [-882.930] (-882.017) (-885.213) -- 0:00:13
771000 -- (-882.615) (-880.413) [-882.730] (-881.158) * (-883.425) (-880.628) [-884.727] (-881.540) -- 0:00:13
771500 -- (-883.072) (-879.553) [-882.893] (-881.468) * [-883.834] (-882.559) (-883.409) (-884.905) -- 0:00:13
772000 -- (-883.879) [-879.627] (-884.584) (-879.902) * (-883.095) (-884.848) (-881.024) [-881.982] -- 0:00:13
772500 -- (-879.561) [-879.454] (-880.466) (-879.405) * (-889.287) (-887.501) (-883.260) [-880.961] -- 0:00:13
773000 -- (-882.937) (-881.846) [-879.632] (-882.274) * (-881.804) (-883.188) (-881.009) [-883.265] -- 0:00:13
773500 -- (-880.990) (-882.738) [-882.602] (-882.926) * (-882.295) [-884.102] (-880.011) (-881.092) -- 0:00:13
774000 -- (-880.490) [-880.442] (-881.116) (-884.325) * (-882.454) [-885.962] (-880.481) (-881.261) -- 0:00:13
774500 -- (-880.717) [-882.387] (-881.152) (-881.976) * (-880.028) (-882.862) [-880.239] (-880.906) -- 0:00:13
775000 -- (-887.361) [-882.805] (-881.579) (-882.062) * [-881.703] (-883.035) (-887.236) (-880.437) -- 0:00:13
Average standard deviation of split frequencies: 0.008657
775500 -- (-882.294) (-886.492) (-881.519) [-880.755] * [-883.786] (-881.058) (-880.811) (-879.940) -- 0:00:13
776000 -- [-881.800] (-881.723) (-881.486) (-880.708) * (-879.577) (-885.721) [-882.698] (-886.662) -- 0:00:13
776500 -- (-881.575) (-883.489) [-880.870] (-882.345) * (-879.756) [-881.967] (-885.701) (-883.039) -- 0:00:13
777000 -- (-880.864) [-880.963] (-882.304) (-881.916) * (-879.754) (-879.826) (-881.785) [-880.464] -- 0:00:13
777500 -- (-884.667) (-881.293) [-881.886] (-882.304) * [-883.068] (-881.796) (-881.644) (-880.753) -- 0:00:13
778000 -- (-881.286) (-881.066) (-882.624) [-881.469] * [-882.663] (-880.669) (-886.265) (-879.823) -- 0:00:13
778500 -- [-882.538] (-882.792) (-884.609) (-887.596) * [-879.762] (-885.436) (-881.568) (-881.828) -- 0:00:13
779000 -- (-882.708) (-881.741) [-880.963] (-881.830) * [-880.665] (-881.259) (-885.236) (-881.462) -- 0:00:13
779500 -- (-883.105) (-883.896) [-880.072] (-882.871) * [-881.422] (-883.540) (-886.880) (-881.586) -- 0:00:13
780000 -- (-880.271) [-883.919] (-880.671) (-881.772) * (-881.845) (-883.950) (-886.927) [-883.727] -- 0:00:13
Average standard deviation of split frequencies: 0.008378
780500 -- [-880.493] (-881.293) (-881.349) (-887.511) * (-883.334) (-880.067) [-881.885] (-879.442) -- 0:00:13
781000 -- (-879.751) (-880.875) [-880.004] (-883.833) * (-882.064) (-881.865) [-879.719] (-881.823) -- 0:00:13
781500 -- (-879.417) (-881.291) [-880.331] (-881.527) * (-882.432) [-880.805] (-881.957) (-881.575) -- 0:00:13
782000 -- (-882.152) (-881.534) (-882.940) [-883.403] * (-883.353) [-881.475] (-881.540) (-883.746) -- 0:00:13
782500 -- (-885.836) (-883.094) [-880.141] (-881.731) * [-881.926] (-880.458) (-884.793) (-884.122) -- 0:00:13
783000 -- (-882.934) [-879.870] (-882.246) (-880.547) * (-880.926) (-881.482) [-880.793] (-883.444) -- 0:00:13
783500 -- [-882.267] (-879.922) (-882.282) (-880.979) * (-880.858) (-881.248) [-881.217] (-881.844) -- 0:00:13
784000 -- (-880.228) (-881.314) (-881.520) [-884.168] * (-880.710) (-880.030) [-882.821] (-881.474) -- 0:00:13
784500 -- (-881.486) (-881.597) [-881.511] (-882.547) * [-880.473] (-881.414) (-882.507) (-879.658) -- 0:00:13
785000 -- [-883.350] (-884.102) (-881.964) (-881.322) * (-879.984) (-880.747) [-880.778] (-881.130) -- 0:00:13
Average standard deviation of split frequencies: 0.008097
785500 -- (-881.886) (-880.807) (-882.622) [-882.086] * [-881.260] (-879.841) (-883.511) (-879.250) -- 0:00:13
786000 -- (-880.998) (-879.775) (-883.641) [-880.269] * [-883.481] (-884.496) (-880.337) (-881.194) -- 0:00:13
786500 -- (-882.173) [-881.375] (-881.161) (-879.888) * (-880.845) [-881.296] (-880.055) (-879.934) -- 0:00:13
787000 -- [-884.295] (-881.150) (-883.232) (-881.460) * [-880.910] (-880.710) (-881.039) (-880.433) -- 0:00:12
787500 -- (-879.928) (-881.133) (-883.079) [-881.530] * [-881.234] (-881.145) (-881.546) (-889.527) -- 0:00:12
788000 -- (-882.611) (-885.554) (-883.775) [-881.963] * (-883.235) (-881.441) (-881.863) [-879.219] -- 0:00:12
788500 -- (-881.881) (-881.412) (-885.670) [-881.993] * (-883.196) (-881.956) (-883.111) [-886.159] -- 0:00:12
789000 -- (-882.526) (-884.019) (-888.340) [-880.148] * (-880.446) (-881.768) (-880.600) [-885.027] -- 0:00:12
789500 -- (-883.597) [-883.473] (-887.207) (-881.219) * (-880.613) (-885.506) [-879.180] (-888.291) -- 0:00:12
790000 -- (-882.531) [-883.099] (-879.933) (-882.977) * (-879.749) (-880.264) [-880.384] (-885.429) -- 0:00:12
Average standard deviation of split frequencies: 0.007825
790500 -- (-887.535) (-882.585) (-881.425) [-880.147] * (-883.617) (-882.102) (-879.931) [-883.837] -- 0:00:12
791000 -- (-880.755) (-879.339) [-880.944] (-882.241) * (-880.329) [-883.593] (-880.419) (-880.256) -- 0:00:12
791500 -- (-881.746) (-883.672) (-883.852) [-882.440] * (-880.501) (-884.910) (-880.174) [-881.822] -- 0:00:12
792000 -- [-879.857] (-882.608) (-881.824) (-885.683) * [-880.199] (-882.077) (-881.996) (-880.846) -- 0:00:12
792500 -- (-880.153) [-883.024] (-881.764) (-885.265) * (-882.470) [-881.435] (-880.225) (-881.304) -- 0:00:12
793000 -- (-880.971) [-884.133] (-883.445) (-883.320) * (-880.727) [-880.038] (-881.641) (-884.519) -- 0:00:12
793500 -- (-883.858) (-880.286) (-880.546) [-882.690] * (-880.911) (-883.919) [-879.697] (-882.824) -- 0:00:12
794000 -- (-881.366) [-880.038] (-879.731) (-880.326) * [-880.280] (-879.604) (-880.536) (-880.863) -- 0:00:12
794500 -- (-881.735) (-881.003) [-882.885] (-880.248) * (-879.428) [-880.073] (-884.866) (-880.983) -- 0:00:12
795000 -- (-882.734) (-881.152) (-881.575) [-880.079] * (-880.125) (-884.598) [-879.728] (-881.461) -- 0:00:12
Average standard deviation of split frequencies: 0.007588
795500 -- (-879.532) [-882.189] (-881.347) (-885.934) * (-880.932) (-879.456) [-879.596] (-880.585) -- 0:00:12
796000 -- (-880.688) [-880.949] (-881.703) (-883.765) * (-882.422) (-881.362) (-883.458) [-882.247] -- 0:00:12
796500 -- [-881.264] (-880.165) (-880.761) (-882.120) * (-880.872) [-880.358] (-879.696) (-885.436) -- 0:00:12
797000 -- (-881.326) [-880.847] (-885.815) (-880.936) * [-882.241] (-881.481) (-881.249) (-883.967) -- 0:00:12
797500 -- (-883.757) [-880.348] (-881.314) (-882.392) * (-881.142) (-882.460) [-881.215] (-881.255) -- 0:00:12
798000 -- (-880.777) (-881.410) [-881.008] (-882.574) * (-881.272) (-882.349) (-881.822) [-882.393] -- 0:00:12
798500 -- (-880.516) (-879.734) (-881.548) [-882.475] * (-881.835) (-882.637) (-879.789) [-880.004] -- 0:00:12
799000 -- (-882.715) (-881.098) (-881.947) [-880.983] * [-879.993] (-880.680) (-880.601) (-879.270) -- 0:00:12
799500 -- (-882.743) (-880.308) [-880.893] (-879.567) * (-882.750) (-883.394) (-881.021) [-879.920] -- 0:00:12
800000 -- (-884.315) (-882.212) (-880.342) [-881.183] * [-880.984] (-885.030) (-880.077) (-879.952) -- 0:00:12
Average standard deviation of split frequencies: 0.007470
800500 -- (-884.473) (-879.701) [-880.851] (-879.572) * (-882.255) [-884.953] (-885.341) (-881.099) -- 0:00:12
801000 -- (-882.250) [-879.696] (-880.423) (-879.575) * (-882.187) (-883.826) [-881.253] (-882.775) -- 0:00:12
801500 -- (-880.326) (-880.430) [-883.114] (-879.851) * (-881.364) [-881.459] (-880.466) (-881.412) -- 0:00:12
802000 -- (-880.986) [-881.244] (-882.418) (-881.582) * (-880.409) (-880.881) (-885.031) [-880.537] -- 0:00:12
802500 -- (-882.951) (-881.171) (-881.690) [-882.317] * (-883.888) (-884.033) (-888.259) [-881.529] -- 0:00:12
803000 -- (-880.334) [-880.315] (-879.907) (-881.754) * (-883.333) (-881.824) (-881.477) [-880.535] -- 0:00:12
803500 -- (-881.015) (-880.354) (-879.858) [-883.626] * (-882.184) [-881.869] (-883.655) (-882.262) -- 0:00:11
804000 -- (-881.569) [-881.197] (-882.369) (-884.509) * (-885.912) [-885.726] (-883.533) (-880.315) -- 0:00:11
804500 -- [-880.008] (-880.822) (-883.261) (-879.989) * (-881.620) [-883.623] (-882.575) (-883.646) -- 0:00:11
805000 -- (-880.953) (-881.852) [-879.936] (-881.806) * (-879.731) (-882.386) (-883.133) [-882.410] -- 0:00:11
Average standard deviation of split frequencies: 0.007859
805500 -- (-881.103) (-885.182) [-881.788] (-880.984) * (-879.772) [-882.041] (-880.220) (-884.482) -- 0:00:11
806000 -- (-881.160) (-881.998) (-884.822) [-879.769] * [-879.815] (-884.777) (-879.747) (-879.807) -- 0:00:11
806500 -- (-882.854) (-879.910) (-881.800) [-884.812] * (-880.490) (-880.729) [-880.183] (-882.148) -- 0:00:11
807000 -- [-880.997] (-879.963) (-879.985) (-881.655) * [-880.845] (-880.959) (-883.953) (-880.925) -- 0:00:11
807500 -- (-880.648) [-879.581] (-880.273) (-881.893) * [-880.309] (-880.733) (-885.775) (-885.212) -- 0:00:11
808000 -- [-879.817] (-880.657) (-880.009) (-880.377) * (-881.858) [-881.252] (-882.561) (-880.064) -- 0:00:11
808500 -- (-882.288) [-880.855] (-883.803) (-881.195) * (-881.442) (-881.846) [-882.800] (-881.629) -- 0:00:11
809000 -- [-881.483] (-884.722) (-879.949) (-880.589) * (-881.039) (-883.104) [-881.202] (-881.286) -- 0:00:11
809500 -- (-882.113) [-880.679] (-882.463) (-881.522) * (-884.879) [-879.758] (-881.080) (-880.698) -- 0:00:11
810000 -- (-884.234) (-881.011) (-881.655) [-880.632] * (-883.409) (-881.627) (-881.764) [-881.131] -- 0:00:11
Average standard deviation of split frequencies: 0.008323
810500 -- (-881.647) (-880.012) (-880.360) [-880.874] * (-884.013) (-882.557) (-880.854) [-883.200] -- 0:00:11
811000 -- (-880.788) [-880.010] (-879.794) (-879.870) * (-881.894) (-882.769) [-883.499] (-879.636) -- 0:00:11
811500 -- (-879.899) [-882.120] (-880.821) (-881.826) * [-881.430] (-882.085) (-879.682) (-884.572) -- 0:00:11
812000 -- [-881.952] (-879.865) (-881.512) (-883.152) * (-881.584) (-885.843) (-884.097) [-883.053] -- 0:00:11
812500 -- (-880.286) [-879.723] (-883.079) (-879.630) * (-879.866) (-881.518) (-880.827) [-888.097] -- 0:00:11
813000 -- (-882.522) (-886.956) [-881.428] (-880.720) * (-882.647) [-882.569] (-882.833) (-880.967) -- 0:00:11
813500 -- (-881.956) (-883.275) (-879.621) [-880.768] * (-881.579) [-883.038] (-880.184) (-882.556) -- 0:00:11
814000 -- (-884.321) (-883.287) (-881.076) [-879.826] * (-884.673) (-879.950) [-881.194] (-882.653) -- 0:00:11
814500 -- (-884.402) (-884.970) (-880.240) [-882.084] * [-885.492] (-880.410) (-880.768) (-883.107) -- 0:00:11
815000 -- [-880.772] (-889.937) (-882.771) (-881.113) * [-882.489] (-887.479) (-883.389) (-883.709) -- 0:00:11
Average standard deviation of split frequencies: 0.008196
815500 -- [-881.272] (-881.796) (-880.810) (-879.778) * (-883.821) [-887.107] (-883.339) (-881.866) -- 0:00:11
816000 -- (-881.837) (-881.062) (-884.493) [-880.597] * [-883.790] (-886.995) (-882.389) (-883.381) -- 0:00:11
816500 -- (-879.154) (-885.062) [-882.999] (-881.868) * (-885.092) (-881.135) [-882.446] (-879.435) -- 0:00:11
817000 -- (-879.588) (-883.770) [-883.166] (-881.954) * (-886.167) (-881.166) (-881.073) [-881.893] -- 0:00:11
817500 -- [-879.710] (-883.279) (-885.552) (-883.312) * (-882.597) [-880.605] (-882.923) (-879.777) -- 0:00:11
818000 -- (-880.504) [-885.564] (-883.499) (-882.245) * [-882.031] (-880.737) (-884.645) (-884.361) -- 0:00:11
818500 -- (-882.380) [-879.684] (-883.164) (-884.911) * (-881.245) (-881.500) [-882.056] (-884.166) -- 0:00:11
819000 -- (-882.163) (-879.641) [-879.779] (-884.793) * (-880.159) (-882.961) (-879.687) [-879.693] -- 0:00:11
819500 -- [-884.326] (-880.969) (-883.523) (-882.412) * (-882.248) (-881.174) (-882.100) [-879.775] -- 0:00:11
820000 -- (-884.109) (-886.539) (-881.516) [-886.913] * (-880.079) [-882.547] (-883.985) (-881.330) -- 0:00:10
Average standard deviation of split frequencies: 0.007862
820500 -- [-881.881] (-883.426) (-882.361) (-882.973) * (-881.235) (-883.369) (-882.792) [-882.401] -- 0:00:10
821000 -- (-882.634) (-880.937) [-881.873] (-880.127) * (-883.542) (-884.778) [-882.104] (-881.953) -- 0:00:10
821500 -- (-883.129) (-879.187) (-880.045) [-879.989] * (-880.206) (-880.662) [-880.436] (-883.807) -- 0:00:10
822000 -- (-881.625) (-881.393) [-879.806] (-884.184) * (-881.095) (-885.396) (-881.547) [-884.217] -- 0:00:10
822500 -- (-883.697) (-880.508) (-880.772) [-881.016] * (-884.405) (-883.615) (-882.589) [-880.653] -- 0:00:10
823000 -- (-885.481) [-882.798] (-881.472) (-879.445) * (-884.339) (-879.986) (-879.954) [-880.944] -- 0:00:10
823500 -- (-883.232) (-880.085) [-882.732] (-881.270) * (-882.856) [-882.960] (-880.909) (-884.889) -- 0:00:10
824000 -- (-883.545) (-881.548) (-881.079) [-881.343] * (-880.718) (-880.070) [-883.535] (-881.875) -- 0:00:10
824500 -- (-880.146) (-879.663) (-880.685) [-882.055] * (-881.930) (-882.625) [-882.484] (-881.922) -- 0:00:10
825000 -- [-880.952] (-880.854) (-880.613) (-886.346) * (-882.404) (-879.710) (-885.668) [-883.164] -- 0:00:10
Average standard deviation of split frequencies: 0.007776
825500 -- (-884.138) (-879.781) [-884.734] (-882.755) * (-879.818) (-880.511) [-881.433] (-886.539) -- 0:00:10
826000 -- (-882.608) (-883.834) [-880.668] (-882.020) * (-881.784) [-880.260] (-880.644) (-879.948) -- 0:00:10
826500 -- (-883.267) [-880.152] (-880.865) (-882.232) * (-881.131) (-879.872) [-880.393] (-880.225) -- 0:00:10
827000 -- [-880.452] (-886.741) (-879.967) (-883.599) * (-883.304) (-879.407) [-880.416] (-879.974) -- 0:00:10
827500 -- (-882.038) [-882.557] (-881.175) (-887.502) * (-879.851) [-883.809] (-880.647) (-881.217) -- 0:00:10
828000 -- (-881.379) (-882.678) (-881.309) [-880.475] * (-880.116) [-881.140] (-880.167) (-882.361) -- 0:00:10
828500 -- [-880.960] (-884.058) (-880.410) (-881.456) * [-882.728] (-882.279) (-879.970) (-884.991) -- 0:00:10
829000 -- [-880.857] (-880.731) (-884.104) (-881.131) * (-885.986) (-880.546) (-883.181) [-885.355] -- 0:00:10
829500 -- (-882.846) [-882.186] (-881.479) (-883.830) * (-887.553) [-881.371] (-880.745) (-880.646) -- 0:00:10
830000 -- [-881.474] (-881.323) (-881.780) (-881.486) * (-879.696) (-882.653) [-882.463] (-882.136) -- 0:00:10
Average standard deviation of split frequencies: 0.007803
830500 -- [-881.744] (-879.409) (-880.743) (-880.679) * [-879.719] (-884.596) (-883.287) (-880.654) -- 0:00:10
831000 -- (-883.123) [-879.913] (-881.854) (-880.724) * (-879.628) [-881.902] (-881.970) (-887.005) -- 0:00:10
831500 -- (-881.561) (-887.379) [-881.165] (-881.369) * [-880.810] (-882.741) (-882.734) (-882.811) -- 0:00:10
832000 -- [-881.269] (-882.434) (-881.310) (-882.260) * (-880.016) [-881.180] (-882.191) (-881.628) -- 0:00:10
832500 -- (-880.099) [-880.000] (-881.623) (-882.221) * [-880.597] (-880.879) (-881.332) (-881.108) -- 0:00:10
833000 -- (-880.170) [-882.551] (-882.431) (-880.383) * (-882.492) (-881.357) [-880.868] (-886.306) -- 0:00:10
833500 -- [-880.951] (-881.553) (-882.329) (-879.524) * (-884.193) (-880.601) [-885.284] (-880.684) -- 0:00:10
834000 -- (-879.715) (-882.581) (-884.807) [-881.741] * (-882.569) (-880.373) (-881.610) [-883.451] -- 0:00:10
834500 -- (-879.991) [-883.621] (-884.945) (-880.468) * [-882.590] (-879.280) (-882.020) (-884.458) -- 0:00:10
835000 -- (-883.191) (-885.376) (-882.331) [-880.883] * (-879.549) (-880.828) [-880.307] (-879.943) -- 0:00:10
Average standard deviation of split frequencies: 0.007824
835500 -- (-885.822) (-883.109) (-879.510) [-880.916] * (-879.854) (-881.695) [-883.467] (-883.319) -- 0:00:10
836000 -- (-882.824) (-881.273) (-883.687) [-880.976] * (-883.511) (-880.775) [-882.326] (-881.653) -- 0:00:10
836500 -- [-880.231] (-882.238) (-881.985) (-881.311) * [-880.103] (-881.404) (-880.871) (-881.408) -- 0:00:09
837000 -- (-880.227) (-880.665) [-883.368] (-880.726) * (-880.265) (-881.540) [-879.914] (-881.870) -- 0:00:09
837500 -- [-880.806] (-880.378) (-880.471) (-882.358) * (-887.557) (-883.833) [-883.970] (-881.668) -- 0:00:09
838000 -- (-886.107) (-880.462) [-881.487] (-881.804) * (-886.533) (-881.236) [-881.519] (-881.281) -- 0:00:09
838500 -- (-883.786) [-883.105] (-881.636) (-888.413) * (-884.011) [-881.621] (-881.236) (-883.139) -- 0:00:09
839000 -- (-882.914) [-882.160] (-884.925) (-880.384) * (-880.911) (-882.769) (-880.740) [-882.191] -- 0:00:09
839500 -- (-881.981) (-880.511) (-884.460) [-879.709] * (-882.394) [-882.031] (-883.518) (-882.806) -- 0:00:09
840000 -- [-881.808] (-887.170) (-880.558) (-885.001) * (-883.867) (-880.242) (-885.163) [-882.818] -- 0:00:09
Average standard deviation of split frequencies: 0.007589
840500 -- (-882.433) [-880.587] (-881.919) (-888.619) * (-880.861) [-881.029] (-881.841) (-883.414) -- 0:00:09
841000 -- [-880.689] (-882.515) (-881.253) (-882.172) * [-880.031] (-884.714) (-879.826) (-879.966) -- 0:00:09
841500 -- (-881.664) [-881.064] (-880.535) (-881.964) * (-881.568) (-883.915) [-879.884] (-885.375) -- 0:00:09
842000 -- [-881.670] (-881.898) (-882.000) (-884.893) * (-880.023) (-880.874) [-880.676] (-884.388) -- 0:00:09
842500 -- (-886.445) (-882.556) [-879.687] (-884.109) * (-880.726) (-879.594) [-880.368] (-881.759) -- 0:00:09
843000 -- (-879.984) (-881.373) [-882.427] (-882.430) * [-882.324] (-880.713) (-881.304) (-885.664) -- 0:00:09
843500 -- [-881.023] (-879.537) (-882.506) (-883.387) * (-883.406) (-881.357) (-882.893) [-879.969] -- 0:00:09
844000 -- [-880.932] (-879.792) (-881.038) (-879.555) * (-880.163) [-881.640] (-884.772) (-881.271) -- 0:00:09
844500 -- (-880.070) (-881.995) (-881.493) [-880.245] * (-880.302) (-879.989) (-881.729) [-881.032] -- 0:00:09
845000 -- [-881.973] (-881.388) (-879.868) (-879.928) * (-882.032) [-883.656] (-880.825) (-882.881) -- 0:00:09
Average standard deviation of split frequencies: 0.007690
845500 -- [-882.423] (-879.545) (-881.706) (-882.031) * (-879.651) (-882.470) [-880.492] (-884.267) -- 0:00:09
846000 -- (-883.895) [-885.254] (-880.272) (-880.953) * (-882.410) (-883.399) [-881.938] (-883.981) -- 0:00:09
846500 -- (-883.476) [-881.357] (-880.322) (-881.117) * [-882.182] (-880.554) (-880.282) (-881.473) -- 0:00:09
847000 -- (-880.959) [-880.328] (-883.073) (-883.473) * (-881.994) (-883.580) (-879.512) [-881.261] -- 0:00:09
847500 -- (-881.111) [-881.966] (-880.957) (-880.764) * (-880.538) (-889.639) (-879.326) [-884.935] -- 0:00:09
848000 -- [-879.959] (-879.765) (-884.075) (-884.049) * (-884.276) (-882.243) [-882.924] (-881.854) -- 0:00:09
848500 -- (-881.646) (-880.049) (-884.164) [-883.266] * (-882.028) [-881.021] (-881.739) (-882.423) -- 0:00:09
849000 -- [-880.138] (-880.010) (-880.849) (-884.687) * (-888.249) [-883.370] (-881.650) (-883.247) -- 0:00:09
849500 -- (-882.010) (-885.608) [-881.175] (-884.673) * (-881.870) (-883.681) (-882.405) [-882.658] -- 0:00:09
850000 -- (-881.258) [-880.614] (-880.477) (-881.058) * (-887.400) [-882.552] (-882.128) (-884.544) -- 0:00:09
Average standard deviation of split frequencies: 0.008054
850500 -- (-881.327) (-884.025) (-883.288) [-880.567] * (-881.732) (-880.697) (-882.018) [-880.841] -- 0:00:09
851000 -- (-880.641) [-880.734] (-881.596) (-880.134) * (-880.567) (-880.010) [-883.312] (-879.901) -- 0:00:09
851500 -- (-879.375) (-882.008) (-880.470) [-880.347] * (-880.736) [-880.944] (-880.430) (-881.112) -- 0:00:09
852000 -- (-881.510) [-883.232] (-879.513) (-880.772) * (-879.769) (-879.775) (-880.549) [-880.094] -- 0:00:09
852500 -- (-888.769) (-879.803) (-879.866) [-881.679] * [-880.999] (-881.731) (-884.179) (-880.242) -- 0:00:08
853000 -- (-886.549) [-880.875] (-879.856) (-883.225) * [-884.562] (-880.268) (-883.048) (-883.038) -- 0:00:08
853500 -- (-885.775) [-879.928] (-881.014) (-880.765) * (-885.948) (-883.008) (-879.881) [-879.943] -- 0:00:08
854000 -- (-881.384) [-882.754] (-879.975) (-884.565) * [-882.806] (-880.543) (-880.962) (-882.059) -- 0:00:08
854500 -- (-881.700) (-880.231) (-882.736) [-883.008] * (-883.815) [-881.174] (-885.117) (-886.056) -- 0:00:08
855000 -- (-880.588) (-882.648) [-882.570] (-880.974) * [-884.028] (-880.829) (-889.186) (-887.796) -- 0:00:08
Average standard deviation of split frequencies: 0.008040
855500 -- (-880.422) (-881.038) (-880.583) [-881.171] * (-882.092) [-881.324] (-887.759) (-881.293) -- 0:00:08
856000 -- (-884.591) [-879.952] (-883.564) (-880.735) * (-880.323) [-881.601] (-882.390) (-880.687) -- 0:00:08
856500 -- (-883.003) (-879.849) [-880.340] (-883.046) * (-882.459) [-881.614] (-883.420) (-884.679) -- 0:00:08
857000 -- (-882.575) (-879.678) [-881.680] (-886.078) * [-880.001] (-882.725) (-880.784) (-884.950) -- 0:00:08
857500 -- (-880.020) (-881.215) (-880.396) [-882.455] * (-880.203) (-881.251) (-879.859) [-880.912] -- 0:00:08
858000 -- (-882.322) (-881.416) [-879.611] (-883.272) * (-882.062) (-880.235) [-880.228] (-884.893) -- 0:00:08
858500 -- (-880.723) (-881.676) [-885.483] (-883.122) * [-880.566] (-884.208) (-886.597) (-885.116) -- 0:00:08
859000 -- (-884.106) (-880.935) [-885.422] (-882.660) * (-879.509) (-882.076) (-881.710) [-880.138] -- 0:00:08
859500 -- (-881.156) (-884.287) [-879.572] (-880.461) * (-880.207) (-880.020) [-881.656] (-880.818) -- 0:00:08
860000 -- (-881.177) (-883.530) (-881.438) [-881.059] * (-881.472) (-882.079) [-883.653] (-880.870) -- 0:00:08
Average standard deviation of split frequencies: 0.008216
860500 -- [-881.210] (-882.214) (-880.814) (-882.976) * (-883.119) (-883.447) (-881.483) [-879.379] -- 0:00:08
861000 -- (-881.198) (-883.158) [-882.012] (-882.199) * [-880.624] (-880.469) (-883.823) (-883.337) -- 0:00:08
861500 -- (-881.869) (-881.926) [-879.436] (-881.410) * (-880.740) [-883.867] (-879.911) (-880.809) -- 0:00:08
862000 -- [-882.589] (-881.174) (-882.144) (-881.494) * [-880.663] (-883.805) (-884.503) (-882.241) -- 0:00:08
862500 -- [-883.013] (-881.113) (-882.136) (-879.661) * (-879.378) (-882.196) [-883.626] (-881.663) -- 0:00:08
863000 -- (-880.873) (-883.492) [-881.024] (-879.646) * (-881.290) [-882.310] (-883.387) (-883.101) -- 0:00:08
863500 -- (-884.403) [-879.713] (-881.172) (-879.644) * (-881.187) (-883.506) [-880.872] (-883.362) -- 0:00:08
864000 -- (-882.231) (-880.949) [-880.810] (-880.080) * (-881.482) (-881.937) (-887.470) [-882.785] -- 0:00:08
864500 -- [-880.334] (-882.139) (-884.162) (-881.081) * (-880.166) (-883.011) (-883.744) [-883.106] -- 0:00:08
865000 -- (-884.200) (-881.568) (-883.146) [-880.412] * [-880.127] (-882.614) (-881.678) (-886.004) -- 0:00:08
Average standard deviation of split frequencies: 0.007766
865500 -- (-880.022) [-880.068] (-881.117) (-884.071) * (-881.878) [-881.751] (-881.471) (-884.150) -- 0:00:08
866000 -- (-880.362) [-882.153] (-880.786) (-881.079) * (-883.820) (-881.299) [-881.562] (-881.275) -- 0:00:08
866500 -- (-880.256) (-880.563) [-883.492] (-884.411) * (-881.466) (-881.132) [-880.772] (-882.920) -- 0:00:08
867000 -- (-880.417) (-882.089) (-881.053) [-881.011] * [-882.302] (-881.665) (-884.123) (-883.559) -- 0:00:08
867500 -- (-883.492) (-882.967) [-883.146] (-880.180) * (-880.208) (-880.641) [-882.066] (-880.671) -- 0:00:08
868000 -- (-885.530) (-882.684) (-879.635) [-880.860] * (-879.620) (-882.706) (-881.564) [-880.866] -- 0:00:08
868500 -- (-881.875) (-880.355) [-880.497] (-881.867) * (-880.958) (-884.955) [-889.201] (-880.902) -- 0:00:08
869000 -- (-882.250) [-883.555] (-880.629) (-880.994) * (-881.068) (-882.873) (-882.975) [-882.159] -- 0:00:07
869500 -- (-881.270) (-881.732) (-882.449) [-882.563] * (-880.074) [-883.790] (-881.092) (-884.132) -- 0:00:07
870000 -- (-883.717) [-881.752] (-883.723) (-884.741) * (-879.754) (-881.886) (-880.217) [-880.091] -- 0:00:07
Average standard deviation of split frequencies: 0.007905
870500 -- (-882.714) (-880.272) (-881.891) [-879.845] * (-880.238) [-884.372] (-880.544) (-881.749) -- 0:00:07
871000 -- (-880.174) (-880.893) [-886.629] (-880.298) * (-880.393) [-880.347] (-880.127) (-884.923) -- 0:00:07
871500 -- (-883.219) (-882.035) [-881.324] (-881.217) * (-883.303) (-883.999) [-883.194] (-882.138) -- 0:00:07
872000 -- (-882.528) (-883.222) (-881.877) [-880.930] * (-881.307) (-882.202) (-882.029) [-883.251] -- 0:00:07
872500 -- [-881.572] (-881.499) (-881.035) (-881.010) * (-881.508) [-880.541] (-880.742) (-879.715) -- 0:00:07
873000 -- (-885.400) (-881.311) (-882.009) [-880.235] * (-884.463) (-880.726) [-883.246] (-883.823) -- 0:00:07
873500 -- [-883.072] (-886.999) (-883.159) (-883.285) * (-883.534) (-881.294) [-884.014] (-881.930) -- 0:00:07
874000 -- (-884.970) (-887.144) [-884.467] (-887.053) * (-882.877) [-880.219] (-879.478) (-881.103) -- 0:00:07
874500 -- [-881.588] (-882.203) (-881.315) (-883.353) * (-880.999) (-880.700) [-880.782] (-881.158) -- 0:00:07
875000 -- (-881.221) (-882.819) [-881.597] (-881.674) * (-880.292) [-881.311] (-882.947) (-880.832) -- 0:00:07
Average standard deviation of split frequencies: 0.008072
875500 -- (-881.737) [-885.520] (-879.966) (-884.563) * (-882.140) [-880.108] (-881.153) (-887.106) -- 0:00:07
876000 -- (-881.263) [-881.871] (-879.888) (-881.229) * [-880.122] (-880.634) (-882.048) (-881.551) -- 0:00:07
876500 -- [-882.191] (-882.989) (-882.492) (-882.886) * (-882.089) (-881.792) (-883.789) [-887.147] -- 0:00:07
877000 -- [-881.417] (-883.178) (-883.400) (-881.223) * [-881.264] (-883.322) (-886.251) (-882.660) -- 0:00:07
877500 -- (-880.746) [-879.888] (-880.174) (-880.423) * (-880.059) (-882.455) [-881.594] (-879.865) -- 0:00:07
878000 -- (-881.783) (-879.765) (-879.584) [-881.261] * (-880.517) (-884.310) [-880.039] (-884.050) -- 0:00:07
878500 -- (-885.224) (-881.302) (-881.018) [-884.415] * (-879.628) (-882.248) [-881.206] (-881.444) -- 0:00:07
879000 -- (-882.730) [-881.293] (-883.440) (-882.493) * [-879.470] (-882.057) (-882.067) (-880.786) -- 0:00:07
879500 -- (-881.595) [-880.869] (-881.582) (-884.363) * [-882.688] (-879.787) (-882.875) (-879.921) -- 0:00:07
880000 -- (-882.939) (-880.770) [-880.489] (-880.441) * (-880.467) [-882.992] (-881.005) (-883.097) -- 0:00:07
Average standard deviation of split frequencies: 0.007672
880500 -- (-881.872) (-882.098) (-880.304) [-882.492] * [-882.460] (-882.881) (-882.330) (-884.069) -- 0:00:07
881000 -- (-883.447) (-882.896) [-880.961] (-881.108) * (-882.393) (-886.383) (-885.518) [-879.806] -- 0:00:07
881500 -- (-885.472) [-881.595] (-883.319) (-882.742) * (-882.810) (-884.792) [-879.934] (-880.693) -- 0:00:07
882000 -- (-883.675) (-882.542) [-882.801] (-881.799) * [-882.034] (-887.595) (-881.701) (-881.458) -- 0:00:07
882500 -- (-882.083) [-882.728] (-883.096) (-880.135) * [-879.931] (-883.989) (-881.442) (-880.681) -- 0:00:07
883000 -- (-881.577) [-881.635] (-881.762) (-882.006) * (-880.860) (-880.321) [-881.058] (-879.943) -- 0:00:07
883500 -- (-882.450) [-881.162] (-879.411) (-884.854) * [-881.392] (-880.490) (-880.112) (-880.464) -- 0:00:07
884000 -- (-884.322) (-882.552) (-881.610) [-884.973] * (-880.499) [-881.326] (-885.747) (-882.015) -- 0:00:07
884500 -- (-880.671) [-881.753] (-882.297) (-881.655) * (-879.682) [-882.989] (-888.649) (-883.115) -- 0:00:07
885000 -- (-883.291) (-882.557) (-882.495) [-883.493] * (-879.478) (-881.690) [-883.272] (-880.585) -- 0:00:07
Average standard deviation of split frequencies: 0.007449
885500 -- (-885.620) (-881.697) [-885.496] (-883.493) * (-883.689) [-880.016] (-881.676) (-881.595) -- 0:00:06
886000 -- (-880.233) (-879.936) (-880.155) [-883.380] * (-881.352) (-880.750) [-882.081] (-883.187) -- 0:00:06
886500 -- (-881.374) [-880.576] (-884.734) (-881.046) * [-883.776] (-884.358) (-882.030) (-881.885) -- 0:00:06
887000 -- [-880.185] (-883.155) (-880.319) (-881.063) * (-880.181) (-879.873) [-879.998] (-883.379) -- 0:00:06
887500 -- [-883.367] (-885.422) (-881.738) (-881.583) * [-883.369] (-880.260) (-883.400) (-882.718) -- 0:00:06
888000 -- [-881.306] (-885.145) (-885.113) (-882.348) * (-880.951) (-883.328) (-883.601) [-883.534] -- 0:00:06
888500 -- (-880.008) [-881.500] (-882.898) (-884.249) * [-882.705] (-882.040) (-883.718) (-882.233) -- 0:00:06
889000 -- (-882.583) [-880.828] (-884.416) (-884.708) * (-881.269) [-881.483] (-879.986) (-881.293) -- 0:00:06
889500 -- (-882.747) (-880.387) (-884.825) [-880.969] * (-880.969) [-881.498] (-881.735) (-882.120) -- 0:00:06
890000 -- (-882.065) (-881.406) [-883.383] (-880.764) * (-879.974) [-885.656] (-884.482) (-880.706) -- 0:00:06
Average standard deviation of split frequencies: 0.007657
890500 -- (-883.327) [-881.850] (-882.966) (-881.598) * (-880.097) (-880.655) (-882.819) [-881.089] -- 0:00:06
891000 -- (-883.632) (-881.729) [-879.868] (-881.572) * (-880.092) (-881.238) [-880.818] (-884.332) -- 0:00:06
891500 -- (-885.319) (-880.769) [-881.401] (-882.303) * (-883.138) (-881.242) [-880.014] (-888.191) -- 0:00:06
892000 -- (-882.993) (-882.320) [-882.664] (-880.947) * [-882.135] (-882.039) (-881.423) (-884.587) -- 0:00:06
892500 -- (-882.320) [-880.018] (-881.028) (-881.258) * (-884.739) [-881.275] (-885.882) (-882.668) -- 0:00:06
893000 -- (-881.200) (-883.066) [-880.991] (-884.060) * (-884.469) (-883.720) (-881.828) [-880.496] -- 0:00:06
893500 -- (-883.353) [-881.711] (-881.681) (-885.397) * (-884.204) (-882.281) (-883.505) [-882.178] -- 0:00:06
894000 -- (-881.789) [-881.657] (-883.339) (-881.848) * (-884.433) (-882.202) (-882.636) [-884.148] -- 0:00:06
894500 -- (-881.967) (-881.455) (-885.357) [-881.295] * (-882.901) (-881.593) [-879.806] (-882.445) -- 0:00:06
895000 -- (-880.683) (-879.704) [-880.529] (-883.822) * (-881.791) [-881.569] (-880.248) (-881.309) -- 0:00:06
Average standard deviation of split frequencies: 0.007366
895500 -- (-882.907) [-881.713] (-882.589) (-881.739) * [-883.967] (-881.166) (-881.356) (-881.621) -- 0:00:06
896000 -- (-882.828) (-881.794) (-888.055) [-880.632] * (-882.025) (-881.252) [-880.905] (-881.268) -- 0:00:06
896500 -- (-881.700) (-879.566) [-881.809] (-882.360) * (-880.959) (-881.597) (-882.135) [-881.954] -- 0:00:06
897000 -- (-883.714) (-879.834) [-880.300] (-882.932) * (-880.400) (-884.053) (-891.800) [-881.778] -- 0:00:06
897500 -- [-883.103] (-879.362) (-879.398) (-884.889) * (-879.980) (-882.922) [-880.858] (-884.060) -- 0:00:06
898000 -- [-880.959] (-879.793) (-879.426) (-883.602) * [-881.802] (-880.447) (-879.937) (-880.907) -- 0:00:06
898500 -- (-882.405) [-880.108] (-879.350) (-882.583) * (-880.660) (-882.287) [-880.992] (-882.544) -- 0:00:06
899000 -- (-880.872) (-881.775) [-879.281] (-882.762) * [-883.629] (-879.635) (-879.371) (-884.164) -- 0:00:06
899500 -- [-880.150] (-879.484) (-879.726) (-883.712) * (-884.277) (-883.134) [-879.760] (-882.416) -- 0:00:06
900000 -- (-880.004) (-879.506) (-880.659) [-883.629] * (-881.531) (-881.199) [-879.963] (-880.847) -- 0:00:06
Average standard deviation of split frequencies: 0.007502
900500 -- (-880.413) [-884.785] (-882.620) (-886.426) * (-884.424) (-881.784) (-887.223) [-882.569] -- 0:00:06
901000 -- (-880.940) [-881.912] (-883.285) (-881.372) * (-882.712) (-882.255) (-881.604) [-882.370] -- 0:00:06
901500 -- (-881.156) (-881.155) [-881.784] (-883.191) * (-883.083) (-881.447) [-881.516] (-882.011) -- 0:00:06
902000 -- (-880.481) (-881.272) (-882.856) [-881.544] * [-883.397] (-881.177) (-881.349) (-888.923) -- 0:00:05
902500 -- [-879.474] (-880.766) (-881.798) (-884.919) * [-884.972] (-880.064) (-880.881) (-882.053) -- 0:00:05
903000 -- (-885.965) (-882.408) (-887.408) [-882.881] * (-882.582) (-881.274) (-882.866) [-883.655] -- 0:00:05
903500 -- (-882.034) (-879.536) (-881.490) [-880.585] * (-879.855) (-882.049) (-880.697) [-879.414] -- 0:00:05
904000 -- (-880.419) (-882.829) [-882.595] (-883.951) * (-882.875) (-881.425) (-881.669) [-882.785] -- 0:00:05
904500 -- (-882.052) [-880.812] (-881.260) (-882.010) * (-881.834) (-883.975) (-880.693) [-883.076] -- 0:00:05
905000 -- (-882.919) (-881.664) [-881.080] (-882.055) * (-880.629) (-886.964) [-883.786] (-880.876) -- 0:00:05
Average standard deviation of split frequencies: 0.007631
905500 -- (-880.524) [-880.979] (-881.150) (-881.507) * (-881.506) (-886.148) (-880.743) [-880.555] -- 0:00:05
906000 -- (-879.612) [-882.053] (-882.783) (-880.930) * (-880.544) [-888.272] (-883.399) (-883.890) -- 0:00:05
906500 -- (-880.842) (-880.370) (-882.100) [-881.809] * (-880.247) (-883.799) (-880.710) [-879.134] -- 0:00:05
907000 -- (-880.775) (-879.759) (-881.504) [-879.447] * (-882.154) [-880.317] (-881.601) (-881.155) -- 0:00:05
907500 -- [-881.996] (-879.901) (-880.633) (-879.775) * (-884.444) (-882.177) (-882.787) [-879.662] -- 0:00:05
908000 -- (-881.430) (-881.397) [-881.824] (-880.005) * (-881.591) [-881.650] (-881.604) (-880.703) -- 0:00:05
908500 -- (-880.450) (-882.313) (-885.666) [-880.061] * [-880.229] (-884.360) (-882.149) (-883.141) -- 0:00:05
909000 -- (-884.311) [-879.949] (-884.137) (-880.285) * (-881.524) [-884.308] (-880.031) (-880.193) -- 0:00:05
909500 -- (-881.399) (-880.625) (-882.795) [-882.546] * (-881.497) (-882.425) (-880.203) [-884.001] -- 0:00:05
910000 -- (-881.222) (-881.338) (-884.073) [-881.684] * (-881.951) (-881.519) (-880.332) [-881.832] -- 0:00:05
Average standard deviation of split frequencies: 0.007351
910500 -- (-880.879) (-881.604) [-882.908] (-882.187) * (-880.674) (-880.396) [-879.789] (-883.772) -- 0:00:05
911000 -- [-882.591] (-884.525) (-880.414) (-881.014) * [-880.546] (-880.546) (-881.267) (-885.538) -- 0:00:05
911500 -- (-880.476) (-880.990) [-884.418] (-881.635) * [-880.552] (-882.449) (-887.137) (-882.374) -- 0:00:05
912000 -- (-881.462) (-881.906) (-895.361) [-880.175] * (-881.572) (-881.827) [-882.970] (-883.814) -- 0:00:05
912500 -- (-882.713) (-879.949) (-881.205) [-880.610] * (-884.986) [-880.703] (-880.326) (-881.343) -- 0:00:05
913000 -- (-882.013) [-880.118] (-881.078) (-880.212) * (-880.262) [-880.824] (-881.557) (-882.341) -- 0:00:05
913500 -- (-881.326) (-883.127) (-879.972) [-882.049] * (-882.014) (-887.430) [-884.054] (-881.534) -- 0:00:05
914000 -- [-881.951] (-881.741) (-882.160) (-881.948) * (-881.461) [-883.864] (-883.548) (-881.531) -- 0:00:05
914500 -- (-883.920) (-883.444) (-880.784) [-881.405] * [-881.186] (-891.284) (-880.517) (-881.745) -- 0:00:05
915000 -- (-880.526) (-880.631) [-881.355] (-883.626) * (-880.649) (-889.964) [-881.771] (-881.204) -- 0:00:05
Average standard deviation of split frequencies: 0.007445
915500 -- [-879.372] (-880.587) (-880.584) (-882.253) * (-883.368) (-890.099) (-883.850) [-880.162] -- 0:00:05
916000 -- (-879.372) (-880.189) [-880.194] (-881.452) * (-883.628) [-880.021] (-881.887) (-881.680) -- 0:00:05
916500 -- (-883.007) [-884.498] (-880.554) (-882.744) * [-879.768] (-884.380) (-883.072) (-880.359) -- 0:00:05
917000 -- (-880.207) [-883.749] (-879.232) (-884.177) * (-882.291) (-881.009) [-880.937] (-882.118) -- 0:00:05
917500 -- (-881.184) [-880.166] (-879.770) (-880.246) * (-881.033) [-882.950] (-880.724) (-882.698) -- 0:00:05
918000 -- (-882.576) (-880.676) [-880.868] (-882.618) * (-885.284) (-888.127) [-880.688] (-880.858) -- 0:00:05
918500 -- (-881.619) (-885.304) (-883.107) [-881.482] * (-886.466) (-880.881) [-881.441] (-881.165) -- 0:00:04
919000 -- (-879.966) (-884.039) (-880.687) [-884.028] * [-883.090] (-882.572) (-884.453) (-881.257) -- 0:00:04
919500 -- [-880.690] (-881.054) (-882.058) (-881.315) * (-883.454) [-883.706] (-886.274) (-882.801) -- 0:00:04
920000 -- (-880.143) [-880.472] (-880.275) (-880.929) * (-881.775) (-881.235) [-884.039] (-879.942) -- 0:00:04
Average standard deviation of split frequencies: 0.007817
920500 -- [-880.599] (-879.397) (-879.801) (-881.380) * (-882.486) (-880.574) [-880.682] (-880.419) -- 0:00:04
921000 -- (-880.736) (-879.656) (-881.034) [-880.122] * (-883.870) [-881.576] (-884.205) (-880.466) -- 0:00:04
921500 -- (-880.465) (-880.181) [-881.247] (-884.116) * [-880.420] (-880.741) (-882.208) (-880.335) -- 0:00:04
922000 -- (-880.666) [-881.004] (-885.648) (-882.673) * [-879.577] (-882.714) (-880.899) (-880.135) -- 0:00:04
922500 -- (-881.874) (-882.552) (-883.438) [-881.718] * (-879.324) (-881.268) (-883.512) [-880.569] -- 0:00:04
923000 -- (-881.293) (-880.880) [-882.599] (-887.214) * (-880.489) [-880.936] (-881.102) (-881.568) -- 0:00:04
923500 -- (-882.547) [-880.165] (-883.386) (-882.556) * (-880.135) [-883.269] (-882.136) (-880.768) -- 0:00:04
924000 -- (-882.187) (-882.976) (-882.410) [-882.035] * [-879.115] (-880.026) (-880.509) (-881.182) -- 0:00:04
924500 -- (-885.127) (-882.425) [-882.290] (-883.153) * (-880.577) (-881.497) [-881.663] (-880.559) -- 0:00:04
925000 -- [-880.377] (-881.165) (-881.968) (-883.677) * (-882.973) [-880.480] (-882.410) (-881.396) -- 0:00:04
Average standard deviation of split frequencies: 0.007636
925500 -- (-880.824) (-882.438) (-881.643) [-882.472] * [-882.711] (-882.018) (-884.482) (-881.565) -- 0:00:04
926000 -- (-881.467) (-883.946) [-881.907] (-881.161) * (-880.094) (-880.546) [-883.962] (-880.799) -- 0:00:04
926500 -- (-881.891) (-879.909) [-880.065] (-880.374) * [-880.629] (-879.986) (-888.622) (-882.125) -- 0:00:04
927000 -- (-883.391) [-880.536] (-883.269) (-881.820) * (-880.871) (-880.278) [-885.878] (-886.834) -- 0:00:04
927500 -- [-882.428] (-880.593) (-882.665) (-879.618) * (-883.288) [-881.940] (-885.456) (-880.034) -- 0:00:04
928000 -- [-880.041] (-879.949) (-880.399) (-881.821) * [-883.201] (-881.105) (-886.311) (-879.785) -- 0:00:04
928500 -- [-884.093] (-880.808) (-880.764) (-880.347) * [-881.315] (-881.729) (-881.124) (-883.674) -- 0:00:04
929000 -- (-880.974) (-879.952) (-880.489) [-881.719] * (-879.923) (-883.215) [-881.555] (-879.281) -- 0:00:04
929500 -- [-882.524] (-881.373) (-881.257) (-880.321) * (-882.816) [-880.684] (-886.064) (-880.794) -- 0:00:04
930000 -- (-881.716) (-883.469) (-881.127) [-882.902] * (-879.516) (-879.332) [-882.290] (-882.281) -- 0:00:04
Average standard deviation of split frequencies: 0.007868
930500 -- (-881.317) [-881.842] (-880.395) (-888.063) * (-879.245) (-885.523) (-884.327) [-881.570] -- 0:00:04
931000 -- (-883.020) (-882.446) [-879.937] (-887.154) * (-880.729) (-881.577) (-881.838) [-879.989] -- 0:00:04
931500 -- (-884.281) (-880.552) [-880.184] (-882.867) * (-882.713) [-881.709] (-879.359) (-881.172) -- 0:00:04
932000 -- (-886.601) (-880.899) [-880.188] (-881.987) * (-883.601) [-880.574] (-879.351) (-882.550) -- 0:00:04
932500 -- [-880.522] (-881.308) (-884.234) (-883.167) * (-882.662) [-884.952] (-882.024) (-883.174) -- 0:00:04
933000 -- (-881.529) (-880.166) (-884.251) [-881.444] * (-880.937) [-880.228] (-884.379) (-879.571) -- 0:00:04
933500 -- (-880.951) (-879.233) [-880.302] (-883.203) * (-880.422) [-880.261] (-882.588) (-883.003) -- 0:00:04
934000 -- (-884.685) (-881.433) [-885.081] (-885.433) * [-881.514] (-879.569) (-880.482) (-880.370) -- 0:00:04
934500 -- (-881.497) (-881.440) [-883.153] (-884.578) * (-881.160) (-881.174) (-889.578) [-881.329] -- 0:00:03
935000 -- (-880.214) (-880.028) (-885.351) [-880.624] * [-880.080] (-880.408) (-884.934) (-881.320) -- 0:00:03
Average standard deviation of split frequencies: 0.007722
935500 -- (-881.626) (-882.346) (-882.804) [-880.655] * [-880.989] (-881.841) (-882.762) (-883.152) -- 0:00:03
936000 -- [-884.619] (-882.370) (-880.234) (-881.860) * (-882.309) [-882.083] (-883.248) (-879.967) -- 0:00:03
936500 -- (-883.821) (-881.829) [-880.331] (-881.364) * (-881.769) (-882.235) (-880.882) [-883.472] -- 0:00:03
937000 -- (-881.143) (-880.407) (-881.643) [-880.915] * (-880.809) (-883.183) (-880.907) [-880.459] -- 0:00:03
937500 -- [-880.496] (-880.965) (-883.657) (-880.535) * (-880.958) [-887.171] (-880.678) (-880.389) -- 0:00:03
938000 -- (-880.964) (-885.086) (-883.849) [-880.308] * [-880.423] (-881.406) (-884.761) (-881.977) -- 0:00:03
938500 -- (-881.661) (-883.285) (-882.607) [-882.551] * (-879.535) [-880.001] (-880.723) (-880.939) -- 0:00:03
939000 -- (-885.221) (-881.998) [-881.754] (-880.572) * (-880.383) (-883.896) (-881.258) [-881.942] -- 0:00:03
939500 -- (-883.640) (-891.808) [-884.429] (-881.110) * (-880.444) (-885.765) [-883.555] (-879.940) -- 0:00:03
940000 -- [-879.481] (-881.288) (-886.405) (-880.649) * (-880.244) (-881.038) [-881.840] (-879.972) -- 0:00:03
Average standard deviation of split frequencies: 0.007651
940500 -- (-879.549) (-880.245) (-882.905) [-882.482] * (-881.069) (-882.331) (-881.944) [-879.755] -- 0:00:03
941000 -- [-881.862] (-879.727) (-886.029) (-880.726) * (-880.954) (-881.097) [-882.249] (-880.236) -- 0:00:03
941500 -- (-880.543) [-880.327] (-880.301) (-880.410) * (-880.589) (-886.226) [-881.053] (-882.439) -- 0:00:03
942000 -- [-881.502] (-883.301) (-880.757) (-880.824) * [-881.277] (-883.204) (-886.153) (-883.044) -- 0:00:03
942500 -- [-881.400] (-880.879) (-879.199) (-883.765) * (-883.359) (-879.757) (-884.473) [-880.031] -- 0:00:03
943000 -- (-880.491) (-882.651) [-882.187] (-881.951) * [-879.863] (-880.332) (-881.204) (-882.344) -- 0:00:03
943500 -- (-880.913) [-881.992] (-881.360) (-883.237) * (-880.151) [-881.624] (-885.896) (-881.156) -- 0:00:03
944000 -- (-881.068) (-881.525) (-881.845) [-881.052] * (-882.201) [-880.603] (-882.283) (-881.753) -- 0:00:03
944500 -- [-879.771] (-879.740) (-882.250) (-880.320) * [-881.434] (-881.344) (-882.176) (-880.686) -- 0:00:03
945000 -- (-879.911) (-881.027) (-881.712) [-879.799] * (-881.273) (-883.446) (-880.419) [-883.056] -- 0:00:03
Average standard deviation of split frequencies: 0.006976
945500 -- (-882.992) (-880.002) (-880.890) [-880.878] * (-882.538) (-880.331) (-881.200) [-882.243] -- 0:00:03
946000 -- (-882.070) (-881.916) [-882.995] (-881.074) * (-880.841) (-883.721) [-880.670] (-881.885) -- 0:00:03
946500 -- (-881.990) (-884.914) (-884.652) [-879.541] * [-882.011] (-885.586) (-880.428) (-883.996) -- 0:00:03
947000 -- (-880.908) (-881.668) (-882.358) [-879.987] * (-880.841) (-882.521) [-882.496] (-884.144) -- 0:00:03
947500 -- (-881.374) (-879.973) (-887.141) [-880.092] * (-881.177) (-883.486) (-882.535) [-882.240] -- 0:00:03
948000 -- (-882.391) (-879.903) [-883.591] (-881.303) * [-883.206] (-881.682) (-881.872) (-881.419) -- 0:00:03
948500 -- [-880.767] (-880.575) (-880.983) (-879.465) * (-879.530) [-880.845] (-882.246) (-881.979) -- 0:00:03
949000 -- (-882.798) [-880.468] (-881.633) (-885.006) * (-880.142) (-880.001) [-883.148] (-884.502) -- 0:00:03
949500 -- (-881.781) [-883.265] (-882.482) (-880.423) * (-880.221) (-881.197) [-883.246] (-880.049) -- 0:00:03
950000 -- (-879.540) (-881.104) [-882.804] (-883.228) * (-881.112) (-880.596) [-881.331] (-882.658) -- 0:00:03
Average standard deviation of split frequencies: 0.006215
950500 -- (-881.466) (-881.912) [-879.690] (-880.780) * (-884.030) (-881.465) [-880.061] (-880.467) -- 0:00:03
951000 -- (-882.366) [-880.412] (-879.804) (-880.414) * (-881.262) (-885.491) [-881.665] (-879.808) -- 0:00:02
951500 -- (-880.723) (-884.355) [-881.844] (-879.698) * [-880.651] (-885.437) (-889.912) (-881.768) -- 0:00:02
952000 -- [-881.097] (-880.142) (-880.568) (-879.857) * (-881.510) (-882.524) (-882.987) [-884.946] -- 0:00:02
952500 -- (-881.636) [-880.423] (-882.955) (-882.224) * (-883.712) (-880.343) (-882.099) [-882.883] -- 0:00:02
953000 -- (-883.627) [-881.216] (-885.258) (-882.685) * (-882.313) (-882.362) (-882.220) [-881.729] -- 0:00:02
953500 -- (-881.302) (-886.296) [-881.967] (-886.403) * [-881.477] (-883.021) (-881.918) (-880.328) -- 0:00:02
954000 -- (-880.553) [-882.439] (-880.299) (-881.376) * (-882.671) [-882.059] (-880.855) (-883.994) -- 0:00:02
954500 -- (-879.413) (-881.030) [-879.572] (-882.641) * (-880.282) (-882.016) [-881.386] (-882.991) -- 0:00:02
955000 -- (-879.608) [-881.533] (-879.622) (-881.517) * (-879.756) (-883.285) (-881.946) [-879.915] -- 0:00:02
Average standard deviation of split frequencies: 0.006016
955500 -- (-879.709) [-883.721] (-879.667) (-881.214) * (-882.481) (-883.235) (-880.789) [-879.594] -- 0:00:02
956000 -- (-880.517) [-883.727] (-882.408) (-882.323) * (-879.686) (-888.199) [-880.858] (-879.594) -- 0:00:02
956500 -- [-880.652] (-882.548) (-881.348) (-880.560) * (-882.063) (-881.638) [-880.556] (-883.325) -- 0:00:02
957000 -- [-881.037] (-884.210) (-880.152) (-880.369) * [-881.175] (-881.401) (-881.178) (-882.479) -- 0:00:02
957500 -- (-885.664) [-884.339] (-884.783) (-880.623) * [-879.455] (-883.066) (-883.417) (-885.363) -- 0:00:02
958000 -- [-880.880] (-881.426) (-879.706) (-880.231) * (-881.960) [-880.778] (-882.720) (-880.250) -- 0:00:02
958500 -- (-887.039) [-881.342] (-879.592) (-882.256) * [-882.251] (-887.126) (-885.300) (-879.699) -- 0:00:02
959000 -- (-882.141) (-883.785) (-880.975) [-881.276] * (-881.864) (-881.426) (-883.079) [-881.091] -- 0:00:02
959500 -- (-880.547) [-880.986] (-882.266) (-880.830) * (-881.252) (-881.611) (-881.406) [-884.253] -- 0:00:02
960000 -- [-880.727] (-879.629) (-882.453) (-881.224) * [-879.939] (-880.317) (-884.262) (-889.686) -- 0:00:02
Average standard deviation of split frequencies: 0.005758
960500 -- (-881.729) (-879.561) (-882.097) [-881.621] * (-880.874) [-882.708] (-886.127) (-883.876) -- 0:00:02
961000 -- (-883.975) (-882.660) [-883.524] (-883.005) * (-880.344) [-882.838] (-881.303) (-882.582) -- 0:00:02
961500 -- (-880.218) (-881.527) [-881.773] (-882.546) * (-882.252) [-883.311] (-880.659) (-880.851) -- 0:00:02
962000 -- [-879.125] (-881.295) (-880.599) (-884.073) * (-881.218) (-883.533) (-881.208) [-880.664] -- 0:00:02
962500 -- (-885.382) (-879.960) (-880.320) [-881.255] * (-881.476) (-881.956) [-880.848] (-882.139) -- 0:00:02
963000 -- (-887.008) (-879.680) (-880.677) [-880.927] * (-882.687) [-882.110] (-881.392) (-881.830) -- 0:00:02
963500 -- (-880.307) [-881.342] (-880.166) (-879.675) * (-880.477) (-881.991) [-880.707] (-880.107) -- 0:00:02
964000 -- [-881.401] (-880.014) (-883.843) (-879.590) * (-882.325) [-882.586] (-880.859) (-881.641) -- 0:00:02
964500 -- (-882.946) [-883.771] (-884.322) (-880.016) * (-880.526) (-881.546) [-880.928] (-880.244) -- 0:00:02
965000 -- (-881.233) [-880.073] (-882.440) (-885.274) * (-880.870) (-882.039) [-880.478] (-879.591) -- 0:00:02
Average standard deviation of split frequencies: 0.005856
965500 -- (-881.597) [-882.290] (-882.117) (-884.691) * (-880.951) (-881.616) [-883.001] (-880.092) -- 0:00:02
966000 -- [-884.667] (-881.325) (-881.914) (-881.862) * (-882.520) [-883.065] (-885.703) (-881.578) -- 0:00:02
966500 -- (-881.205) [-882.459] (-883.963) (-882.859) * (-881.396) [-879.379] (-880.926) (-880.344) -- 0:00:02
967000 -- (-882.118) (-881.498) (-880.641) [-880.273] * (-883.509) (-881.819) (-887.887) [-881.054] -- 0:00:02
967500 -- [-879.797] (-883.027) (-879.915) (-884.113) * (-879.714) [-884.887] (-882.202) (-881.077) -- 0:00:01
968000 -- (-880.797) (-879.491) (-879.704) [-882.057] * (-880.948) (-884.657) [-880.902] (-880.995) -- 0:00:01
968500 -- (-882.213) (-880.116) (-882.833) [-881.442] * (-880.030) (-881.678) (-881.713) [-883.783] -- 0:00:01
969000 -- (-879.911) (-881.468) [-882.921] (-882.229) * (-881.483) [-880.607] (-882.104) (-884.743) -- 0:00:01
969500 -- (-882.020) [-880.989] (-879.829) (-882.152) * [-887.138] (-883.526) (-881.713) (-881.866) -- 0:00:01
970000 -- [-881.010] (-881.340) (-881.153) (-883.267) * (-882.380) (-881.876) [-882.176] (-880.664) -- 0:00:01
Average standard deviation of split frequencies: 0.005375
970500 -- [-880.664] (-881.444) (-880.450) (-883.857) * (-882.632) (-883.417) (-880.097) [-882.521] -- 0:00:01
971000 -- (-885.883) (-880.097) [-882.421] (-883.988) * [-881.170] (-880.122) (-880.948) (-884.550) -- 0:00:01
971500 -- (-887.125) (-881.061) [-882.271] (-883.685) * [-882.277] (-882.402) (-882.260) (-890.342) -- 0:00:01
972000 -- (-887.228) [-880.667] (-881.485) (-881.687) * (-882.081) (-882.085) [-881.348] (-882.626) -- 0:00:01
972500 -- (-884.876) (-881.669) [-879.264] (-880.842) * [-880.652] (-880.229) (-881.007) (-883.667) -- 0:00:01
973000 -- (-885.894) (-880.670) [-879.504] (-881.458) * (-883.587) [-881.352] (-881.923) (-881.085) -- 0:00:01
973500 -- [-880.242] (-881.678) (-882.262) (-883.170) * (-882.683) [-879.464] (-885.006) (-880.129) -- 0:00:01
974000 -- (-879.800) [-880.484] (-885.890) (-882.158) * (-883.614) (-887.216) [-881.746] (-885.116) -- 0:00:01
974500 -- (-884.424) (-882.694) (-881.455) [-883.284] * [-883.578] (-881.478) (-880.764) (-879.753) -- 0:00:01
975000 -- [-881.371] (-881.059) (-885.723) (-882.819) * [-882.756] (-880.338) (-882.304) (-883.882) -- 0:00:01
Average standard deviation of split frequencies: 0.005249
975500 -- (-880.768) [-879.491] (-879.606) (-880.747) * (-882.143) (-881.390) (-883.616) [-883.774] -- 0:00:01
976000 -- (-880.980) (-882.041) [-880.312] (-880.936) * [-880.088] (-882.700) (-882.214) (-881.953) -- 0:00:01
976500 -- [-881.308] (-880.837) (-881.022) (-880.132) * (-882.612) (-884.159) (-881.975) [-880.708] -- 0:00:01
977000 -- (-883.522) [-880.024] (-879.952) (-882.296) * [-881.101] (-879.675) (-884.526) (-883.616) -- 0:00:01
977500 -- [-880.477] (-881.080) (-884.052) (-882.801) * [-880.404] (-879.607) (-880.012) (-884.839) -- 0:00:01
978000 -- (-886.085) [-881.972] (-885.223) (-881.725) * (-880.124) (-884.312) (-880.728) [-881.532] -- 0:00:01
978500 -- (-879.991) (-884.488) (-880.236) [-883.559] * (-881.141) [-885.826] (-884.099) (-880.364) -- 0:00:01
979000 -- [-879.812] (-880.621) (-883.297) (-884.134) * (-881.367) (-882.996) [-881.650] (-882.682) -- 0:00:01
979500 -- (-881.120) [-881.775] (-886.841) (-881.503) * [-879.860] (-882.744) (-881.825) (-883.182) -- 0:00:01
980000 -- [-882.346] (-885.778) (-880.414) (-880.214) * (-879.820) (-886.023) (-882.743) [-880.401] -- 0:00:01
Average standard deviation of split frequencies: 0.005416
980500 -- [-881.103] (-881.259) (-881.131) (-884.954) * (-880.006) (-887.777) (-882.773) [-880.572] -- 0:00:01
981000 -- (-884.175) [-880.467] (-882.139) (-881.807) * (-882.122) (-881.824) [-882.573] (-879.944) -- 0:00:01
981500 -- (-885.914) (-881.011) [-883.204] (-882.507) * [-881.100] (-880.826) (-879.774) (-880.362) -- 0:00:01
982000 -- (-881.131) [-879.691] (-885.023) (-879.662) * [-888.097] (-880.686) (-882.060) (-879.781) -- 0:00:01
982500 -- [-881.156] (-883.205) (-887.023) (-881.650) * (-882.660) (-882.785) [-883.303] (-883.966) -- 0:00:01
983000 -- [-880.061] (-881.052) (-881.881) (-881.935) * (-880.165) (-882.293) (-882.479) [-880.808] -- 0:00:01
983500 -- (-880.377) [-881.167] (-880.377) (-889.738) * [-882.675] (-881.388) (-884.309) (-880.437) -- 0:00:01
984000 -- [-879.859] (-879.968) (-880.927) (-882.201) * (-882.213) (-881.907) (-883.997) [-882.503] -- 0:00:00
984500 -- (-883.734) (-880.059) [-879.528] (-884.126) * (-879.202) [-881.170] (-881.415) (-883.099) -- 0:00:00
985000 -- (-881.737) [-884.014] (-882.300) (-881.851) * (-879.226) [-881.017] (-880.467) (-884.961) -- 0:00:00
Average standard deviation of split frequencies: 0.005036
985500 -- [-882.339] (-881.512) (-883.558) (-882.804) * [-882.440] (-882.439) (-882.404) (-885.445) -- 0:00:00
986000 -- [-881.621] (-885.421) (-885.780) (-884.250) * (-880.796) [-880.780] (-882.209) (-883.866) -- 0:00:00
986500 -- [-883.228] (-881.070) (-883.848) (-881.254) * (-879.847) [-881.923] (-880.810) (-880.999) -- 0:00:00
987000 -- (-880.788) (-880.389) [-881.273] (-889.331) * [-882.689] (-882.537) (-880.534) (-881.480) -- 0:00:00
987500 -- (-881.157) (-879.473) [-880.203] (-884.204) * (-881.200) (-884.426) (-880.730) [-881.995] -- 0:00:00
988000 -- (-881.484) [-883.262] (-879.364) (-882.839) * (-879.460) [-881.877] (-881.269) (-882.182) -- 0:00:00
988500 -- [-885.053] (-881.380) (-881.527) (-881.637) * [-882.996] (-884.081) (-879.905) (-880.777) -- 0:00:00
989000 -- [-881.064] (-885.390) (-880.089) (-880.901) * (-879.884) (-880.934) (-882.975) [-882.538] -- 0:00:00
989500 -- (-881.066) (-885.278) (-883.355) [-884.619] * (-884.955) (-879.719) (-879.888) [-879.729] -- 0:00:00
990000 -- (-880.901) (-882.347) [-880.033] (-881.921) * [-884.182] (-879.693) (-880.232) (-880.276) -- 0:00:00
Average standard deviation of split frequencies: 0.004917
990500 -- (-881.605) (-883.656) [-881.043] (-880.269) * (-881.942) (-880.421) (-881.367) [-880.102] -- 0:00:00
991000 -- (-881.281) [-880.290] (-882.495) (-880.178) * (-886.141) (-880.282) [-884.142] (-881.725) -- 0:00:00
991500 -- [-882.474] (-881.791) (-883.419) (-883.403) * (-882.454) (-883.461) (-883.590) [-881.230] -- 0:00:00
992000 -- (-880.961) (-881.959) [-881.836] (-884.201) * [-882.280] (-882.049) (-879.989) (-880.337) -- 0:00:00
992500 -- (-882.614) [-884.481] (-880.209) (-880.749) * [-882.707] (-886.653) (-879.380) (-880.583) -- 0:00:00
993000 -- (-881.740) (-884.467) (-881.263) [-880.608] * (-880.885) [-879.377] (-880.934) (-880.443) -- 0:00:00
993500 -- (-883.175) [-880.524] (-881.309) (-879.642) * (-881.338) (-879.938) (-880.286) [-882.627] -- 0:00:00
994000 -- (-881.508) [-879.978] (-886.688) (-881.001) * [-881.009] (-883.814) (-880.206) (-879.625) -- 0:00:00
994500 -- (-887.153) (-879.995) [-883.852] (-881.299) * (-883.022) [-885.350] (-885.531) (-881.117) -- 0:00:00
995000 -- (-880.813) [-880.103] (-881.979) (-882.205) * [-881.962] (-885.775) (-880.024) (-881.606) -- 0:00:00
Average standard deviation of split frequencies: 0.004796
995500 -- [-880.521] (-882.386) (-880.821) (-883.039) * (-886.932) (-880.254) (-882.222) [-881.467] -- 0:00:00
996000 -- (-883.135) [-883.537] (-879.746) (-885.493) * (-882.970) [-882.563] (-879.844) (-881.767) -- 0:00:00
996500 -- (-882.044) (-882.964) [-880.122] (-882.906) * (-879.832) (-881.971) (-879.777) [-882.204] -- 0:00:00
997000 -- (-881.103) (-882.004) [-879.142] (-881.450) * (-880.675) (-881.806) [-881.296] (-880.673) -- 0:00:00
997500 -- (-882.419) (-884.798) [-880.261] (-881.160) * [-879.621] (-882.703) (-886.274) (-881.111) -- 0:00:00
998000 -- (-881.624) (-886.693) [-880.755] (-881.789) * (-879.549) (-884.894) (-883.342) [-881.633] -- 0:00:00
998500 -- [-880.979] (-881.702) (-880.298) (-881.151) * (-880.015) (-882.930) (-882.036) [-883.648] -- 0:00:00
999000 -- (-880.165) (-882.951) (-880.529) [-881.801] * (-883.043) [-880.629] (-881.198) (-879.762) -- 0:00:00
999500 -- (-882.155) (-880.867) (-884.383) [-881.105] * (-881.038) [-880.837] (-882.220) (-883.487) -- 0:00:00
1000000 -- (-882.219) (-882.510) (-888.090) [-882.176] * (-882.114) (-881.074) [-881.125] (-880.611) -- 0:00:00
Average standard deviation of split frequencies: 0.005025
Analysis completed in 1 mins 1 seconds
Analysis used 59.71 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -879.12
Likelihood of best state for "cold" chain of run 2 was -879.12
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.0 % ( 24 %) Dirichlet(Pi{all})
29.9 % ( 23 %) Slider(Pi{all})
78.6 % ( 52 %) Multiplier(Alpha{1,2})
77.8 % ( 48 %) Multiplier(Alpha{3})
22.7 % ( 30 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 93 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.3 % ( 26 %) Dirichlet(Pi{all})
29.9 % ( 23 %) Slider(Pi{all})
79.2 % ( 55 %) Multiplier(Alpha{1,2})
77.2 % ( 46 %) Multiplier(Alpha{3})
21.1 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166751 0.82 0.67
3 | 167140 166357 0.84
4 | 166802 166493 166457
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166382 0.82 0.67
3 | 167070 166764 0.84
4 | 166276 166961 166547
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -880.83
| 22 1 |
| |
| 1 2 2 2 1 1 |
| 2 1 2 1 2 1 1 |
| 21 22 2 2 1 1 1 2 11 1 1 |
| 2 1 2 1 2 1 21 1 11 2 2 2 *1 |
|1 21 22 21 1 1 2 21 21 1 1 1|
| 21 1 11 *122 * * * 2 1 1 1 1 2 |
| 21 1 2 1 2 2 2 1 2 22 2 |
| 2 1 2 2 2 2 222|
| 2 1 1 2 |
|2 1 1 |
| 1 1 2 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -882.58
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -880.84 -883.91
2 -880.85 -883.92
--------------------------------------
TOTAL -880.85 -883.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885604 0.084218 0.367232 1.472256 0.854557 1402.04 1451.52 1.000
r(A<->C){all} 0.178512 0.020122 0.000148 0.460281 0.148073 188.91 261.34 1.013
r(A<->G){all} 0.160698 0.017931 0.000005 0.425057 0.127385 161.15 189.78 1.000
r(A<->T){all} 0.162359 0.019323 0.000146 0.449142 0.126679 108.44 170.71 1.000
r(C<->G){all} 0.161741 0.018384 0.000111 0.441107 0.127129 93.01 176.10 1.001
r(C<->T){all} 0.170888 0.020380 0.000282 0.455869 0.134218 172.18 182.98 1.000
r(G<->T){all} 0.165803 0.020056 0.000341 0.450846 0.125095 236.53 341.57 1.003
pi(A){all} 0.196402 0.000248 0.166347 0.227652 0.196122 1261.80 1381.40 1.000
pi(C){all} 0.327191 0.000326 0.291271 0.361395 0.326879 1109.33 1238.42 1.000
pi(G){all} 0.291099 0.000315 0.257259 0.326906 0.291104 1287.43 1296.57 1.000
pi(T){all} 0.185308 0.000233 0.156838 0.215697 0.184858 1404.40 1421.99 1.001
alpha{1,2} 0.408426 0.224988 0.000118 1.358987 0.242435 1227.12 1252.45 1.000
alpha{3} 0.461412 0.244096 0.000444 1.427834 0.291508 1106.99 1238.74 1.000
pinvar{all} 0.997531 0.000009 0.992225 0.999997 0.998491 1336.57 1418.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*.***
9 -- ..*.*.
10 -- ...*.*
11 -- .*...*
12 -- .**...
13 -- .**.**
14 -- ..**..
15 -- .*.*..
16 -- .****.
17 -- ..****
18 -- .*..*.
19 -- ...**.
20 -- ....**
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.004711 0.148568 0.155230 2
8 436 0.145237 0.005653 0.141239 0.149234 2
9 435 0.144903 0.001413 0.143904 0.145903 2
10 433 0.144237 0.000471 0.143904 0.144570 2
11 432 0.143904 0.004711 0.140573 0.147235 2
12 426 0.141905 0.016017 0.130580 0.153231 2
13 425 0.141572 0.008951 0.135243 0.147901 2
14 423 0.140906 0.009893 0.133911 0.147901 2
15 423 0.140906 0.002355 0.139241 0.142572 2
16 422 0.140573 0.001884 0.139241 0.141905 2
17 421 0.140240 0.001413 0.139241 0.141239 2
18 419 0.139574 0.002355 0.137908 0.141239 2
19 417 0.138907 0.013662 0.129247 0.148568 2
20 415 0.138241 0.000471 0.137908 0.138574 2
21 413 0.137575 0.001413 0.136576 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098550 0.010109 0.000002 0.300489 0.066880 1.000 2
length{all}[2] 0.096269 0.009322 0.000006 0.295370 0.067295 1.001 2
length{all}[3] 0.098877 0.009990 0.000023 0.298768 0.065748 1.000 2
length{all}[4] 0.098321 0.009884 0.000033 0.290469 0.068371 1.000 2
length{all}[5] 0.098454 0.009670 0.000131 0.294670 0.067968 1.000 2
length{all}[6] 0.098102 0.009988 0.000011 0.298905 0.066942 1.001 2
length{all}[7] 0.099333 0.009933 0.000310 0.298059 0.069637 0.998 2
length{all}[8] 0.094296 0.008193 0.000280 0.267848 0.066163 0.999 2
length{all}[9] 0.104739 0.011510 0.000047 0.319782 0.069760 1.001 2
length{all}[10] 0.103863 0.011189 0.000509 0.303702 0.072012 0.998 2
length{all}[11] 0.100633 0.009524 0.000169 0.286286 0.076575 1.007 2
length{all}[12] 0.104733 0.010438 0.000037 0.296778 0.077585 1.013 2
length{all}[13] 0.097275 0.009624 0.000046 0.306296 0.066978 0.999 2
length{all}[14] 0.093997 0.010459 0.000611 0.294466 0.062138 1.000 2
length{all}[15] 0.100330 0.010306 0.000127 0.291176 0.070256 1.001 2
length{all}[16] 0.103286 0.008834 0.000076 0.290378 0.078477 0.999 2
length{all}[17] 0.105162 0.010160 0.000502 0.314936 0.077989 1.000 2
length{all}[18] 0.103158 0.011215 0.000497 0.314214 0.068593 1.001 2
length{all}[19] 0.097546 0.008457 0.000022 0.288394 0.073334 0.998 2
length{all}[20] 0.092836 0.007727 0.000122 0.270388 0.065975 1.009 2
length{all}[21] 0.091430 0.008498 0.000725 0.272693 0.062325 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005025
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 648
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 216 / 216 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080072 0.012441 0.013548 0.098232 0.029709 0.016471 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -905.656218
Iterating by ming2
Initial: fx= 905.656218
x= 0.08007 0.01244 0.01355 0.09823 0.02971 0.01647 0.30000 1.30000
1 h-m-p 0.0000 0.0001 519.0109 ++ 889.914123 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0078 42.8464 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 474.3775 ++ 888.744205 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0095 35.4597 ---------.. | 2/8
5 h-m-p 0.0000 0.0000 423.6942 ++ 886.279736 m 0.0000 73 | 3/8
6 h-m-p 0.0002 0.0106 31.1200 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 366.2029 ++ 877.909407 m 0.0001 103 | 4/8
8 h-m-p 0.0007 0.0130 25.0134 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 298.6164 +++ 856.454154 m 0.0002 135 | 5/8
10 h-m-p 0.0035 0.0237 14.4971 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 212.8279 ++ 852.522289 m 0.0001 167 | 6/8
12 h-m-p 0.4193 8.0000 0.0000 +++ 852.522289 m 8.0000 179 | 6/8
13 h-m-p 0.0657 8.0000 0.0004 --Y 852.522289 0 0.0010 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 +++++ 852.522289 m 8.0000 210 | 6/8
15 h-m-p 0.0048 2.4210 0.7033 ++++Y 852.522287 0 0.8364 227 | 6/8
16 h-m-p 1.6000 8.0000 0.0722 Y 852.522287 0 0.8139 240 | 6/8
17 h-m-p 1.6000 8.0000 0.0013 Y 852.522287 0 0.4000 253 | 6/8
18 h-m-p 1.6000 8.0000 0.0002 ------C 852.522287 0 0.0001 272 | 6/8
19 h-m-p 0.0618 8.0000 0.0000 --Y 852.522287 0 0.0010 287
Out..
lnL = -852.522287
288 lfun, 288 eigenQcodon, 1728 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021193 0.101820 0.036714 0.050092 0.101391 0.017648 0.719191 0.696776 0.469545
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.321247
np = 9
lnL0 = -921.613600
Iterating by ming2
Initial: fx= 921.613600
x= 0.02119 0.10182 0.03671 0.05009 0.10139 0.01765 0.71919 0.69678 0.46955
1 h-m-p 0.0000 0.0001 508.9664 ++ 899.683338 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 218.5487 ++ 896.044093 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0001 362.5455 ++ 886.149074 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 1065.1707 ++ 877.294218 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 4386.8772 ++ 852.632086 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 729.2553 ++ 852.522280 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 852.522280 m 8.0000 86 | 6/9
8 h-m-p 0.0399 6.0287 0.0291 ++++ 852.522276 m 6.0287 103 | 7/9
9 h-m-p 0.2783 8.0000 0.0387 ----------Y 852.522276 0 0.0000 128 | 7/9
10 h-m-p 0.0160 8.0000 0.0001 -------Y 852.522276 0 0.0000 149 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 852.522276 m 8.0000 166 | 7/9
12 h-m-p 0.0041 2.0569 0.4108 --------Y 852.522276 0 0.0000 188 | 7/9
13 h-m-p 0.0160 8.0000 0.0006 +++++ 852.522276 m 8.0000 205 | 7/9
14 h-m-p 0.0119 2.2429 0.3793 ----------C 852.522276 0 0.0000 229 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 -------C 852.522276 0 0.0000 250 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 --C 852.522276 0 0.0003 266
Out..
lnL = -852.522276
267 lfun, 801 eigenQcodon, 3204 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.035748 0.023472 0.080173 0.101460 0.073046 0.106399 0.694893 1.727319 0.114650 0.391685 2.190263
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.829389
np = 11
lnL0 = -937.021472
Iterating by ming2
Initial: fx= 937.021472
x= 0.03575 0.02347 0.08017 0.10146 0.07305 0.10640 0.69489 1.72732 0.11465 0.39169 2.19026
1 h-m-p 0.0000 0.0001 468.1672 ++ 909.949768 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0003 215.2266 ++ 897.013382 m 0.0003 30 | 2/11
3 h-m-p 0.0000 0.0002 682.9836 ++ 867.976748 m 0.0002 44 | 3/11
4 h-m-p 0.0001 0.0003 194.1336 ++ 862.924313 m 0.0003 58 | 4/11
5 h-m-p 0.0000 0.0000 5136.1861 ++ 855.940872 m 0.0000 72 | 5/11
6 h-m-p 0.0090 0.0448 3.9439 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 296.8377 ++ 853.494342 m 0.0000 111 | 6/11
8 h-m-p 0.0030 0.4842 1.9522 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 212.0692 ++ 852.522280 m 0.0000 149 | 7/11
10 h-m-p 0.0230 8.0000 0.0000 +++++ 852.522280 m 8.0000 166 | 7/11
11 h-m-p 0.0293 8.0000 0.0016 -----------Y 852.522280 0 0.0000 195 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 ----Y 852.522280 0 0.0000 217 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 852.522280 m 8.0000 267 | 7/11
15 h-m-p 0.0160 8.0000 0.9041 ------------C 852.522280 0 0.0000 297 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 852.522280 m 8.0000 318 | 7/11
17 h-m-p 0.0160 8.0000 1.1734 ----------Y 852.522280 0 0.0000 346 | 7/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 852.522280 m 8.0000 363 | 7/11
19 h-m-p 0.0103 5.1454 1.1903 ----------C 852.522280 0 0.0000 391 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 --C 852.522280 0 0.0003 407 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 ------------N 852.522280 0 0.0000 437
Out..
lnL = -852.522280
438 lfun, 1752 eigenQcodon, 7884 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -852.533611 S = -852.520120 -0.005166
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:03
did 20 / 53 patterns 0:03
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040643 0.098907 0.109180 0.052885 0.062270 0.068004 0.676506 0.241214 1.606692
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.367241
np = 9
lnL0 = -941.099812
Iterating by ming2
Initial: fx= 941.099812
x= 0.04064 0.09891 0.10918 0.05289 0.06227 0.06800 0.67651 0.24121 1.60669
1 h-m-p 0.0000 0.0002 486.4950 +++ 892.420365 m 0.0002 15 | 1/9
2 h-m-p 0.0008 0.0038 47.2353 ++ 888.197764 m 0.0038 27 | 2/9
3 h-m-p 0.0000 0.0002 205.1405 ++ 880.570730 m 0.0002 39 | 3/9
4 h-m-p 0.0008 0.0038 37.8145 ++ 877.308900 m 0.0038 51 | 4/9
5 h-m-p 0.0000 0.0002 133.6428 ++ 870.726672 m 0.0002 63 | 5/9
6 h-m-p 0.0003 0.0138 45.3863 +++ 866.464384 m 0.0138 76 | 6/9
7 h-m-p 0.0017 0.0084 136.0575 ++ 852.522274 m 0.0084 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 -------------Y 852.522274 0 0.0000 113 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 --N 852.522274 0 0.0003 129
Out..
lnL = -852.522274
130 lfun, 1430 eigenQcodon, 7800 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.072688 0.098998 0.105297 0.090076 0.100426 0.076679 0.000100 0.900000 0.794200 1.815877 2.796475
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.339243
np = 11
lnL0 = -952.212994
Iterating by ming2
Initial: fx= 952.212994
x= 0.07269 0.09900 0.10530 0.09008 0.10043 0.07668 0.00011 0.90000 0.79420 1.81588 2.79648
1 h-m-p 0.0000 0.0000 403.5836 ++ 952.008961 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 4650.2546 ++ 875.033342 m 0.0000 30 | 2/11
3 h-m-p 0.0001 0.0004 56.5812 ++ 870.466250 m 0.0004 44 | 3/11
4 h-m-p 0.0008 0.0121 25.7572 ++ 867.870718 m 0.0121 58 | 4/11
5 h-m-p 0.0001 0.0004 229.0155 ++ 856.528507 m 0.0004 72 | 5/11
6 h-m-p 0.0041 0.0296 20.4874 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 295.5075 ++ 855.068387 m 0.0000 110 | 6/11
8 h-m-p 0.0004 0.0358 8.5741 ----------.. | 6/11
9 h-m-p 0.0000 0.0001 209.8832 ++ 852.522280 m 0.0001 146 | 7/11
10 h-m-p 0.3612 8.0000 0.0000 +++ 852.522280 m 8.0000 161 | 7/11
11 h-m-p 0.0160 8.0000 0.0091 +++++ 852.522279 m 8.0000 182 | 7/11
12 h-m-p 0.0085 0.1143 8.4772 -----------N 852.522279 0 0.0000 211 | 7/11
13 h-m-p 0.0160 8.0000 0.0005 +++++ 852.522279 m 8.0000 228 | 7/11
14 h-m-p 0.0002 0.0601 20.9412 ----------.. | 7/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 852.522279 m 8.0000 271 | 7/11
16 h-m-p 0.0160 8.0000 0.0878 --------C 852.522279 0 0.0000 297 | 7/11
17 h-m-p 0.0160 8.0000 0.0332 +++++ 852.522240 m 8.0000 318 | 7/11
18 h-m-p 0.5486 2.7429 0.3575 ----------------.. | 7/11
19 h-m-p 0.0160 8.0000 0.0003 +++++ 852.522239 m 8.0000 371 | 7/11
20 h-m-p 0.0170 7.2114 0.1363 -----------Y 852.522239 0 0.0000 400 | 7/11
21 h-m-p 0.0022 1.0879 0.0231 +++++ 852.522231 m 1.0879 421 | 8/11
22 h-m-p 0.1953 8.0000 0.0297 ------------C 852.522231 0 0.0000 451 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 852.522231 m 8.0000 471 | 8/11
24 h-m-p 0.0040 2.0060 1.3608 -----------C 852.522231 0 0.0000 499 | 8/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 852.522231 m 8.0000 516 | 8/11
26 h-m-p 0.0033 1.6521 1.7687 ++++
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
+ 852.522193 m 1.6521 536
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.799466e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16387) = 5.603835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.16386) = 5.603838e-161 2000 rounds
| 9/11
27 h-m-p 1.6000 8.0000 0.0126
QuantileBeta(0.15, 0.00500, 4.14826) = 5.627649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10144) = 5.700306e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
+ 852.522193 m 8.0000 550
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.924798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08600) = 5.724678e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08566) = 5.725206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.08583) = 5.724942e-161 2000 rounds
| 9/11
28 h-m-p 1.6000 8.0000 0.0056
QuantileBeta(0.15, 0.00500, 4.07889) = 5.735972e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05805) = 5.769318e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
+ 852.522193 m 8.0000 566
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.982315e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05128) = 5.780251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05095) = 5.780786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
| 9/11
29 h-m-p 0.0323 3.7586 1.3880
QuantileBeta(0.15, 0.00500, 4.01639) = 5.837182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91223) = 6.014015e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.49559) = 6.842733e-161 2000 rounds
++
QuantileBeta(0.15, 0.00500, 2.66221) = 9.438856e-161 2000 rounds
Y 852.522193 0 2.0642 585 | 9/11
30 h-m-p 0.9720 8.0000 2.9476
QuantileBeta(0.15, 0.00500, 4.05111) = 5.780519e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38455) = 1.079954e-160 2000 rounds
---------Y 852.522193 0 0.0000 608 | 9/11
31 h-m-p 0.1664 8.0000 0.0000 Y 852.522193 0 0.1664 622 | 9/11
32 h-m-p 1.6000 8.0000 0.0000 +Y 852.522193 0 6.4000 639 | 9/11
33 h-m-p 0.2986 8.0000 0.0000 -------------Y 852.522193 0 0.0000 668
Out..
lnL = -852.522193
669 lfun, 8028 eigenQcodon, 44154 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -852.557498 S = -852.522741 -0.015344
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:16
did 20 / 53 patterns 0:17
did 30 / 53 patterns 0:17
did 40 / 53 patterns 0:17
did 50 / 53 patterns 0:17
did 53 / 53 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
NC_002677_1_NP_302154_1_1026_ML1680 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
NZ_CP029543_1_WP_010908475_1_1813_cofC MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
NZ_AP014567_1_WP_010908475_1_1860_cofC MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT
**************************************************
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
NC_002677_1_NP_302154_1_1026_ML1680 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
NZ_CP029543_1_WP_010908475_1_1813_cofC AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
NZ_AP014567_1_WP_010908475_1_1860_cofC AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA
**************************************************
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
NC_002677_1_NP_302154_1_1026_ML1680 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
NZ_CP029543_1_WP_010908475_1_1813_cofC AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
NZ_AP014567_1_WP_010908475_1_1860_cofC AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT
**************************************************
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
NC_002677_1_NP_302154_1_1026_ML1680 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
NZ_CP029543_1_WP_010908475_1_1813_cofC AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
NZ_AP014567_1_WP_010908475_1_1860_cofC AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA
**************************************************
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 RRLGIGAATTRVVAHL
NC_002677_1_NP_302154_1_1026_ML1680 RRLGIGAATTRVVAHL
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 RRLGIGAATTRVVAHL
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 RRLGIGAATTRVVAHL
NZ_CP029543_1_WP_010908475_1_1813_cofC RRLGIGAATTRVVAHL
NZ_AP014567_1_WP_010908475_1_1860_cofC RRLGIGAATTRVVAHL
****************
>NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT >NC_002677_1_NP_302154_1_1026_ML1680 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT >NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT >NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT >NZ_CP029543_1_WP_010908475_1_1813_cofC ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT >NZ_AP014567_1_WP_010908475_1_1860_cofC ATGAGTGGCACACGGGCTGGAGGCACAGCTGATGTCGGCTTGATCATCGC CGTTAAGCGGCTGGCCGCCGCCAAGACCAGGCTAGGACCGGTCTTCTCGA CTCGGACACGAGAGAATGTGGTGTTGGCCATGTTGGTAGACACCCTGACC GCAGCGGCACCCGTTTCAGCACTACGTTCAATCACCGTCATCACGCCCGA TGAGGCCGCTGCCGCGGCAGCGGCCGAATTCGGAGCCGAGATTCTGGCCG ATCCAACACCCGATGGTCATGGTGATCCACTGAATAACGCCATTGCCGCT GCGGAACACGCGATAGCTGGATCATTCTCCAATATCGTTGTACTGCAAGG AGATTTGCCTGCCTTACAGACACAGGAATTGTCCGAGGCAATCGCTGCCG CCCGACACCATCAGCGCAGCTTCGTCGCTGATCGACTGGGTAGCGGAACC GCAGCGCTCTGCACGTTCGGAACCGCACTCAACCCGCAGTTCGGTCCAGA TTCATCCGCGCAACATCGCCGTTCAGGCGCGATCGAGCTTACGGGACCCT GGCCTGGCCTGCGATGCGACGTCGACACGCCTGCCGATCTGGCCGCCGCA CGCCGTCTGGGCATCGGAGCCGCCACCACGCGGGTGGTCGCACATCTT
>NC_011896_1_WP_010908475_1_1785_MLBR_RS08460 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL >NC_002677_1_NP_302154_1_1026_ML1680 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL >NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL >NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400 MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL >NZ_CP029543_1_WP_010908475_1_1813_cofC MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL >NZ_AP014567_1_WP_010908475_1_1860_cofC MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLT AAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAA AEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGT AALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAA RRLGIGAATTRVVAHL
#NEXUS
[ID: 5474653881]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908475_1_1785_MLBR_RS08460
NC_002677_1_NP_302154_1_1026_ML1680
NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070
NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400
NZ_CP029543_1_WP_010908475_1_1813_cofC
NZ_AP014567_1_WP_010908475_1_1860_cofC
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908475_1_1785_MLBR_RS08460,
2 NC_002677_1_NP_302154_1_1026_ML1680,
3 NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070,
4 NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400,
5 NZ_CP029543_1_WP_010908475_1_1813_cofC,
6 NZ_AP014567_1_WP_010908475_1_1860_cofC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06687961,2:0.06729505,3:0.06574828,4:0.06837082,5:0.0679682,6:0.06694242);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06687961,2:0.06729505,3:0.06574828,4:0.06837082,5:0.0679682,6:0.06694242);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -880.84 -883.91
2 -880.85 -883.92
--------------------------------------
TOTAL -880.85 -883.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1680/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885604 0.084218 0.367232 1.472256 0.854557 1402.04 1451.52 1.000
r(A<->C){all} 0.178512 0.020122 0.000148 0.460281 0.148073 188.91 261.34 1.013
r(A<->G){all} 0.160698 0.017931 0.000005 0.425057 0.127385 161.15 189.78 1.000
r(A<->T){all} 0.162359 0.019323 0.000146 0.449142 0.126679 108.44 170.71 1.000
r(C<->G){all} 0.161741 0.018384 0.000111 0.441107 0.127129 93.01 176.10 1.001
r(C<->T){all} 0.170888 0.020380 0.000282 0.455869 0.134218 172.18 182.98 1.000
r(G<->T){all} 0.165803 0.020056 0.000341 0.450846 0.125095 236.53 341.57 1.003
pi(A){all} 0.196402 0.000248 0.166347 0.227652 0.196122 1261.80 1381.40 1.000
pi(C){all} 0.327191 0.000326 0.291271 0.361395 0.326879 1109.33 1238.42 1.000
pi(G){all} 0.291099 0.000315 0.257259 0.326906 0.291104 1287.43 1296.57 1.000
pi(T){all} 0.185308 0.000233 0.156838 0.215697 0.184858 1404.40 1421.99 1.001
alpha{1,2} 0.408426 0.224988 0.000118 1.358987 0.242435 1227.12 1252.45 1.000
alpha{3} 0.461412 0.244096 0.000444 1.427834 0.291508 1106.99 1238.74 1.000
pinvar{all} 0.997531 0.000009 0.992225 0.999997 0.998491 1336.57 1418.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1680/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 216
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 3 3 3 3 3 3 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 5 5 5 5 5 5 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 4 4 4 4 4 4 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 4 4 4 4 4 4
CTG 9 9 9 9 9 9 | CCG 2 2 2 2 2 2 | CAG 4 4 4 4 4 4 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 8 8 8 8 8 8 | ACC 7 7 7 7 7 7 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 5 5 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 7 7 7 7 7 7 | Asp GAT 9 9 9 9 9 9 | Gly GGT 4 4 4 4 4 4
GTC 6 6 6 6 6 6 | GCC 20 20 20 20 20 20 | GAC 3 3 3 3 3 3 | GGC 6 6 6 6 6 6
GTA 2 2 2 2 2 2 | GCA 9 9 9 9 9 9 | Glu GAA 3 3 3 3 3 3 | GGA 9 9 9 9 9 9
GTG 3 3 3 3 3 3 | GCG 8 8 8 8 8 8 | GAG 5 5 5 5 5 5 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908475_1_1785_MLBR_RS08460
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
#2: NC_002677_1_NP_302154_1_1026_ML1680
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
#3: NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
#4: NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
#5: NZ_CP029543_1_WP_010908475_1_1813_cofC
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
#6: NZ_AP014567_1_WP_010908475_1_1860_cofC
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 36 | TCC 18 | TAC 0 | TGC 12
Leu L TTA 6 | TCA 30 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 24 | Arg R CGT 18
CTC 12 | CCC 24 | CAC 12 | CGC 18
CTA 12 | CCA 18 | Gln Q CAA 12 | CGA 24
CTG 54 | CCG 12 | CAG 24 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 6
ATC 48 | ACC 42 | AAC 12 | AGC 12
ATA 6 | ACA 30 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 30 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 42 | Asp D GAT 54 | Gly G GGT 24
GTC 36 | GCC 120 | GAC 18 | GGC 36
GTA 12 | GCA 54 | Glu E GAA 18 | GGA 54
GTG 18 | GCG 48 | GAG 30 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11111 C:0.24537 A:0.19444 G:0.44907
position 2: T:0.25000 C:0.38426 A:0.18056 G:0.18519
position 3: T:0.19444 C:0.35185 A:0.21296 G:0.24074
Average T:0.18519 C:0.32716 A:0.19599 G:0.29167
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -852.522287 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.719191 0.805127
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908475_1_1785_MLBR_RS08460: 0.000004, NC_002677_1_NP_302154_1_1026_ML1680: 0.000004, NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070: 0.000004, NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400: 0.000004, NZ_CP029543_1_WP_010908475_1_1813_cofC: 0.000004, NZ_AP014567_1_WP_010908475_1_1860_cofC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.71919
omega (dN/dS) = 0.80513
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
7..2 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
7..3 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
7..4 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
7..5 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
7..6 0.000 434.7 213.3 0.8051 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -852.522276 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.694893 0.704954 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908475_1_1785_MLBR_RS08460: 0.000004, NC_002677_1_NP_302154_1_1026_ML1680: 0.000004, NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070: 0.000004, NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400: 0.000004, NZ_CP029543_1_WP_010908475_1_1813_cofC: 0.000004, NZ_AP014567_1_WP_010908475_1_1860_cofC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.69489
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70495 0.29505
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
7..2 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
7..3 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
7..4 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
7..5 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
7..6 0.000 434.8 213.2 0.2950 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -852.522280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.676506 0.726244 0.142883 0.000001 2.277157
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908475_1_1785_MLBR_RS08460: 0.000004, NC_002677_1_NP_302154_1_1026_ML1680: 0.000004, NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070: 0.000004, NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400: 0.000004, NZ_CP029543_1_WP_010908475_1_1813_cofC: 0.000004, NZ_AP014567_1_WP_010908475_1_1860_cofC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.67651
MLEs of dN/dS (w) for site classes (K=3)
p: 0.72624 0.14288 0.13087
w: 0.00000 1.00000 2.27716
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
7..2 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
7..3 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
7..4 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
7..5 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
7..6 0.000 435.0 213.0 0.4409 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908475_1_1785_MLBR_RS08460)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908475_1_1785_MLBR_RS08460)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -852.522274 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.038334 0.193238
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908475_1_1785_MLBR_RS08460: 0.000004, NC_002677_1_NP_302154_1_1026_ML1680: 0.000004, NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070: 0.000004, NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400: 0.000004, NZ_CP029543_1_WP_010908475_1_1813_cofC: 0.000004, NZ_AP014567_1_WP_010908475_1_1860_cofC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 1.03833 q = 0.19324
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.24997 0.58521 0.78465 0.89772 0.95700 0.98479 0.99586 0.99927 0.99995 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
7..2 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
7..3 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
7..4 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
7..5 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
7..6 0.000 440.7 207.3 0.8454 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -852.522193 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.829034 2.862546
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908475_1_1785_MLBR_RS08460: 0.000004, NC_002677_1_NP_302154_1_1026_ML1680: 0.000004, NZ_LVXE01000025_1_WP_010908475_1_1043_A3216_RS08070: 0.000004, NZ_LYPH01000028_1_WP_010908475_1_1125_A8144_RS05400: 0.000004, NZ_CP029543_1_WP_010908475_1_1813_cofC: 0.000004, NZ_AP014567_1_WP_010908475_1_1860_cofC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.82903
(p1 = 0.00001) w = 2.86255
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.86255
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 440.7 207.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908475_1_1785_MLBR_RS08460)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:17
Model 1: NearlyNeutral -852.522276 Model 2: PositiveSelection -852.52228 Model 0: one-ratio -852.522287 Model 7: beta -852.522274 Model 8: beta&w>1 -852.522193 Model 0 vs 1 2.199999994445534E-5 Model 2 vs 1 7.999999979801942E-6 Model 8 vs 7 1.6200000004573667E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
