--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:20:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1683/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -809.82 -814.56
2 -809.81 -812.48
--------------------------------------
TOTAL -809.81 -813.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900669 0.093693 0.358534 1.497060 0.862070 1342.88 1421.94 1.000
r(A<->C){all} 0.168107 0.020729 0.000013 0.456001 0.127158 170.25 182.37 1.001
r(A<->G){all} 0.175912 0.023381 0.000053 0.486864 0.136073 250.44 270.74 1.002
r(A<->T){all} 0.167529 0.021272 0.000012 0.470234 0.126502 111.34 199.94 1.002
r(C<->G){all} 0.169196 0.019773 0.000027 0.451880 0.132711 263.19 263.34 1.001
r(C<->T){all} 0.158923 0.019191 0.000029 0.431710 0.119310 120.91 222.99 1.002
r(G<->T){all} 0.160332 0.019592 0.000067 0.445592 0.122906 286.44 345.04 1.000
pi(A){all} 0.233151 0.000307 0.200973 0.270001 0.233225 1366.46 1407.24 1.000
pi(C){all} 0.277738 0.000338 0.242309 0.315051 0.277594 1294.68 1357.13 1.000
pi(G){all} 0.338132 0.000378 0.301010 0.375655 0.338012 1149.02 1275.95 1.000
pi(T){all} 0.150979 0.000219 0.121975 0.180428 0.150832 1346.99 1391.12 1.000
alpha{1,2} 0.425309 0.224585 0.000119 1.343620 0.272620 1153.49 1236.76 1.000
alpha{3} 0.460478 0.239876 0.000194 1.434071 0.293661 1265.09 1335.00 1.000
pinvar{all} 0.997507 0.000009 0.992071 0.999998 0.998447 1278.75 1314.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -751.817275
Model 2: PositiveSelection -751.817253
Model 0: one-ratio -751.81717
Model 7: beta -751.817274
Model 8: beta&w>1 -751.817085
Model 0 vs 1 2.0999999992454832E-4
Model 2 vs 1 4.399999988891068E-5
Model 8 vs 7 3.7799999995513645E-4
>C1
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C2
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C3
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C4
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C5
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C6
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=200
C1 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C2 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C3 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C4 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C5 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C6 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
**************************************************
C1 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C2 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C3 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C4 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C5 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C6 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
**************************************************
C1 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C2 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C3 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C4 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C5 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C6 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
**************************************************
C1 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C2 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C3 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C4 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C5 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C6 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
**************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 200 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 200 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6000]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6000]--->[6000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.743 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C2 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C3 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C4 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C5 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
C6 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
**************************************************
C1 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C2 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C3 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C4 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C5 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
C6 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
**************************************************
C1 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C2 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C3 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C4 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C5 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
C6 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
**************************************************
C1 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C2 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C3 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C4 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C5 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
C6 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
**************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
C2 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
C3 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
C4 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
C5 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
C6 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
**************************************************
C1 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
C2 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
C3 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
C4 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
C5 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
C6 CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
**************************************************
C1 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
C2 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
C3 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
C4 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
C5 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
C6 GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
**************************************************
C1 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
C2 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
C3 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
C4 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
C5 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
C6 GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
**************************************************
C1 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
C2 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
C3 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
C4 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
C5 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
C6 AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
**************************************************
C1 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
C2 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
C3 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
C4 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
C5 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
C6 AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
**************************************************
C1 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
C2 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
C3 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
C4 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
C5 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
C6 GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
**************************************************
C1 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
C2 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
C3 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
C4 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
C5 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
C6 GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
**************************************************
C1 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
C2 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
C3 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
C4 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
C5 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
C6 CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
**************************************************
C1 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
C2 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
C3 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
C4 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
C5 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
C6 AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
**************************************************
C1 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
C2 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
C3 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
C4 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
C5 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
C6 GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
**************************************************
C1 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
C2 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
C3 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
C4 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
C5 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
C6 TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
**************************************************
>C1
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C2
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C3
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C4
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C5
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C6
ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA
CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC
GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC
GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA
AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC
AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC
GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA
GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC
CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG
AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA
GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG
TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>C1
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C2
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C3
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C4
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C5
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
>C6
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 600 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857544
Setting output file names to "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 877604003
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5959238239
Seed = 1771331101
Swapseed = 1579857544
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1342.828766 -- -24.965149
Chain 2 -- -1342.828561 -- -24.965149
Chain 3 -- -1342.828766 -- -24.965149
Chain 4 -- -1342.828766 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1342.828766 -- -24.965149
Chain 2 -- -1342.828766 -- -24.965149
Chain 3 -- -1342.828766 -- -24.965149
Chain 4 -- -1342.828766 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1342.829] (-1342.829) (-1342.829) (-1342.829) * [-1342.829] (-1342.829) (-1342.829) (-1342.829)
500 -- (-833.955) (-823.962) (-825.143) [-824.795] * (-824.015) (-841.096) (-819.902) [-816.202] -- 0:00:00
1000 -- (-824.423) (-819.161) [-813.275] (-824.028) * [-819.914] (-830.173) (-818.198) (-826.070) -- 0:00:00
1500 -- (-820.067) (-818.601) (-815.372) [-820.611] * [-818.571] (-826.571) (-814.650) (-820.720) -- 0:00:00
2000 -- (-814.589) (-818.914) (-819.647) [-819.789] * (-820.716) (-816.780) [-819.279] (-822.281) -- 0:00:00
2500 -- (-821.216) (-815.728) (-818.517) [-819.509] * [-817.988] (-815.536) (-818.692) (-822.650) -- 0:00:00
3000 -- (-824.537) (-820.122) (-829.880) [-816.878] * (-826.452) (-817.424) [-815.394] (-817.072) -- 0:00:00
3500 -- (-820.267) (-815.613) (-818.331) [-814.812] * (-822.034) [-817.864] (-825.197) (-820.008) -- 0:00:00
4000 -- (-818.216) [-818.282] (-815.990) (-823.348) * (-829.523) (-816.735) [-816.099] (-821.033) -- 0:00:00
4500 -- (-821.262) [-823.656] (-823.679) (-816.578) * (-815.810) (-826.602) [-815.103] (-816.186) -- 0:00:00
5000 -- (-823.088) [-820.264] (-824.067) (-823.923) * (-813.048) [-819.956] (-815.533) (-826.337) -- 0:00:00
Average standard deviation of split frequencies: 0.074826
5500 -- (-814.904) (-823.028) [-818.217] (-830.340) * (-811.239) (-820.773) (-818.242) [-822.966] -- 0:03:00
6000 -- (-815.546) (-819.943) (-818.385) [-814.771] * (-810.022) [-824.083] (-823.616) (-820.568) -- 0:02:45
6500 -- (-815.442) (-816.440) [-818.279] (-812.632) * (-809.913) (-814.661) [-815.190] (-819.849) -- 0:02:32
7000 -- (-823.463) (-826.515) (-817.515) [-815.446] * (-811.463) (-816.902) (-820.560) [-818.353] -- 0:02:21
7500 -- [-818.156] (-822.131) (-815.309) (-820.356) * (-814.783) [-814.289] (-820.905) (-820.596) -- 0:02:12
8000 -- (-812.371) (-824.164) (-818.913) [-819.483] * (-811.551) (-816.481) (-817.277) [-823.565] -- 0:02:04
8500 -- [-820.145] (-808.966) (-821.331) (-822.685) * [-808.950] (-824.972) (-822.426) (-817.150) -- 0:01:56
9000 -- (-820.853) [-810.222] (-819.100) (-817.968) * (-814.836) (-834.494) (-814.235) [-814.266] -- 0:01:50
9500 -- (-821.907) [-811.265] (-815.235) (-817.427) * (-811.859) [-820.911] (-813.865) (-822.904) -- 0:01:44
10000 -- (-817.614) (-808.439) (-819.261) [-821.954] * (-811.406) [-817.221] (-820.874) (-813.745) -- 0:01:39
Average standard deviation of split frequencies: 0.064082
10500 -- (-823.229) [-808.243] (-817.707) (-817.785) * [-810.588] (-826.112) (-824.036) (-816.370) -- 0:01:34
11000 -- (-819.936) (-808.583) [-816.915] (-818.806) * (-812.436) (-828.379) (-821.506) [-817.384] -- 0:01:29
11500 -- (-817.039) (-810.848) (-827.020) [-817.196] * [-810.228] (-822.328) (-825.258) (-824.476) -- 0:01:25
12000 -- (-825.618) (-812.726) [-815.471] (-830.490) * (-810.073) [-820.519] (-812.485) (-824.338) -- 0:01:22
12500 -- (-822.232) [-810.522] (-814.838) (-815.138) * (-810.324) [-818.889] (-818.015) (-822.206) -- 0:01:19
13000 -- (-817.027) (-809.912) [-820.318] (-820.600) * [-810.556] (-824.936) (-820.065) (-816.196) -- 0:01:15
13500 -- (-820.141) (-810.900) [-819.376] (-822.383) * (-811.002) (-819.633) [-820.550] (-824.777) -- 0:01:13
14000 -- (-821.264) (-810.067) [-814.958] (-821.488) * (-809.098) (-819.752) [-818.026] (-819.756) -- 0:01:10
14500 -- [-817.089] (-810.820) (-822.118) (-822.366) * (-809.770) (-821.509) (-817.289) [-820.245] -- 0:01:07
15000 -- [-818.758] (-810.793) (-819.571) (-827.291) * [-809.589] (-810.915) (-822.263) (-827.789) -- 0:01:05
Average standard deviation of split frequencies: 0.046794
15500 -- (-819.227) [-811.604] (-815.239) (-816.631) * (-812.832) (-810.853) [-819.209] (-822.251) -- 0:01:03
16000 -- (-819.619) [-813.756] (-820.681) (-811.991) * (-819.815) (-813.332) [-816.824] (-816.454) -- 0:01:01
16500 -- (-825.837) [-810.630] (-824.860) (-810.510) * (-811.592) [-810.867] (-816.991) (-817.685) -- 0:00:59
17000 -- (-829.937) (-811.200) (-818.170) [-808.931] * [-808.852] (-810.756) (-827.553) (-817.857) -- 0:00:57
17500 -- (-816.812) (-811.261) [-819.083] (-811.078) * [-810.337] (-809.951) (-815.281) (-820.595) -- 0:00:56
18000 -- (-816.586) [-810.117] (-820.377) (-810.270) * (-812.962) [-811.072] (-825.447) (-820.162) -- 0:00:54
18500 -- (-820.006) (-810.746) [-816.330] (-816.301) * (-815.181) (-810.392) [-815.939] (-820.482) -- 0:00:53
19000 -- [-817.226] (-809.483) (-823.226) (-811.787) * (-810.768) (-810.503) [-821.746] (-828.246) -- 0:00:51
19500 -- [-825.158] (-811.780) (-819.655) (-813.452) * (-810.166) [-812.003] (-817.860) (-819.867) -- 0:00:50
20000 -- (-829.579) [-810.271] (-820.598) (-812.904) * (-811.922) [-809.219] (-826.192) (-823.329) -- 0:00:49
Average standard deviation of split frequencies: 0.033455
20500 -- (-830.179) (-809.304) (-815.351) [-811.920] * (-809.535) [-808.945] (-830.830) (-818.614) -- 0:00:47
21000 -- (-822.709) [-809.214] (-824.168) (-811.166) * (-809.743) (-809.562) (-815.912) [-815.516] -- 0:01:33
21500 -- [-822.451] (-811.225) (-817.590) (-810.863) * (-809.306) (-809.687) (-815.418) [-815.778] -- 0:01:31
22000 -- (-837.505) (-810.578) [-818.032] (-820.905) * (-811.390) (-809.471) [-821.697] (-818.018) -- 0:01:28
22500 -- (-820.720) (-809.893) (-818.593) [-815.159] * (-811.003) [-809.893] (-818.567) (-820.763) -- 0:01:26
23000 -- (-812.585) (-810.229) [-817.481] (-811.908) * (-811.171) [-809.331] (-817.200) (-822.513) -- 0:01:24
23500 -- (-811.084) (-814.191) [-818.824] (-810.018) * (-809.686) (-810.843) (-819.696) [-823.512] -- 0:01:23
24000 -- (-811.013) [-810.745] (-826.645) (-809.920) * (-812.970) (-812.109) [-818.002] (-820.535) -- 0:01:21
24500 -- (-811.940) [-809.188] (-816.124) (-810.805) * (-811.085) (-811.307) [-817.448] (-820.401) -- 0:01:19
25000 -- (-812.234) (-814.819) (-821.721) [-812.508] * (-808.579) [-809.160] (-826.686) (-828.876) -- 0:01:18
Average standard deviation of split frequencies: 0.033789
25500 -- (-811.086) [-810.699] (-822.690) (-814.781) * [-812.910] (-809.243) (-830.845) (-821.999) -- 0:01:16
26000 -- [-808.731] (-810.023) (-825.613) (-810.994) * (-817.396) (-809.540) [-815.666] (-837.624) -- 0:01:14
26500 -- (-812.967) [-809.199] (-827.660) (-814.035) * (-815.199) (-810.832) [-815.362] (-820.388) -- 0:01:13
27000 -- (-809.606) (-808.289) [-817.837] (-814.253) * (-812.617) (-810.442) [-809.881] (-813.510) -- 0:01:12
27500 -- (-810.209) [-808.678] (-817.086) (-811.669) * (-809.870) [-815.133] (-809.369) (-815.657) -- 0:01:10
28000 -- [-811.538] (-811.434) (-821.179) (-811.369) * [-811.142] (-809.337) (-812.151) (-815.050) -- 0:01:09
28500 -- [-809.610] (-811.323) (-821.667) (-811.646) * (-810.369) [-811.205] (-810.020) (-817.706) -- 0:01:08
29000 -- (-809.164) (-813.712) (-827.333) [-813.811] * [-810.117] (-810.759) (-810.067) (-813.340) -- 0:01:06
29500 -- (-809.497) (-813.420) [-814.284] (-810.803) * (-812.180) (-812.633) [-809.450] (-811.211) -- 0:01:05
30000 -- (-809.638) (-817.219) [-823.471] (-812.917) * (-808.367) (-811.800) [-809.892] (-810.769) -- 0:01:04
Average standard deviation of split frequencies: 0.052445
30500 -- (-809.215) (-809.008) [-815.862] (-813.007) * (-809.349) [-808.683] (-812.904) (-810.073) -- 0:01:03
31000 -- (-808.633) (-809.417) [-818.093] (-810.774) * (-809.462) (-810.120) (-809.006) [-809.282] -- 0:01:02
31500 -- (-809.841) [-809.375] (-814.757) (-812.547) * (-811.803) (-817.970) [-811.672] (-810.242) -- 0:01:01
32000 -- [-808.245] (-808.824) (-820.066) (-809.092) * [-811.485] (-810.131) (-808.668) (-810.932) -- 0:01:00
32500 -- (-810.355) (-809.130) [-816.177] (-809.105) * (-812.899) [-808.390] (-808.467) (-808.761) -- 0:00:59
33000 -- (-810.112) (-810.357) (-833.266) [-808.976] * (-811.638) [-810.000] (-810.452) (-809.755) -- 0:00:58
33500 -- (-811.096) [-809.378] (-829.418) (-810.289) * (-809.501) [-811.363] (-811.661) (-809.188) -- 0:00:57
34000 -- (-810.638) (-811.172) (-821.886) [-809.589] * (-808.760) (-809.920) (-808.832) [-809.483] -- 0:00:56
34500 -- [-809.606] (-811.808) (-814.534) (-810.076) * (-809.697) (-812.023) [-810.306] (-810.676) -- 0:00:55
35000 -- [-808.958] (-812.596) (-816.887) (-808.670) * [-808.789] (-810.751) (-811.539) (-808.939) -- 0:00:55
Average standard deviation of split frequencies: 0.041595
35500 -- (-808.847) (-813.627) [-817.176] (-808.926) * (-810.648) (-810.953) [-811.640] (-809.915) -- 0:00:54
36000 -- (-810.610) (-811.567) (-819.393) [-809.893] * (-810.821) (-811.092) (-811.244) [-811.098] -- 0:00:53
36500 -- (-812.605) (-812.600) (-825.439) [-809.849] * (-812.215) (-809.314) [-812.832] (-812.234) -- 0:00:52
37000 -- [-810.094] (-809.119) (-820.329) (-813.923) * (-810.319) (-810.326) [-810.291] (-809.209) -- 0:01:18
37500 -- [-808.499] (-808.871) (-824.337) (-810.844) * [-809.494] (-808.865) (-812.362) (-809.102) -- 0:01:17
38000 -- [-809.170] (-809.466) (-819.563) (-810.854) * (-812.460) [-808.495] (-813.997) (-809.054) -- 0:01:15
38500 -- [-810.759] (-811.100) (-817.511) (-811.680) * (-814.954) (-808.860) (-809.375) [-808.931] -- 0:01:14
39000 -- (-808.324) (-808.425) (-815.724) [-811.316] * (-812.375) (-810.427) [-808.299] (-810.955) -- 0:01:13
39500 -- [-809.910] (-810.423) (-825.266) (-810.044) * (-811.466) (-813.609) (-808.486) [-811.923] -- 0:01:12
40000 -- (-808.124) (-812.529) (-820.035) [-810.541] * [-809.586] (-809.992) (-809.708) (-811.218) -- 0:01:12
Average standard deviation of split frequencies: 0.036139
40500 -- (-810.023) (-811.280) (-817.108) [-810.978] * (-808.843) (-810.285) [-810.308] (-811.492) -- 0:01:11
41000 -- [-812.496] (-811.128) (-821.987) (-810.953) * (-809.873) [-810.370] (-808.770) (-809.111) -- 0:01:10
41500 -- (-811.812) (-811.611) (-823.821) [-811.913] * (-808.504) [-810.728] (-809.885) (-808.748) -- 0:01:09
42000 -- (-811.198) (-809.699) [-822.317] (-810.699) * [-808.457] (-809.514) (-809.252) (-810.443) -- 0:01:08
42500 -- (-811.331) [-811.850] (-822.201) (-811.614) * [-809.297] (-809.145) (-811.055) (-809.160) -- 0:01:07
43000 -- (-810.659) (-811.846) (-814.934) [-810.420] * (-810.448) (-809.145) (-811.054) [-808.752] -- 0:01:06
43500 -- [-809.998] (-811.057) (-820.993) (-809.746) * (-811.055) (-810.262) [-810.183] (-809.094) -- 0:01:05
44000 -- (-816.291) (-813.944) (-829.974) [-810.229] * (-809.934) [-810.696] (-812.080) (-810.177) -- 0:01:05
44500 -- (-812.533) (-812.541) (-819.417) [-812.477] * (-811.320) (-810.683) (-808.714) [-813.309] -- 0:01:04
45000 -- [-811.482] (-814.690) (-830.823) (-811.130) * (-811.106) [-813.806] (-809.323) (-813.747) -- 0:01:03
Average standard deviation of split frequencies: 0.037731
45500 -- [-809.901] (-812.953) (-821.687) (-810.633) * (-809.889) [-811.005] (-808.374) (-810.191) -- 0:01:02
46000 -- [-811.192] (-810.167) (-822.804) (-811.076) * (-809.591) (-810.181) (-812.963) [-810.553] -- 0:01:02
46500 -- (-808.353) (-813.889) (-835.020) [-808.920] * [-809.654] (-812.261) (-813.453) (-810.557) -- 0:01:01
47000 -- (-809.551) (-810.078) (-813.284) [-810.201] * (-810.296) (-811.659) [-812.480] (-808.717) -- 0:01:00
47500 -- (-815.552) [-811.119] (-813.755) (-812.132) * (-808.611) (-809.471) (-811.478) [-809.343] -- 0:01:00
48000 -- [-813.526] (-809.159) (-811.505) (-808.428) * (-808.651) (-809.220) (-810.005) [-809.284] -- 0:00:59
48500 -- (-817.556) [-808.417] (-809.859) (-811.618) * (-812.098) (-809.462) [-813.614] (-809.692) -- 0:00:58
49000 -- (-819.020) (-809.656) (-808.922) [-812.689] * (-810.039) [-813.343] (-812.909) (-810.518) -- 0:00:58
49500 -- (-814.001) [-808.725] (-810.417) (-812.516) * [-809.025] (-809.949) (-810.644) (-810.178) -- 0:00:57
50000 -- (-811.679) (-814.160) (-809.410) [-813.459] * [-809.150] (-812.831) (-809.606) (-811.149) -- 0:00:57
Average standard deviation of split frequencies: 0.032099
50500 -- (-811.907) (-813.843) (-811.565) [-809.523] * (-809.809) (-811.438) (-810.352) [-811.428] -- 0:00:56
51000 -- (-813.825) (-811.271) [-809.606] (-810.294) * (-808.533) (-811.489) (-812.005) [-809.209] -- 0:00:55
51500 -- (-812.286) (-811.547) [-812.085] (-809.324) * (-809.611) (-809.034) (-812.718) [-808.803] -- 0:01:13
52000 -- [-810.623] (-811.704) (-809.396) (-809.993) * (-811.631) [-811.401] (-809.935) (-809.226) -- 0:01:12
52500 -- (-811.971) (-811.386) [-809.552] (-809.805) * (-808.479) (-812.978) [-809.446] (-808.651) -- 0:01:12
53000 -- [-809.340] (-810.950) (-815.911) (-811.035) * (-809.108) [-811.188] (-809.807) (-812.232) -- 0:01:11
53500 -- (-810.952) (-809.562) [-810.160] (-811.016) * [-809.834] (-808.759) (-811.458) (-810.919) -- 0:01:10
54000 -- (-810.469) (-810.490) [-809.951] (-811.739) * (-811.429) (-812.027) [-809.863] (-808.990) -- 0:01:10
54500 -- [-811.550] (-811.689) (-810.819) (-809.683) * [-809.605] (-812.082) (-809.574) (-810.186) -- 0:01:09
55000 -- [-810.594] (-811.017) (-808.330) (-811.048) * (-816.040) (-812.533) [-811.848] (-810.233) -- 0:01:08
Average standard deviation of split frequencies: 0.032469
55500 -- (-811.773) [-810.661] (-810.236) (-809.710) * [-810.442] (-808.975) (-811.400) (-809.206) -- 0:01:08
56000 -- [-810.731] (-820.157) (-809.313) (-813.821) * [-813.075] (-808.976) (-809.096) (-810.513) -- 0:01:07
56500 -- (-813.176) (-811.561) [-812.913] (-810.099) * [-812.130] (-808.921) (-812.599) (-808.905) -- 0:01:06
57000 -- (-809.151) [-814.055] (-811.953) (-812.375) * (-812.634) [-809.147] (-809.746) (-808.377) -- 0:01:06
57500 -- (-809.465) [-809.106] (-812.080) (-809.619) * (-813.035) (-811.103) [-809.157] (-808.174) -- 0:01:05
58000 -- [-809.308] (-809.656) (-809.900) (-809.661) * [-809.270] (-813.522) (-811.850) (-808.593) -- 0:01:04
58500 -- (-812.910) (-809.838) [-809.629] (-811.751) * (-808.880) (-811.261) [-811.895] (-808.287) -- 0:01:04
59000 -- [-810.315] (-808.662) (-811.278) (-808.521) * (-810.909) (-812.787) [-812.148] (-808.300) -- 0:01:03
59500 -- (-813.032) (-812.218) [-810.264] (-811.730) * (-812.739) (-814.539) (-811.731) [-810.498] -- 0:01:03
60000 -- (-810.190) (-811.822) (-809.937) [-810.077] * (-809.367) (-813.546) (-812.270) [-809.331] -- 0:01:02
Average standard deviation of split frequencies: 0.031452
60500 -- [-811.687] (-814.117) (-813.592) (-810.806) * (-813.851) (-811.584) [-811.466] (-808.369) -- 0:01:02
61000 -- (-811.690) (-811.783) (-815.427) [-810.634] * (-814.057) [-811.663] (-813.332) (-808.920) -- 0:01:01
61500 -- (-809.443) (-810.802) [-809.925] (-810.933) * (-809.944) [-812.479] (-814.646) (-810.897) -- 0:01:01
62000 -- (-810.517) [-811.645] (-809.282) (-810.421) * [-810.332] (-808.373) (-810.689) (-812.258) -- 0:01:00
62500 -- (-808.872) (-813.986) (-809.271) [-809.521] * (-810.982) [-809.577] (-812.013) (-808.942) -- 0:01:00
63000 -- (-814.252) (-812.924) (-811.327) [-808.369] * [-811.300] (-810.066) (-811.162) (-809.050) -- 0:00:59
63500 -- (-810.743) (-810.021) (-814.469) [-810.959] * (-811.502) (-811.377) (-810.590) [-808.852] -- 0:00:58
64000 -- (-809.301) [-811.674] (-813.376) (-809.990) * (-809.765) (-813.097) (-810.143) [-809.569] -- 0:00:58
64500 -- (-810.215) (-813.472) [-810.646] (-810.272) * [-810.398] (-809.906) (-810.967) (-810.510) -- 0:00:58
65000 -- [-809.493] (-812.860) (-812.711) (-813.564) * (-809.929) [-808.491] (-809.150) (-809.838) -- 0:00:57
Average standard deviation of split frequencies: 0.028259
65500 -- (-809.726) [-809.544] (-811.919) (-809.699) * (-813.037) (-812.290) [-809.444] (-810.111) -- 0:00:57
66000 -- (-813.267) [-811.400] (-816.301) (-809.524) * (-810.678) (-811.856) [-810.119] (-811.628) -- 0:00:56
66500 -- (-812.552) (-810.989) [-809.242] (-812.472) * (-813.711) (-810.777) [-811.428] (-813.985) -- 0:00:56
67000 -- (-810.852) (-811.026) [-812.046] (-810.112) * (-809.861) (-809.997) (-808.648) [-814.986] -- 0:00:55
67500 -- (-810.229) (-814.577) (-811.529) [-809.895] * (-811.874) (-816.498) [-809.599] (-813.885) -- 0:00:55
68000 -- (-811.464) (-812.872) (-809.385) [-808.839] * (-812.810) (-816.312) (-808.944) [-813.842] -- 0:01:08
68500 -- [-810.526] (-810.316) (-809.151) (-810.312) * (-812.896) (-814.310) [-809.016] (-812.184) -- 0:01:07
69000 -- (-808.352) [-809.960] (-810.701) (-809.862) * [-811.587] (-811.085) (-810.440) (-811.993) -- 0:01:07
69500 -- [-809.187] (-813.437) (-815.578) (-810.989) * (-811.441) [-809.917] (-810.706) (-815.225) -- 0:01:06
70000 -- (-809.268) (-816.655) [-812.657] (-810.872) * (-811.541) (-813.810) (-812.881) [-811.912] -- 0:01:06
Average standard deviation of split frequencies: 0.028589
70500 -- (-811.985) [-813.013] (-816.391) (-809.058) * [-811.254] (-813.030) (-813.229) (-811.659) -- 0:01:05
71000 -- [-812.186] (-810.990) (-818.860) (-809.843) * (-816.500) [-810.031] (-810.310) (-812.568) -- 0:01:05
71500 -- (-812.671) [-811.647] (-810.257) (-810.260) * (-821.646) (-811.343) (-811.173) [-809.296] -- 0:01:04
72000 -- [-809.895] (-809.872) (-810.237) (-809.441) * (-809.948) [-809.467] (-812.166) (-811.201) -- 0:01:04
72500 -- (-808.523) (-813.970) (-813.562) [-814.716] * (-812.155) [-812.691] (-809.167) (-810.478) -- 0:01:03
73000 -- (-808.719) [-813.479] (-814.848) (-810.676) * [-811.971] (-809.053) (-808.449) (-814.850) -- 0:01:03
73500 -- [-808.717] (-810.433) (-812.509) (-809.598) * (-811.886) (-811.421) (-808.428) [-811.651] -- 0:01:03
74000 -- [-809.297] (-812.383) (-811.331) (-809.735) * (-815.341) (-813.194) (-808.565) [-810.549] -- 0:01:02
74500 -- (-811.006) [-811.910] (-811.916) (-814.334) * (-811.320) (-813.776) (-810.024) [-808.661] -- 0:01:02
75000 -- (-815.582) [-816.712] (-812.179) (-809.127) * (-811.822) (-811.819) [-811.366] (-808.747) -- 0:01:01
Average standard deviation of split frequencies: 0.028532
75500 -- (-809.275) (-812.330) [-810.026] (-809.866) * (-811.350) (-810.447) [-810.164] (-809.697) -- 0:01:01
76000 -- [-808.610] (-812.052) (-809.032) (-810.396) * [-810.465] (-810.665) (-811.376) (-811.413) -- 0:01:00
76500 -- (-809.681) [-809.416] (-809.034) (-809.427) * [-810.572] (-810.008) (-811.636) (-813.136) -- 0:01:00
77000 -- [-810.567] (-808.577) (-808.397) (-809.031) * (-810.657) (-811.975) [-812.062] (-810.264) -- 0:00:59
77500 -- (-809.892) [-809.074] (-808.994) (-809.877) * [-813.144] (-814.925) (-812.390) (-808.808) -- 0:00:59
78000 -- (-811.577) (-809.426) (-809.732) [-809.879] * (-812.376) (-809.940) [-809.349] (-809.520) -- 0:00:59
78500 -- [-811.330] (-811.404) (-811.447) (-810.383) * (-809.423) (-811.871) [-810.636] (-808.634) -- 0:00:58
79000 -- (-809.465) (-811.078) [-814.676] (-811.140) * (-809.351) (-808.491) (-810.921) [-809.967] -- 0:00:58
79500 -- (-808.743) (-809.181) (-811.288) [-814.137] * (-809.699) (-809.441) (-809.695) [-810.654] -- 0:00:57
80000 -- [-812.355] (-809.289) (-811.693) (-810.631) * (-809.379) (-809.945) (-809.256) [-812.410] -- 0:00:57
Average standard deviation of split frequencies: 0.028912
80500 -- (-812.794) (-809.305) [-809.985] (-815.589) * [-809.512] (-808.581) (-811.169) (-810.762) -- 0:00:57
81000 -- (-808.935) [-809.292] (-809.880) (-810.484) * [-810.113] (-810.727) (-811.700) (-809.735) -- 0:00:56
81500 -- (-811.223) (-810.551) [-808.473] (-810.375) * [-811.282] (-809.271) (-810.965) (-814.054) -- 0:00:56
82000 -- (-809.385) (-811.608) (-809.138) [-810.355] * (-810.562) [-811.198] (-810.817) (-811.454) -- 0:00:55
82500 -- [-811.860] (-815.038) (-810.967) (-811.052) * (-810.620) (-812.912) [-809.306] (-811.325) -- 0:00:55
83000 -- (-812.037) [-811.771] (-812.592) (-812.504) * (-809.695) (-810.586) [-809.574] (-810.642) -- 0:00:55
83500 -- [-809.765] (-815.593) (-813.479) (-809.821) * (-809.330) (-811.976) (-811.366) [-809.536] -- 0:00:54
84000 -- (-808.999) (-814.925) [-811.772] (-809.726) * (-810.558) [-813.140] (-811.138) (-809.222) -- 0:00:54
84500 -- [-809.026] (-810.639) (-811.953) (-812.294) * (-810.727) (-817.641) (-809.834) [-809.964] -- 0:01:05
85000 -- [-808.764] (-809.850) (-810.331) (-810.571) * (-810.665) (-813.681) [-809.056] (-815.939) -- 0:01:04
Average standard deviation of split frequencies: 0.025580
85500 -- (-813.024) (-808.905) [-810.475] (-813.202) * (-809.731) (-813.467) [-810.317] (-813.926) -- 0:01:04
86000 -- (-809.675) (-814.924) (-812.945) [-809.536] * (-812.367) (-811.687) [-808.954] (-815.716) -- 0:01:03
86500 -- [-808.624] (-815.761) (-812.169) (-814.245) * [-811.506] (-811.081) (-810.122) (-814.139) -- 0:01:03
87000 -- (-810.018) [-812.105] (-813.937) (-808.449) * (-808.752) (-810.992) [-809.672] (-813.289) -- 0:01:02
87500 -- (-808.711) (-812.214) (-813.986) [-810.613] * (-809.194) (-808.971) (-809.758) [-808.674] -- 0:01:02
88000 -- (-809.131) (-808.856) (-813.985) [-809.493] * (-812.605) (-809.356) [-810.274] (-809.344) -- 0:01:02
88500 -- [-810.167] (-810.670) (-813.167) (-814.978) * (-812.076) [-809.653] (-809.191) (-810.660) -- 0:01:01
89000 -- (-810.436) (-811.878) [-811.254] (-819.521) * (-809.855) (-809.638) [-811.884] (-808.684) -- 0:01:01
89500 -- [-811.676] (-811.605) (-809.458) (-813.718) * [-810.877] (-811.452) (-812.194) (-808.471) -- 0:01:01
90000 -- [-811.752] (-813.074) (-811.269) (-811.274) * (-809.510) [-809.207] (-810.409) (-811.505) -- 0:01:00
Average standard deviation of split frequencies: 0.025006
90500 -- (-810.399) [-809.992] (-809.872) (-810.042) * (-810.679) (-813.368) [-810.557] (-810.047) -- 0:01:00
91000 -- (-810.246) (-810.955) [-809.783] (-810.063) * (-816.513) (-812.538) (-813.280) [-809.770] -- 0:00:59
91500 -- [-811.887] (-813.237) (-810.300) (-810.664) * (-808.551) (-810.950) [-811.911] (-810.702) -- 0:00:59
92000 -- (-811.186) (-811.574) (-811.342) [-810.286] * [-813.719] (-809.770) (-810.984) (-809.406) -- 0:00:59
92500 -- (-809.943) (-810.853) [-810.876] (-810.738) * (-808.868) [-809.568] (-811.312) (-809.006) -- 0:00:58
93000 -- (-810.338) [-811.137] (-809.408) (-811.067) * [-809.881] (-812.002) (-811.303) (-809.963) -- 0:00:58
93500 -- (-809.402) (-810.551) [-808.685] (-811.813) * (-811.427) [-811.763] (-812.691) (-810.060) -- 0:00:58
94000 -- (-809.169) (-813.148) (-811.906) [-809.804] * [-810.015] (-812.060) (-811.301) (-814.476) -- 0:00:57
94500 -- (-816.012) [-809.208] (-812.313) (-816.044) * [-809.909] (-813.572) (-812.158) (-811.598) -- 0:00:57
95000 -- [-811.604] (-809.230) (-813.808) (-810.527) * (-811.913) [-812.035] (-814.097) (-812.190) -- 0:00:57
Average standard deviation of split frequencies: 0.022343
95500 -- (-809.581) [-809.038] (-811.335) (-813.875) * (-814.762) [-810.569] (-810.141) (-811.194) -- 0:00:56
96000 -- (-810.908) (-810.182) (-811.511) [-809.099] * (-811.742) (-808.786) (-812.313) [-810.785] -- 0:00:56
96500 -- (-809.428) [-811.388] (-812.147) (-809.222) * (-810.852) [-810.696] (-809.367) (-808.788) -- 0:00:56
97000 -- (-809.430) (-808.472) (-808.917) [-809.988] * (-815.722) (-815.856) [-812.155] (-808.683) -- 0:00:55
97500 -- (-810.641) (-808.615) [-808.374] (-809.800) * (-812.069) (-811.943) (-810.560) [-811.767] -- 0:00:55
98000 -- (-812.322) [-809.154] (-808.394) (-808.922) * [-811.442] (-818.139) (-810.169) (-809.246) -- 0:00:55
98500 -- [-811.141] (-810.067) (-808.168) (-808.585) * (-808.875) [-814.418] (-811.050) (-810.660) -- 0:00:54
99000 -- (-812.594) (-809.252) [-809.297] (-809.462) * (-812.432) (-811.217) [-812.650] (-813.368) -- 0:00:54
99500 -- (-813.206) [-810.303] (-809.459) (-809.494) * (-811.765) [-813.239] (-810.670) (-809.763) -- 0:00:54
100000 -- [-809.840] (-811.442) (-808.272) (-809.145) * (-809.810) (-808.906) [-811.518] (-810.806) -- 0:00:54
Average standard deviation of split frequencies: 0.021307
100500 -- (-808.601) (-813.558) (-808.861) [-808.796] * (-811.483) (-810.442) [-809.893] (-809.508) -- 0:01:02
101000 -- (-811.383) (-813.063) (-811.817) [-808.754] * (-812.266) (-809.235) [-808.401] (-810.629) -- 0:01:02
101500 -- [-812.573] (-813.033) (-810.021) (-809.367) * (-812.427) (-810.977) (-808.490) [-808.568] -- 0:01:01
102000 -- [-809.866] (-820.050) (-810.305) (-809.606) * (-813.601) [-809.219] (-809.897) (-808.828) -- 0:01:01
102500 -- [-809.174] (-816.225) (-810.547) (-808.762) * (-816.200) (-814.966) [-810.906] (-811.064) -- 0:01:01
103000 -- (-810.322) (-811.146) [-809.889] (-809.784) * (-813.076) (-813.697) [-809.743] (-811.491) -- 0:01:00
103500 -- (-810.905) (-812.376) [-811.236] (-812.121) * (-811.596) (-808.544) [-810.127] (-812.223) -- 0:01:00
104000 -- (-811.258) (-809.592) [-810.120] (-811.458) * (-809.846) [-810.058] (-811.754) (-813.815) -- 0:01:00
104500 -- [-811.440] (-809.486) (-811.089) (-810.973) * (-811.354) [-809.633] (-811.442) (-812.078) -- 0:00:59
105000 -- (-810.514) [-809.558] (-809.535) (-812.637) * [-810.461] (-811.335) (-810.715) (-817.209) -- 0:00:59
Average standard deviation of split frequencies: 0.019059
105500 -- [-810.133] (-811.406) (-815.470) (-811.205) * [-812.376] (-813.854) (-808.504) (-816.690) -- 0:00:59
106000 -- (-810.638) (-810.995) (-811.627) [-809.986] * (-809.814) (-810.336) (-810.760) [-813.141] -- 0:00:59
106500 -- [-810.484] (-811.465) (-811.198) (-814.646) * (-811.844) (-810.800) [-810.744] (-817.792) -- 0:00:58
107000 -- [-809.279] (-809.907) (-811.026) (-810.495) * (-809.613) (-812.879) [-810.186] (-815.551) -- 0:00:58
107500 -- [-811.286] (-814.321) (-810.461) (-812.462) * (-810.150) (-813.176) [-809.041] (-811.398) -- 0:00:58
108000 -- [-809.820] (-811.701) (-812.546) (-811.681) * (-809.065) [-813.136] (-809.619) (-812.675) -- 0:00:57
108500 -- [-812.129] (-810.834) (-812.303) (-810.808) * (-811.619) (-812.645) [-810.175] (-812.974) -- 0:00:57
109000 -- (-810.580) [-810.776] (-811.087) (-813.676) * [-810.663] (-811.896) (-810.787) (-813.271) -- 0:00:57
109500 -- (-808.395) (-813.117) [-812.349] (-812.453) * (-810.230) [-809.854] (-810.629) (-811.723) -- 0:00:56
110000 -- [-810.854] (-812.654) (-811.645) (-813.704) * (-809.718) (-808.623) (-810.307) [-813.181] -- 0:00:56
Average standard deviation of split frequencies: 0.018256
110500 -- [-810.415] (-812.753) (-814.658) (-812.054) * (-810.404) [-811.356] (-813.359) (-811.675) -- 0:00:56
111000 -- (-811.709) (-812.658) [-809.132] (-809.218) * (-813.696) (-811.239) [-810.248] (-808.513) -- 0:00:56
111500 -- [-810.799] (-808.788) (-811.183) (-809.684) * [-808.220] (-813.022) (-809.992) (-809.580) -- 0:00:55
112000 -- (-814.279) [-812.017] (-809.128) (-811.211) * (-809.332) [-814.110] (-809.901) (-814.783) -- 0:00:55
112500 -- (-812.359) (-809.191) [-809.833] (-810.310) * [-808.984] (-812.094) (-808.452) (-811.709) -- 0:00:55
113000 -- (-816.037) [-809.432] (-814.854) (-809.210) * [-809.713] (-812.170) (-810.949) (-810.234) -- 0:00:54
113500 -- (-814.134) [-808.728] (-810.157) (-809.482) * (-811.049) [-811.058] (-813.879) (-811.590) -- 0:00:54
114000 -- (-814.733) (-808.388) (-810.817) [-811.127] * (-811.053) (-816.828) (-814.010) [-811.557] -- 0:00:54
114500 -- [-813.251] (-808.454) (-810.221) (-809.235) * (-814.538) (-814.175) [-808.774] (-808.212) -- 0:00:54
115000 -- (-817.473) [-808.331] (-810.171) (-809.752) * (-811.900) (-810.834) [-808.478] (-810.126) -- 0:00:53
Average standard deviation of split frequencies: 0.017029
115500 -- (-816.704) (-811.984) (-811.673) [-813.659] * (-812.989) (-810.974) (-810.887) [-809.392] -- 0:00:53
116000 -- [-812.545] (-811.665) (-809.912) (-812.221) * (-813.929) (-809.047) [-808.898] (-811.311) -- 0:00:53
116500 -- (-809.705) (-809.852) (-809.446) [-810.440] * [-809.715] (-809.773) (-809.230) (-809.246) -- 0:00:53
117000 -- (-809.002) (-810.230) [-809.906] (-813.366) * [-810.453] (-812.281) (-808.534) (-811.291) -- 0:01:00
117500 -- (-810.338) [-810.061] (-810.289) (-814.064) * (-810.463) (-810.151) [-815.213] (-812.196) -- 0:01:00
118000 -- (-809.370) [-809.917] (-810.985) (-810.846) * (-818.729) (-810.666) [-809.428] (-810.836) -- 0:00:59
118500 -- (-811.845) [-813.938] (-811.465) (-811.683) * (-815.951) (-810.603) (-809.888) [-808.547] -- 0:00:59
119000 -- (-810.882) (-810.513) [-810.471] (-811.914) * (-810.294) (-813.702) (-810.456) [-814.822] -- 0:00:59
119500 -- (-812.063) (-811.200) [-809.979] (-814.680) * [-813.006] (-810.056) (-809.953) (-814.925) -- 0:00:58
120000 -- (-814.115) (-815.117) [-811.965] (-812.561) * [-809.550] (-811.115) (-810.132) (-809.301) -- 0:00:58
Average standard deviation of split frequencies: 0.016213
120500 -- (-810.831) (-808.558) (-810.603) [-810.086] * (-811.313) (-810.457) (-816.395) [-808.573] -- 0:00:58
121000 -- (-809.910) [-808.323] (-810.002) (-812.283) * (-811.062) [-809.791] (-810.748) (-809.237) -- 0:00:58
121500 -- [-810.776] (-808.581) (-810.982) (-813.623) * (-811.438) (-810.223) (-814.963) [-809.648] -- 0:00:57
122000 -- (-810.147) (-808.382) [-811.696] (-811.266) * (-812.110) [-808.619] (-811.566) (-812.151) -- 0:00:57
122500 -- (-811.540) [-810.165] (-813.763) (-811.781) * (-812.925) (-811.781) [-811.132] (-812.371) -- 0:00:57
123000 -- (-809.614) [-808.691] (-810.459) (-811.094) * (-813.412) (-810.555) [-813.786] (-809.643) -- 0:00:57
123500 -- (-809.585) [-808.815] (-808.681) (-809.224) * (-812.671) (-812.018) [-812.518] (-811.022) -- 0:00:56
124000 -- (-810.566) (-810.424) [-808.570] (-811.270) * (-814.069) [-810.655] (-814.082) (-810.022) -- 0:00:56
124500 -- (-809.364) (-810.359) [-808.692] (-811.485) * (-811.184) (-811.414) (-811.044) [-809.244] -- 0:00:56
125000 -- [-809.783] (-813.160) (-813.833) (-812.593) * (-809.203) (-814.967) [-810.846] (-808.822) -- 0:00:56
Average standard deviation of split frequencies: 0.013656
125500 -- [-809.907] (-811.914) (-816.507) (-811.803) * (-810.579) (-813.056) (-810.667) [-812.694] -- 0:00:55
126000 -- [-809.911] (-811.614) (-810.563) (-814.157) * (-815.163) (-809.633) (-810.440) [-808.961] -- 0:00:55
126500 -- (-810.911) (-810.742) [-811.080] (-811.596) * (-811.267) [-809.068] (-811.953) (-808.578) -- 0:00:55
127000 -- (-810.247) (-816.359) [-810.499] (-810.672) * (-810.832) (-809.010) (-808.437) [-812.850] -- 0:00:54
127500 -- [-809.645] (-811.447) (-811.096) (-809.327) * [-808.888] (-809.969) (-810.706) (-814.937) -- 0:00:54
128000 -- (-809.599) [-810.350] (-811.851) (-810.078) * (-812.421) [-811.142] (-815.056) (-814.354) -- 0:00:54
128500 -- [-809.666] (-808.996) (-810.713) (-809.506) * (-809.951) [-809.609] (-814.512) (-809.131) -- 0:00:54
129000 -- [-809.148] (-808.575) (-812.882) (-811.655) * (-811.517) [-811.826] (-808.688) (-809.798) -- 0:00:54
129500 -- (-809.259) (-808.779) (-809.042) [-810.213] * (-811.761) [-815.746] (-810.212) (-811.714) -- 0:00:53
130000 -- [-809.791] (-808.720) (-813.015) (-811.165) * (-815.848) [-811.229] (-811.197) (-808.493) -- 0:00:53
Average standard deviation of split frequencies: 0.015000
130500 -- (-809.226) (-814.024) [-809.929] (-811.296) * (-813.260) [-809.226] (-810.951) (-809.121) -- 0:00:53
131000 -- [-811.551] (-811.325) (-809.136) (-810.803) * (-812.331) (-809.500) (-810.612) [-811.188] -- 0:00:53
131500 -- (-811.071) (-810.341) [-809.351] (-810.376) * [-812.589] (-809.479) (-809.659) (-809.699) -- 0:00:52
132000 -- (-810.786) (-809.162) [-808.809] (-810.037) * (-810.090) [-809.825] (-811.567) (-811.201) -- 0:00:52
132500 -- (-810.396) [-809.260] (-809.366) (-810.075) * [-816.157] (-810.906) (-810.758) (-810.602) -- 0:00:52
133000 -- (-808.859) (-810.731) [-808.582] (-809.098) * [-809.741] (-810.482) (-810.755) (-809.667) -- 0:00:52
133500 -- [-814.708] (-810.495) (-808.858) (-811.272) * (-812.652) [-809.941] (-810.154) (-810.679) -- 0:00:51
134000 -- (-813.278) [-810.987] (-808.986) (-811.684) * [-809.735] (-810.290) (-808.472) (-812.646) -- 0:00:58
134500 -- (-810.646) [-810.789] (-809.495) (-810.600) * (-808.987) (-811.282) [-811.975] (-813.465) -- 0:00:57
135000 -- (-811.564) (-810.732) (-810.148) [-813.483] * (-808.854) (-810.722) [-811.043] (-812.285) -- 0:00:57
Average standard deviation of split frequencies: 0.015251
135500 -- (-812.629) (-812.057) [-811.385] (-814.496) * (-809.793) (-809.322) [-809.508] (-812.083) -- 0:00:57
136000 -- (-810.776) [-809.984] (-810.301) (-810.961) * [-809.045] (-814.852) (-809.527) (-809.277) -- 0:00:57
136500 -- [-809.666] (-810.592) (-812.739) (-809.223) * (-808.789) (-810.693) (-809.854) [-810.552] -- 0:00:56
137000 -- (-811.011) [-810.173] (-812.162) (-811.182) * (-811.926) [-808.286] (-812.153) (-809.862) -- 0:00:56
137500 -- (-810.540) (-808.606) [-809.641] (-809.113) * [-811.262] (-809.127) (-808.920) (-812.112) -- 0:00:56
138000 -- (-808.676) [-809.515] (-809.473) (-813.083) * (-811.201) (-808.705) [-808.878] (-809.069) -- 0:00:56
138500 -- (-808.618) [-810.383] (-809.684) (-810.964) * (-809.967) (-808.824) (-809.895) [-809.068] -- 0:00:55
139000 -- (-810.254) [-810.220] (-816.943) (-811.744) * (-816.161) (-808.978) [-808.806] (-812.722) -- 0:00:55
139500 -- (-811.458) [-808.866] (-812.247) (-812.819) * (-810.583) [-809.875] (-812.042) (-810.133) -- 0:00:55
140000 -- (-810.767) [-808.881] (-808.397) (-808.742) * [-810.099] (-812.225) (-810.431) (-809.291) -- 0:00:55
Average standard deviation of split frequencies: 0.015825
140500 -- (-810.128) [-810.281] (-810.702) (-809.668) * (-810.914) (-808.906) [-808.860] (-809.506) -- 0:00:55
141000 -- (-814.294) (-810.204) [-809.183] (-812.311) * (-811.443) (-813.414) (-811.126) [-811.507] -- 0:00:54
141500 -- (-812.666) (-810.243) (-809.108) [-811.341] * (-812.974) (-810.932) [-808.414] (-809.199) -- 0:00:54
142000 -- [-809.406] (-810.310) (-809.755) (-814.375) * (-810.131) [-810.702] (-810.818) (-813.031) -- 0:00:54
142500 -- [-808.496] (-810.310) (-813.438) (-815.114) * (-812.023) [-814.935] (-810.490) (-812.284) -- 0:00:54
143000 -- (-810.402) (-810.672) (-808.399) [-810.613] * (-808.845) [-811.825] (-810.629) (-811.335) -- 0:00:53
143500 -- (-810.321) (-810.270) (-809.179) [-809.358] * (-809.711) (-815.598) [-810.445] (-811.234) -- 0:00:53
144000 -- (-811.765) (-811.968) [-810.193] (-808.992) * [-809.949] (-810.366) (-809.366) (-811.381) -- 0:00:53
144500 -- [-810.843] (-812.710) (-809.347) (-809.325) * (-811.017) [-809.616] (-810.449) (-811.436) -- 0:00:53
145000 -- [-811.343] (-812.357) (-813.363) (-809.377) * [-808.231] (-809.095) (-810.001) (-810.806) -- 0:00:53
Average standard deviation of split frequencies: 0.015974
145500 -- (-809.088) (-813.476) (-809.951) [-813.203] * (-808.447) (-810.398) (-808.820) [-809.801] -- 0:00:52
146000 -- (-809.754) [-813.204] (-811.943) (-811.627) * (-809.297) (-810.525) [-810.568] (-811.166) -- 0:00:52
146500 -- (-810.446) (-808.887) (-812.536) [-809.886] * (-809.928) [-810.500] (-809.781) (-809.856) -- 0:00:52
147000 -- (-808.730) (-811.790) (-811.671) [-810.615] * [-811.732] (-810.676) (-809.840) (-813.288) -- 0:00:52
147500 -- (-812.640) (-814.403) (-808.417) [-809.981] * (-811.239) [-811.508] (-813.248) (-814.100) -- 0:00:52
148000 -- (-818.146) [-810.665] (-810.440) (-813.278) * (-810.527) (-813.975) (-813.862) [-812.618] -- 0:00:51
148500 -- (-811.087) (-810.114) (-814.223) [-811.376] * (-814.117) (-810.704) (-810.529) [-810.986] -- 0:00:51
149000 -- (-809.048) (-809.293) [-821.862] (-811.095) * (-815.442) (-808.818) (-812.924) [-810.690] -- 0:00:51
149500 -- (-810.394) (-810.548) (-811.090) [-810.683] * (-814.430) (-809.114) (-811.427) [-809.347] -- 0:00:51
150000 -- (-811.805) (-813.697) [-809.433] (-809.255) * [-809.456] (-812.718) (-811.068) (-809.998) -- 0:00:51
Average standard deviation of split frequencies: 0.016632
150500 -- (-810.213) (-808.430) [-809.619] (-810.203) * (-808.473) [-810.038] (-810.380) (-815.500) -- 0:00:56
151000 -- (-810.798) [-809.989] (-810.371) (-809.838) * (-808.622) [-809.889] (-809.868) (-811.817) -- 0:00:56
151500 -- (-812.653) (-811.219) [-812.477] (-809.444) * (-809.197) (-811.212) [-808.543] (-811.191) -- 0:00:56
152000 -- (-809.447) (-810.131) [-810.664] (-808.474) * (-808.796) (-810.536) (-810.812) [-811.226] -- 0:00:55
152500 -- [-809.233] (-809.332) (-810.513) (-811.094) * [-809.202] (-810.766) (-811.034) (-810.215) -- 0:00:55
153000 -- [-809.871] (-809.202) (-811.702) (-812.477) * (-809.552) [-810.179] (-810.233) (-814.783) -- 0:00:55
153500 -- (-810.742) (-808.682) [-809.095] (-813.454) * (-809.166) [-809.898] (-810.630) (-811.307) -- 0:00:55
154000 -- (-810.151) [-808.608] (-812.470) (-811.962) * [-810.543] (-809.687) (-810.204) (-810.822) -- 0:00:54
154500 -- (-809.156) (-811.209) (-809.359) [-811.698] * (-810.633) [-809.152] (-811.199) (-809.572) -- 0:00:54
155000 -- (-808.126) (-810.723) [-812.209] (-809.684) * [-811.448] (-809.557) (-812.141) (-811.926) -- 0:00:54
Average standard deviation of split frequencies: 0.014605
155500 -- (-810.055) (-810.009) [-812.826] (-816.431) * [-810.237] (-810.827) (-811.119) (-811.070) -- 0:00:54
156000 -- (-810.121) (-810.972) [-811.711] (-812.475) * (-813.639) (-810.518) [-810.480] (-810.586) -- 0:00:54
156500 -- (-811.646) [-809.998] (-808.337) (-813.842) * (-811.487) [-809.202] (-809.304) (-811.216) -- 0:00:53
157000 -- (-809.503) (-810.714) [-808.341] (-815.284) * (-810.472) (-809.866) (-810.001) [-810.756] -- 0:00:53
157500 -- [-809.350] (-814.016) (-812.446) (-816.225) * [-808.490] (-808.837) (-811.139) (-811.002) -- 0:00:53
158000 -- (-809.350) (-817.042) (-815.445) [-808.689] * (-809.973) [-809.015] (-810.806) (-812.500) -- 0:00:53
158500 -- (-812.361) (-809.151) (-812.131) [-809.788] * (-808.963) (-811.682) [-808.788] (-810.212) -- 0:00:53
159000 -- (-811.472) (-811.495) (-812.551) [-809.510] * [-810.932] (-808.629) (-808.656) (-809.385) -- 0:00:52
159500 -- (-809.881) (-809.071) [-809.192] (-810.252) * [-808.628] (-812.276) (-812.238) (-810.521) -- 0:00:52
160000 -- (-809.528) (-812.075) [-811.051] (-811.995) * [-810.231] (-809.500) (-811.925) (-810.247) -- 0:00:52
Average standard deviation of split frequencies: 0.014825
160500 -- (-810.272) (-813.167) [-810.587] (-811.040) * (-810.296) (-810.798) (-813.096) [-809.779] -- 0:00:52
161000 -- (-811.038) (-810.420) (-810.720) [-809.470] * [-811.359] (-809.150) (-817.092) (-814.757) -- 0:00:52
161500 -- (-812.123) (-812.607) (-809.911) [-809.748] * (-808.622) (-810.157) (-812.585) [-810.854] -- 0:00:51
162000 -- (-810.169) (-809.950) (-815.372) [-810.408] * (-808.204) (-813.424) (-809.134) [-809.666] -- 0:00:51
162500 -- (-808.870) [-809.391] (-812.598) (-811.909) * (-808.407) [-810.769] (-811.897) (-811.610) -- 0:00:51
163000 -- [-810.366] (-809.457) (-810.894) (-811.379) * [-809.335] (-808.606) (-811.535) (-808.860) -- 0:00:51
163500 -- (-812.777) (-809.031) [-808.996] (-812.699) * (-809.211) (-809.961) [-811.684] (-810.970) -- 0:00:51
164000 -- (-811.723) [-809.600] (-810.045) (-814.215) * [-809.052] (-810.692) (-811.990) (-811.003) -- 0:00:50
164500 -- (-812.066) (-809.432) [-810.202] (-809.969) * (-808.333) (-810.540) [-808.239] (-812.096) -- 0:00:50
165000 -- (-812.593) [-812.202] (-808.973) (-809.774) * (-810.867) (-810.204) [-813.895] (-813.696) -- 0:00:50
Average standard deviation of split frequencies: 0.015477
165500 -- (-812.039) [-812.436] (-810.649) (-811.307) * (-809.803) (-812.924) (-808.668) [-813.779] -- 0:00:50
166000 -- [-809.935] (-812.083) (-811.209) (-811.072) * (-812.997) (-810.208) (-809.145) [-814.681] -- 0:00:50
166500 -- (-809.582) (-810.759) [-810.659] (-809.759) * [-816.013] (-809.871) (-808.663) (-811.528) -- 0:00:50
167000 -- (-810.826) (-811.568) (-811.778) [-811.737] * [-811.155] (-809.443) (-808.452) (-809.225) -- 0:00:49
167500 -- (-810.946) (-810.995) (-812.079) [-813.265] * [-811.243] (-809.203) (-810.330) (-810.930) -- 0:00:54
168000 -- (-809.465) [-811.629] (-812.015) (-810.144) * (-810.547) (-809.053) [-812.645] (-812.996) -- 0:00:54
168500 -- [-810.371] (-810.107) (-811.093) (-809.777) * (-814.475) (-813.237) [-811.436] (-811.420) -- 0:00:54
169000 -- (-813.013) [-810.029] (-809.662) (-811.305) * [-813.075] (-815.730) (-813.013) (-816.163) -- 0:00:54
169500 -- (-810.904) (-808.726) (-809.293) [-810.402] * (-812.886) (-812.213) [-812.072] (-810.177) -- 0:00:53
170000 -- (-810.999) (-808.247) [-808.176] (-810.872) * (-809.091) [-811.140] (-809.395) (-809.634) -- 0:00:53
Average standard deviation of split frequencies: 0.015882
170500 -- [-809.035] (-811.405) (-809.287) (-810.872) * [-810.129] (-813.802) (-810.543) (-812.723) -- 0:00:53
171000 -- [-808.999] (-810.548) (-809.918) (-808.809) * [-811.397] (-813.427) (-811.953) (-809.462) -- 0:00:53
171500 -- (-809.112) (-813.242) (-810.438) [-808.670] * (-810.879) (-809.458) (-809.187) [-809.783] -- 0:00:53
172000 -- (-819.814) (-810.294) [-810.964] (-808.461) * [-812.337] (-809.540) (-810.020) (-809.539) -- 0:00:52
172500 -- (-809.618) (-809.001) [-812.847] (-810.045) * (-813.177) (-815.878) (-814.269) [-812.213] -- 0:00:52
173000 -- (-809.012) [-810.934] (-809.665) (-808.642) * (-810.044) (-810.742) (-811.138) [-810.450] -- 0:00:52
173500 -- (-809.111) [-810.222] (-811.370) (-809.038) * (-809.367) [-812.091] (-814.908) (-809.817) -- 0:00:52
174000 -- (-809.470) [-810.221] (-810.178) (-809.298) * (-811.615) [-808.687] (-809.017) (-810.489) -- 0:00:52
174500 -- (-809.286) (-811.270) [-814.820] (-812.666) * (-811.226) (-809.327) (-808.975) [-808.626] -- 0:00:52
175000 -- (-814.742) (-809.002) [-812.941] (-811.054) * [-809.192] (-811.635) (-810.318) (-809.775) -- 0:00:51
Average standard deviation of split frequencies: 0.015648
175500 -- (-810.831) [-809.019] (-809.016) (-810.394) * (-809.226) [-808.815] (-810.022) (-810.330) -- 0:00:51
176000 -- [-809.916] (-808.876) (-809.412) (-810.107) * (-811.018) (-809.048) (-808.902) [-812.691] -- 0:00:51
176500 -- [-809.089] (-808.386) (-809.999) (-810.492) * [-810.931] (-816.122) (-809.460) (-809.173) -- 0:00:51
177000 -- [-810.282] (-808.416) (-810.473) (-810.700) * (-810.132) (-810.808) (-810.021) [-808.997] -- 0:00:51
177500 -- [-810.315] (-809.025) (-809.998) (-815.596) * (-810.692) (-810.033) [-808.756] (-809.348) -- 0:00:50
178000 -- [-809.649] (-812.651) (-812.179) (-815.065) * (-814.930) (-808.734) [-808.848] (-810.452) -- 0:00:50
178500 -- (-809.150) (-810.719) (-808.720) [-809.865] * (-810.614) [-808.950] (-809.731) (-813.244) -- 0:00:50
179000 -- [-809.248] (-809.079) (-812.834) (-811.365) * (-811.395) [-808.902] (-809.823) (-813.262) -- 0:00:50
179500 -- (-809.974) (-810.539) [-808.937] (-808.390) * (-813.965) (-811.265) [-809.251] (-811.108) -- 0:00:50
180000 -- (-809.317) (-810.137) [-809.781] (-812.667) * (-811.178) [-810.317] (-809.412) (-809.609) -- 0:00:50
Average standard deviation of split frequencies: 0.013916
180500 -- (-811.630) [-808.728] (-813.397) (-811.392) * (-808.703) (-811.010) (-809.947) [-809.601] -- 0:00:49
181000 -- (-812.136) (-809.135) [-811.136] (-813.184) * (-809.956) (-812.674) (-809.086) [-809.275] -- 0:00:49
181500 -- (-813.405) (-809.461) (-811.258) [-810.339] * [-816.516] (-809.323) (-809.760) (-809.062) -- 0:00:49
182000 -- [-810.123] (-811.522) (-812.606) (-825.621) * (-813.951) [-808.882] (-808.767) (-809.166) -- 0:00:49
182500 -- (-813.006) [-810.700] (-812.888) (-813.120) * (-809.753) (-808.575) (-809.499) [-809.043] -- 0:00:49
183000 -- (-814.445) [-809.230] (-809.747) (-811.670) * (-813.063) (-811.446) (-808.747) [-810.538] -- 0:00:49
183500 -- (-810.011) (-809.225) [-808.519] (-810.344) * [-809.875] (-811.174) (-809.958) (-813.894) -- 0:00:48
184000 -- (-808.950) [-809.126] (-811.056) (-810.143) * (-809.459) [-810.908] (-810.709) (-810.266) -- 0:00:48
184500 -- (-812.004) (-808.936) (-809.556) [-809.569] * [-809.148] (-811.860) (-811.639) (-808.474) -- 0:00:53
185000 -- (-810.163) (-809.378) [-812.559] (-811.326) * (-809.980) (-809.364) (-813.209) [-809.470] -- 0:00:52
Average standard deviation of split frequencies: 0.014273
185500 -- (-809.415) (-809.307) [-812.096] (-810.828) * [-811.006] (-811.356) (-811.867) (-810.428) -- 0:00:52
186000 -- [-809.159] (-809.895) (-809.469) (-809.007) * (-810.811) (-809.399) [-809.769] (-809.631) -- 0:00:52
186500 -- [-812.843] (-814.410) (-812.228) (-808.936) * (-808.829) [-809.507] (-809.590) (-811.563) -- 0:00:52
187000 -- (-813.196) (-810.523) (-809.916) [-809.485] * [-810.129] (-808.542) (-810.637) (-815.656) -- 0:00:52
187500 -- (-815.600) (-810.608) (-810.183) [-813.595] * (-810.031) (-808.837) [-811.853] (-809.973) -- 0:00:52
188000 -- (-813.804) (-809.574) [-810.164] (-813.589) * (-808.679) [-809.011] (-809.121) (-809.105) -- 0:00:51
188500 -- (-811.647) (-810.879) (-810.013) [-809.694] * [-808.849] (-811.318) (-810.125) (-809.663) -- 0:00:51
189000 -- [-811.009] (-810.451) (-810.922) (-811.518) * [-810.655] (-810.840) (-809.892) (-809.741) -- 0:00:51
189500 -- (-809.912) [-811.060] (-811.761) (-810.352) * (-809.420) (-811.238) [-810.045] (-815.406) -- 0:00:51
190000 -- (-811.125) (-810.605) [-810.109] (-812.006) * (-809.309) (-812.957) [-809.205] (-811.318) -- 0:00:51
Average standard deviation of split frequencies: 0.014422
190500 -- (-810.758) (-809.223) [-810.016] (-811.099) * [-809.851] (-809.416) (-808.276) (-808.968) -- 0:00:50
191000 -- (-809.850) (-809.600) (-809.247) [-809.835] * (-809.538) (-809.112) (-813.754) [-811.605] -- 0:00:50
191500 -- (-810.858) [-809.426] (-811.954) (-811.783) * (-810.657) (-813.797) [-811.276] (-808.541) -- 0:00:50
192000 -- (-810.426) (-810.451) [-813.191] (-811.154) * (-809.637) [-812.590] (-810.016) (-809.708) -- 0:00:50
192500 -- (-810.394) (-809.061) (-811.883) [-810.724] * (-809.124) [-814.074] (-812.819) (-811.040) -- 0:00:50
193000 -- (-809.493) (-809.713) (-809.719) [-810.698] * [-808.746] (-814.569) (-811.071) (-810.168) -- 0:00:50
193500 -- (-811.545) (-810.954) [-809.203] (-809.312) * (-808.526) [-809.723] (-811.433) (-813.157) -- 0:00:50
194000 -- [-809.969] (-810.965) (-809.478) (-809.552) * [-808.898] (-810.493) (-810.995) (-810.262) -- 0:00:49
194500 -- (-811.039) [-811.823] (-809.447) (-809.624) * [-808.879] (-808.972) (-809.304) (-810.103) -- 0:00:49
195000 -- (-811.978) [-811.726] (-810.092) (-809.344) * (-808.607) (-808.773) [-809.265] (-809.513) -- 0:00:49
Average standard deviation of split frequencies: 0.013763
195500 -- (-809.960) (-810.611) [-808.956] (-810.675) * (-808.930) (-813.710) (-810.999) [-809.443] -- 0:00:49
196000 -- (-809.200) (-810.291) (-811.118) [-809.539] * (-809.573) (-810.290) [-811.077] (-809.155) -- 0:00:49
196500 -- (-808.997) [-809.427] (-811.832) (-809.646) * (-810.493) [-808.968] (-810.177) (-813.399) -- 0:00:49
197000 -- (-810.577) [-812.825] (-809.384) (-811.436) * (-808.963) (-811.203) [-809.589] (-808.905) -- 0:00:48
197500 -- [-809.010] (-811.217) (-809.672) (-808.516) * (-812.686) (-810.786) [-811.616] (-810.801) -- 0:00:48
198000 -- (-808.952) (-809.643) [-809.967] (-809.171) * (-809.626) [-811.970] (-812.310) (-812.242) -- 0:00:48
198500 -- (-812.389) (-810.343) [-810.457] (-810.058) * (-810.042) (-815.683) [-809.723] (-811.593) -- 0:00:48
199000 -- (-809.799) (-812.160) (-809.615) [-809.140] * (-813.953) [-812.717] (-810.447) (-810.243) -- 0:00:48
199500 -- [-808.875] (-813.133) (-810.694) (-811.177) * (-810.090) (-813.130) [-810.798] (-809.678) -- 0:00:48
200000 -- [-809.976] (-812.780) (-809.838) (-811.851) * (-810.978) [-809.737] (-811.262) (-811.530) -- 0:00:48
Average standard deviation of split frequencies: 0.015270
200500 -- (-810.156) [-809.656] (-809.805) (-808.886) * (-808.534) (-810.649) [-808.739] (-812.385) -- 0:00:51
201000 -- (-810.699) [-809.197] (-809.315) (-809.741) * (-811.837) (-808.972) (-808.580) [-813.262] -- 0:00:51
201500 -- [-810.438] (-811.027) (-808.622) (-810.984) * (-809.070) (-809.363) (-815.189) [-810.086] -- 0:00:51
202000 -- (-809.882) [-812.350] (-809.872) (-810.796) * (-809.545) (-810.138) [-814.645] (-810.743) -- 0:00:51
202500 -- (-812.557) (-809.650) [-810.220] (-811.968) * (-809.413) [-810.739] (-811.058) (-816.621) -- 0:00:51
203000 -- (-811.389) (-809.594) (-810.633) [-811.619] * (-813.103) (-810.176) [-810.534] (-812.680) -- 0:00:51
203500 -- (-809.856) [-809.329] (-812.488) (-809.335) * [-814.096] (-810.707) (-808.832) (-809.253) -- 0:00:50
204000 -- [-814.108] (-809.679) (-812.363) (-809.161) * (-810.989) (-809.793) (-808.832) [-810.514] -- 0:00:50
204500 -- (-811.263) [-810.321] (-813.574) (-810.754) * (-810.207) [-808.837] (-808.452) (-811.201) -- 0:00:50
205000 -- (-812.509) [-812.679] (-808.906) (-809.267) * (-810.704) (-808.948) [-812.821] (-812.051) -- 0:00:50
Average standard deviation of split frequencies: 0.013984
205500 -- (-810.528) (-809.758) [-809.241] (-811.206) * [-809.786] (-810.550) (-811.689) (-811.682) -- 0:00:50
206000 -- (-809.647) (-810.006) [-811.117] (-811.319) * (-808.495) [-811.664] (-809.973) (-813.339) -- 0:00:50
206500 -- (-810.854) (-810.646) (-811.410) [-813.409] * (-808.699) [-810.500] (-809.019) (-813.807) -- 0:00:49
207000 -- (-810.090) (-811.434) (-813.405) [-808.777] * (-809.993) (-810.013) (-809.708) [-813.721] -- 0:00:49
207500 -- (-812.732) (-810.013) [-808.902] (-808.994) * (-812.199) (-808.953) (-809.566) [-811.744] -- 0:00:49
208000 -- (-812.702) [-808.397] (-809.186) (-809.974) * (-810.836) (-810.928) [-808.702] (-811.500) -- 0:00:49
208500 -- (-812.776) [-809.345] (-809.618) (-813.484) * (-812.595) (-810.415) [-809.747] (-810.315) -- 0:00:49
209000 -- (-809.996) (-809.841) [-809.313] (-814.115) * [-810.845] (-809.060) (-808.362) (-811.710) -- 0:00:49
209500 -- (-809.480) [-810.957] (-815.116) (-810.909) * [-811.917] (-813.125) (-810.559) (-809.334) -- 0:00:49
210000 -- (-811.599) [-810.937] (-811.852) (-811.767) * (-811.322) (-810.559) (-809.054) [-809.604] -- 0:00:48
Average standard deviation of split frequencies: 0.014794
210500 -- (-809.842) (-812.003) (-810.887) [-812.006] * [-810.862] (-808.771) (-809.701) (-809.221) -- 0:00:48
211000 -- (-809.767) (-813.629) (-812.029) [-811.240] * (-808.396) [-808.620] (-809.113) (-809.446) -- 0:00:48
211500 -- (-808.694) (-811.284) [-809.080] (-811.067) * (-811.476) (-808.294) (-810.954) [-811.471] -- 0:00:48
212000 -- (-810.960) [-810.807] (-811.602) (-810.722) * [-810.037] (-813.280) (-812.553) (-811.174) -- 0:00:48
212500 -- [-809.643] (-809.171) (-810.051) (-812.817) * (-810.815) (-809.209) (-812.787) [-810.027] -- 0:00:48
213000 -- (-809.468) [-809.539] (-810.734) (-814.582) * (-810.485) (-810.743) (-810.438) [-810.472] -- 0:00:48
213500 -- [-810.311] (-809.301) (-811.877) (-813.008) * (-811.330) [-808.776] (-813.749) (-811.064) -- 0:00:47
214000 -- (-809.269) (-811.350) [-808.912] (-813.911) * (-809.200) (-809.473) [-808.661] (-811.118) -- 0:00:47
214500 -- (-809.141) [-810.539] (-810.128) (-809.253) * (-808.944) (-810.748) [-808.950] (-811.333) -- 0:00:47
215000 -- (-812.772) [-808.597] (-814.988) (-808.800) * [-814.369] (-809.625) (-809.322) (-808.459) -- 0:00:47
Average standard deviation of split frequencies: 0.014243
215500 -- [-812.536] (-808.821) (-814.174) (-808.963) * (-812.609) [-809.911] (-809.294) (-813.161) -- 0:00:47
216000 -- (-810.887) (-809.032) [-811.685] (-811.623) * (-810.661) [-809.520] (-808.695) (-812.329) -- 0:00:47
216500 -- (-813.640) (-809.161) (-810.843) [-812.210] * [-811.475] (-811.201) (-809.414) (-813.084) -- 0:00:47
217000 -- [-810.623] (-812.163) (-811.226) (-811.959) * (-810.964) (-812.357) [-809.379] (-813.569) -- 0:00:46
217500 -- (-811.100) [-809.702] (-812.198) (-811.591) * (-810.042) [-810.730] (-809.710) (-819.295) -- 0:00:50
218000 -- (-811.048) [-810.268] (-811.803) (-810.459) * [-811.165] (-813.141) (-811.544) (-817.354) -- 0:00:50
218500 -- (-810.311) (-810.726) (-810.864) [-810.773] * (-814.284) [-814.567] (-811.774) (-820.060) -- 0:00:50
219000 -- [-809.401] (-813.464) (-808.744) (-810.351) * [-809.837] (-813.688) (-809.016) (-815.780) -- 0:00:49
219500 -- (-810.803) (-811.957) (-808.528) [-810.280] * (-810.961) (-811.586) [-809.526] (-815.178) -- 0:00:49
220000 -- (-809.614) (-810.668) [-811.327] (-818.045) * (-810.385) (-808.671) [-811.078] (-812.233) -- 0:00:49
Average standard deviation of split frequencies: 0.013823
220500 -- (-809.204) [-809.807] (-809.776) (-814.298) * (-810.640) [-809.666] (-811.800) (-809.711) -- 0:00:49
221000 -- (-809.523) [-810.781] (-812.341) (-817.892) * (-811.719) (-808.975) (-814.239) [-812.494] -- 0:00:49
221500 -- (-809.712) (-811.625) (-815.061) [-813.640] * [-810.411] (-809.684) (-812.370) (-811.543) -- 0:00:49
222000 -- [-810.002] (-809.119) (-810.045) (-810.197) * (-809.653) (-808.843) (-811.405) [-811.729] -- 0:00:49
222500 -- [-808.689] (-809.791) (-810.797) (-809.041) * (-809.999) [-809.523] (-814.016) (-811.083) -- 0:00:48
223000 -- [-811.306] (-811.020) (-809.185) (-810.095) * (-812.559) (-809.696) (-814.531) [-810.755] -- 0:00:48
223500 -- (-810.437) [-809.461] (-810.762) (-809.387) * (-811.140) (-808.491) [-812.904] (-812.191) -- 0:00:48
224000 -- (-812.003) [-810.856] (-810.239) (-809.527) * (-811.157) (-811.715) [-810.313] (-811.443) -- 0:00:48
224500 -- (-812.431) [-809.465] (-811.195) (-813.110) * (-811.491) (-811.734) (-810.272) [-809.475] -- 0:00:48
225000 -- (-809.552) [-808.330] (-809.586) (-811.013) * (-810.110) [-810.763] (-812.065) (-809.096) -- 0:00:48
Average standard deviation of split frequencies: 0.014253
225500 -- (-809.009) (-813.774) (-810.044) [-810.841] * [-811.280] (-809.359) (-810.084) (-809.227) -- 0:00:48
226000 -- (-809.670) [-810.042] (-809.488) (-809.627) * (-809.789) [-809.446] (-809.683) (-812.944) -- 0:00:47
226500 -- [-809.151] (-811.501) (-812.620) (-808.981) * (-810.872) (-815.739) (-811.437) [-810.422] -- 0:00:47
227000 -- (-809.739) [-810.865] (-810.432) (-810.122) * (-810.066) (-811.988) (-811.252) [-812.481] -- 0:00:47
227500 -- [-810.998] (-813.658) (-810.784) (-811.694) * (-810.056) (-809.430) [-811.693] (-812.143) -- 0:00:47
228000 -- (-812.815) (-814.045) (-812.927) [-808.922] * (-808.692) (-808.708) [-812.841] (-810.440) -- 0:00:47
228500 -- (-812.870) (-813.537) [-809.611] (-809.377) * [-810.034] (-813.613) (-813.053) (-811.826) -- 0:00:47
229000 -- (-812.921) (-813.509) [-811.136] (-810.977) * (-812.204) (-809.649) (-812.446) [-808.830] -- 0:00:47
229500 -- (-809.462) (-812.134) [-809.532] (-813.329) * (-811.199) (-811.234) (-810.234) [-808.882] -- 0:00:47
230000 -- (-810.142) [-809.106] (-811.512) (-814.204) * (-811.710) (-810.615) [-809.191] (-812.539) -- 0:00:46
Average standard deviation of split frequencies: 0.014736
230500 -- (-808.557) (-809.958) (-812.851) [-810.894] * (-812.825) [-809.992] (-808.763) (-811.853) -- 0:00:46
231000 -- (-809.239) [-809.175] (-811.671) (-816.735) * (-812.988) [-809.196] (-808.976) (-810.907) -- 0:00:46
231500 -- (-809.664) (-809.178) (-813.350) [-810.060] * [-810.353] (-809.996) (-810.060) (-810.764) -- 0:00:46
232000 -- [-808.558] (-811.452) (-809.581) (-810.104) * (-812.112) [-809.696] (-810.286) (-809.393) -- 0:00:46
232500 -- (-810.040) (-811.149) [-810.333] (-809.956) * (-810.557) (-808.307) (-816.269) [-811.130] -- 0:00:46
233000 -- [-809.762] (-808.654) (-811.426) (-809.102) * (-810.262) (-811.563) [-811.406] (-810.645) -- 0:00:46
233500 -- (-810.907) (-809.042) [-813.210] (-812.545) * (-811.252) (-811.440) [-810.598] (-812.649) -- 0:00:49
234000 -- (-809.692) (-812.558) [-809.565] (-810.420) * [-813.017] (-812.893) (-812.550) (-810.909) -- 0:00:49
234500 -- (-811.939) (-813.417) (-809.957) [-810.478] * (-811.523) (-810.887) (-809.695) [-812.359] -- 0:00:48
235000 -- (-810.820) [-808.955] (-809.145) (-811.541) * [-808.506] (-808.996) (-809.511) (-808.536) -- 0:00:48
Average standard deviation of split frequencies: 0.015349
235500 -- (-810.394) [-812.962] (-808.959) (-812.565) * (-811.483) (-810.111) [-809.367] (-808.537) -- 0:00:48
236000 -- (-811.965) (-812.744) [-809.843] (-812.694) * [-810.740] (-811.818) (-812.136) (-808.863) -- 0:00:48
236500 -- (-812.202) (-810.563) [-809.871] (-813.629) * [-812.221] (-809.397) (-811.308) (-814.123) -- 0:00:48
237000 -- (-809.708) (-813.518) [-809.952] (-809.883) * (-812.436) [-808.877] (-809.785) (-811.193) -- 0:00:48
237500 -- [-809.545] (-810.921) (-810.976) (-810.359) * (-811.386) (-810.852) (-809.029) [-812.415] -- 0:00:48
238000 -- (-808.872) (-810.651) (-809.370) [-812.368] * [-809.181] (-813.079) (-810.595) (-809.913) -- 0:00:48
238500 -- (-810.629) (-811.165) (-810.676) [-812.485] * [-811.891] (-809.705) (-810.752) (-811.171) -- 0:00:47
239000 -- (-811.264) (-812.263) [-811.096] (-812.506) * [-809.607] (-813.020) (-811.897) (-812.145) -- 0:00:47
239500 -- (-810.799) (-811.083) [-810.842] (-817.811) * (-810.230) (-815.962) (-809.080) [-810.686] -- 0:00:47
240000 -- (-816.123) (-808.325) [-812.242] (-813.429) * (-810.398) (-809.192) (-809.442) [-809.518] -- 0:00:47
Average standard deviation of split frequencies: 0.017302
240500 -- [-809.456] (-810.273) (-815.717) (-813.463) * (-810.282) (-809.193) [-809.710] (-811.896) -- 0:00:47
241000 -- (-810.808) [-809.936] (-820.058) (-810.429) * (-810.967) [-810.210] (-810.149) (-813.104) -- 0:00:47
241500 -- (-808.671) (-810.275) (-812.486) [-810.750] * (-810.820) (-809.349) (-810.963) [-813.736] -- 0:00:47
242000 -- [-808.671] (-812.880) (-813.888) (-809.828) * (-812.586) (-812.397) [-808.735] (-811.341) -- 0:00:46
242500 -- (-810.277) [-808.486] (-809.028) (-808.756) * (-812.461) (-809.947) (-808.576) [-810.811] -- 0:00:46
243000 -- (-814.186) (-809.532) [-813.311] (-808.887) * (-810.331) [-813.289] (-809.735) (-812.193) -- 0:00:46
243500 -- [-809.960] (-809.614) (-811.214) (-809.803) * (-808.548) (-813.973) (-809.043) [-812.998] -- 0:00:46
244000 -- (-813.026) (-810.193) (-813.169) [-808.207] * (-816.227) (-808.703) [-811.010] (-813.713) -- 0:00:46
244500 -- [-813.029] (-813.259) (-810.261) (-809.795) * (-812.188) (-808.718) (-810.001) [-812.111] -- 0:00:46
245000 -- (-809.782) (-816.449) [-809.489] (-810.236) * (-810.191) [-809.028] (-811.268) (-812.446) -- 0:00:46
Average standard deviation of split frequencies: 0.015935
245500 -- (-810.226) [-810.500] (-811.981) (-810.646) * [-810.860] (-810.679) (-809.987) (-809.021) -- 0:00:46
246000 -- [-809.167] (-812.467) (-810.420) (-812.615) * [-809.864] (-811.173) (-809.312) (-809.476) -- 0:00:45
246500 -- [-810.835] (-809.234) (-810.391) (-810.867) * (-811.264) (-810.247) (-809.477) [-811.689] -- 0:00:45
247000 -- (-810.981) (-809.614) (-815.971) [-811.232] * (-810.406) (-811.723) [-808.960] (-812.422) -- 0:00:45
247500 -- (-811.278) (-812.280) [-820.972] (-811.879) * [-809.687] (-810.265) (-811.738) (-809.440) -- 0:00:45
248000 -- [-810.661] (-811.269) (-812.269) (-809.148) * [-809.304] (-809.619) (-809.048) (-811.689) -- 0:00:45
248500 -- (-810.228) [-811.187] (-814.883) (-808.799) * (-810.169) (-810.155) [-809.580] (-813.240) -- 0:00:45
249000 -- (-809.613) (-822.874) (-812.347) [-810.038] * (-810.311) (-809.977) [-813.311] (-810.272) -- 0:00:45
249500 -- (-810.396) (-811.399) [-809.452] (-809.469) * (-811.259) (-811.635) (-812.155) [-810.018] -- 0:00:48
250000 -- [-811.788] (-811.607) (-812.337) (-809.190) * (-811.004) [-808.724] (-811.803) (-812.907) -- 0:00:48
Average standard deviation of split frequencies: 0.015738
250500 -- (-810.268) (-810.831) (-815.180) [-808.914] * (-810.924) (-808.889) (-809.217) [-809.722] -- 0:00:47
251000 -- (-815.200) [-815.175] (-812.069) (-813.025) * (-814.944) [-810.460] (-811.257) (-809.884) -- 0:00:47
251500 -- (-813.389) (-811.383) [-809.839] (-809.954) * (-815.440) [-809.044] (-809.912) (-810.577) -- 0:00:47
252000 -- (-809.643) (-811.186) (-808.634) [-810.260] * (-809.248) (-813.703) [-808.227] (-809.827) -- 0:00:47
252500 -- (-809.930) (-811.218) [-810.049] (-813.953) * [-810.745] (-815.145) (-808.581) (-810.914) -- 0:00:47
253000 -- (-813.865) (-812.455) [-809.412] (-810.442) * (-809.681) (-810.177) [-810.325] (-810.777) -- 0:00:47
253500 -- (-811.679) (-809.075) (-811.233) [-809.848] * (-808.300) (-809.693) (-813.482) [-808.279] -- 0:00:47
254000 -- [-812.601] (-810.469) (-808.763) (-809.274) * (-809.349) (-811.164) (-809.665) [-810.218] -- 0:00:46
254500 -- (-809.136) [-811.596] (-808.641) (-810.586) * (-813.294) [-811.081] (-810.104) (-811.762) -- 0:00:46
255000 -- (-808.446) (-811.842) (-809.102) [-809.003] * [-809.537] (-809.797) (-809.143) (-809.824) -- 0:00:46
Average standard deviation of split frequencies: 0.014538
255500 -- (-810.526) (-814.391) [-808.814] (-810.614) * (-809.944) [-813.811] (-810.203) (-809.530) -- 0:00:46
256000 -- (-810.731) [-810.715] (-810.740) (-811.301) * [-813.465] (-815.496) (-809.254) (-809.004) -- 0:00:46
256500 -- (-813.135) (-810.599) [-810.997] (-808.477) * [-810.085] (-812.178) (-811.145) (-810.077) -- 0:00:46
257000 -- (-808.653) (-811.887) [-809.676] (-811.297) * (-808.909) (-811.923) [-809.599] (-810.039) -- 0:00:46
257500 -- (-810.855) (-811.178) [-809.695] (-811.995) * (-814.167) (-812.033) (-813.668) [-810.625] -- 0:00:46
258000 -- (-815.362) (-811.371) [-810.901] (-814.129) * (-810.281) (-809.721) (-812.021) [-813.325] -- 0:00:46
258500 -- [-811.800] (-813.476) (-811.063) (-816.378) * (-810.917) [-808.438] (-813.888) (-809.571) -- 0:00:45
259000 -- (-811.697) [-811.498] (-809.152) (-810.926) * (-811.088) (-814.737) [-813.582] (-812.178) -- 0:00:45
259500 -- (-818.955) (-809.615) [-810.832] (-812.159) * (-810.695) [-816.110] (-814.968) (-811.715) -- 0:00:45
260000 -- (-813.489) [-809.359] (-810.866) (-810.670) * (-809.972) [-815.073] (-814.570) (-810.710) -- 0:00:45
Average standard deviation of split frequencies: 0.014182
260500 -- (-811.257) [-811.859] (-808.550) (-809.714) * [-809.744] (-815.763) (-809.172) (-811.002) -- 0:00:45
261000 -- (-810.271) (-812.184) (-808.536) [-810.890] * (-811.230) (-813.966) [-811.153] (-810.414) -- 0:00:45
261500 -- (-810.816) [-811.681] (-809.566) (-816.115) * [-811.622] (-813.685) (-810.864) (-813.654) -- 0:00:45
262000 -- (-808.931) [-809.526] (-809.478) (-811.766) * (-815.667) (-809.959) [-809.328] (-818.423) -- 0:00:45
262500 -- (-810.694) [-808.993] (-810.728) (-808.900) * (-810.517) (-809.884) [-809.757] (-811.209) -- 0:00:44
263000 -- (-811.728) (-808.835) [-809.077] (-808.914) * (-811.905) (-809.538) (-810.729) [-810.565] -- 0:00:44
263500 -- (-810.521) [-811.934] (-809.805) (-810.177) * (-809.023) (-809.858) (-812.274) [-814.918] -- 0:00:44
264000 -- (-810.634) (-809.634) [-808.820] (-809.204) * (-811.702) (-810.543) (-811.095) [-809.277] -- 0:00:44
264500 -- (-808.750) [-809.811] (-808.281) (-809.450) * (-810.089) [-809.825] (-811.513) (-808.675) -- 0:00:47
265000 -- (-811.722) (-808.854) (-811.695) [-810.012] * (-811.699) [-812.724] (-810.257) (-809.377) -- 0:00:47
Average standard deviation of split frequencies: 0.014374
265500 -- [-811.593] (-809.387) (-814.291) (-811.251) * [-809.928] (-815.445) (-809.121) (-813.804) -- 0:00:47
266000 -- [-809.180] (-809.522) (-816.382) (-809.575) * (-809.320) (-809.909) (-811.947) [-810.353] -- 0:00:46
266500 -- (-809.911) (-808.691) (-808.834) [-811.948] * (-812.895) [-813.246] (-808.767) (-814.511) -- 0:00:46
267000 -- (-812.728) (-809.219) [-810.394] (-810.614) * [-809.937] (-812.906) (-812.653) (-810.535) -- 0:00:46
267500 -- (-810.855) (-810.284) [-810.708] (-809.147) * (-811.228) (-810.532) (-811.544) [-812.740] -- 0:00:46
268000 -- (-810.590) [-811.847] (-811.455) (-808.915) * (-810.551) [-814.744] (-809.396) (-818.685) -- 0:00:46
268500 -- (-809.816) (-810.293) (-808.691) [-809.183] * (-810.004) (-810.993) [-814.780] (-810.044) -- 0:00:46
269000 -- (-811.214) (-812.027) [-809.209] (-810.289) * (-810.722) [-809.093] (-814.476) (-809.938) -- 0:00:46
269500 -- [-811.750] (-809.233) (-809.111) (-814.286) * (-813.299) [-811.821] (-811.258) (-815.343) -- 0:00:46
270000 -- (-810.797) (-810.107) (-809.473) [-810.795] * [-810.911] (-809.743) (-812.257) (-809.836) -- 0:00:45
Average standard deviation of split frequencies: 0.013546
270500 -- [-813.182] (-810.942) (-809.360) (-810.743) * [-809.861] (-809.905) (-810.059) (-809.260) -- 0:00:45
271000 -- [-808.702] (-812.033) (-810.020) (-809.372) * (-812.310) [-809.363] (-809.517) (-810.360) -- 0:00:45
271500 -- (-810.062) [-810.494] (-810.463) (-809.593) * (-812.410) (-809.356) [-810.666] (-810.842) -- 0:00:45
272000 -- (-809.695) [-810.734] (-811.184) (-810.638) * [-812.422] (-809.369) (-808.750) (-811.053) -- 0:00:45
272500 -- (-810.080) (-809.185) [-810.194] (-809.149) * (-810.493) (-810.039) (-808.609) [-809.568] -- 0:00:45
273000 -- (-810.005) (-811.239) (-809.038) [-812.315] * (-813.524) [-808.565] (-812.573) (-815.502) -- 0:00:45
273500 -- (-811.521) (-810.230) (-810.589) [-813.469] * (-811.092) [-809.810] (-811.178) (-810.234) -- 0:00:45
274000 -- (-809.658) [-809.739] (-809.160) (-809.748) * (-810.312) (-808.470) (-809.034) [-812.040] -- 0:00:45
274500 -- (-809.822) (-808.913) [-809.266] (-809.799) * (-811.282) (-809.231) [-809.405] (-809.162) -- 0:00:44
275000 -- [-809.561] (-811.389) (-812.290) (-812.018) * (-809.822) (-811.988) (-812.051) [-810.826] -- 0:00:44
Average standard deviation of split frequencies: 0.013664
275500 -- (-815.962) [-809.404] (-809.118) (-808.565) * (-808.281) [-809.383] (-810.255) (-813.513) -- 0:00:44
276000 -- [-813.118] (-809.273) (-809.129) (-809.699) * (-808.280) (-810.028) (-812.052) [-809.789] -- 0:00:44
276500 -- (-815.654) (-811.367) [-809.671] (-811.486) * (-813.835) [-811.550] (-811.362) (-810.961) -- 0:00:44
277000 -- (-809.907) (-810.697) [-810.437] (-813.065) * (-809.147) (-811.568) [-810.440] (-810.442) -- 0:00:44
277500 -- (-809.483) (-809.192) [-815.380] (-810.618) * [-809.262] (-813.943) (-812.643) (-809.339) -- 0:00:46
278000 -- [-808.419] (-812.952) (-810.834) (-814.912) * [-810.532] (-816.580) (-811.264) (-809.711) -- 0:00:46
278500 -- (-811.167) [-808.579] (-809.328) (-812.166) * (-810.213) (-812.587) (-812.095) [-810.873] -- 0:00:46
279000 -- (-809.556) (-808.669) [-809.414] (-812.236) * (-812.505) (-808.992) (-814.572) [-809.333] -- 0:00:46
279500 -- (-809.967) (-808.635) (-808.823) [-813.849] * (-813.928) (-809.364) [-812.263] (-810.847) -- 0:00:46
280000 -- (-812.470) (-810.372) (-814.858) [-810.589] * (-815.616) (-810.945) [-811.405] (-812.497) -- 0:00:46
Average standard deviation of split frequencies: 0.013614
280500 -- (-812.201) (-810.657) (-811.799) [-814.518] * (-811.304) [-815.760] (-808.796) (-810.062) -- 0:00:46
281000 -- [-812.462] (-808.788) (-811.146) (-811.487) * (-810.895) (-812.900) [-808.532] (-812.066) -- 0:00:46
281500 -- (-811.435) (-810.092) (-810.892) [-810.064] * (-812.997) (-809.765) (-813.287) [-811.981] -- 0:00:45
282000 -- (-810.625) (-810.526) (-809.922) [-811.668] * (-815.841) (-812.773) [-811.388] (-809.319) -- 0:00:45
282500 -- (-810.415) (-809.658) (-809.984) [-810.534] * (-814.340) [-811.946] (-812.367) (-808.312) -- 0:00:45
283000 -- (-808.769) (-810.073) (-810.113) [-810.089] * (-813.977) (-814.726) (-814.661) [-809.480] -- 0:00:45
283500 -- (-809.619) (-811.097) (-810.328) [-810.780] * [-810.366] (-815.642) (-809.772) (-809.899) -- 0:00:45
284000 -- (-811.146) (-810.059) [-808.701] (-809.720) * (-813.600) (-814.483) [-809.808] (-809.226) -- 0:00:45
284500 -- (-810.186) (-810.621) (-813.141) [-809.315] * (-811.176) (-812.328) (-813.798) [-811.044] -- 0:00:45
285000 -- (-810.429) [-809.656] (-816.177) (-810.975) * (-809.504) [-812.313] (-813.436) (-808.942) -- 0:00:45
Average standard deviation of split frequencies: 0.012032
285500 -- (-815.233) (-808.607) (-811.699) [-809.915] * (-811.107) (-814.292) (-812.175) [-809.381] -- 0:00:45
286000 -- (-818.577) (-809.441) [-811.521] (-811.069) * (-811.497) [-808.475] (-811.944) (-809.233) -- 0:00:44
286500 -- [-810.781] (-808.357) (-817.156) (-812.442) * (-809.132) (-811.719) [-810.538] (-809.900) -- 0:00:44
287000 -- (-810.021) (-808.420) (-815.503) [-816.058] * [-809.375] (-809.491) (-810.658) (-813.084) -- 0:00:44
287500 -- [-812.176] (-809.655) (-814.435) (-813.771) * (-809.172) [-813.351] (-810.227) (-812.591) -- 0:00:44
288000 -- [-810.114] (-810.436) (-811.435) (-812.306) * (-810.765) (-812.924) [-810.968] (-811.122) -- 0:00:44
288500 -- (-809.508) (-810.821) [-813.306] (-815.025) * (-809.209) (-809.258) [-809.348] (-811.925) -- 0:00:44
289000 -- [-810.410] (-809.993) (-810.246) (-809.843) * [-809.898] (-810.494) (-813.973) (-810.418) -- 0:00:44
289500 -- [-812.091] (-809.802) (-811.993) (-810.968) * (-810.355) (-809.974) [-813.079] (-810.513) -- 0:00:44
290000 -- [-809.580] (-808.924) (-810.427) (-809.327) * [-810.394] (-809.432) (-810.613) (-813.700) -- 0:00:44
Average standard deviation of split frequencies: 0.012326
290500 -- [-808.579] (-810.068) (-809.536) (-809.252) * [-810.129] (-811.809) (-811.718) (-814.175) -- 0:00:43
291000 -- [-809.916] (-809.909) (-809.269) (-811.439) * [-810.069] (-810.783) (-811.843) (-809.086) -- 0:00:43
291500 -- [-810.104] (-810.061) (-811.521) (-811.056) * [-809.616] (-812.256) (-808.931) (-815.980) -- 0:00:43
292000 -- (-811.490) [-812.682] (-812.943) (-810.670) * [-809.793] (-809.956) (-809.911) (-810.261) -- 0:00:43
292500 -- (-810.515) (-809.415) (-810.198) [-808.878] * (-809.083) (-812.415) [-810.274] (-808.565) -- 0:00:43
293000 -- (-809.131) (-810.872) [-811.814] (-810.728) * (-809.255) (-810.547) [-810.676] (-808.393) -- 0:00:45
293500 -- (-810.901) (-810.595) [-812.577] (-812.294) * [-810.845] (-812.479) (-809.141) (-810.022) -- 0:00:45
294000 -- (-810.432) (-810.987) [-817.878] (-811.820) * (-809.347) [-810.638] (-810.213) (-815.381) -- 0:00:45
294500 -- [-809.799] (-811.730) (-816.490) (-813.084) * (-809.484) (-811.874) [-808.551] (-810.101) -- 0:00:45
295000 -- (-810.092) (-810.351) [-811.805] (-811.465) * (-810.779) [-811.887] (-809.758) (-808.408) -- 0:00:45
Average standard deviation of split frequencies: 0.013059
295500 -- (-813.020) [-812.920] (-810.148) (-812.238) * [-814.627] (-814.816) (-810.581) (-808.765) -- 0:00:45
296000 -- (-811.669) [-812.723] (-811.263) (-808.775) * (-814.973) [-809.002] (-810.790) (-809.683) -- 0:00:45
296500 -- (-813.764) (-810.405) [-809.837] (-814.103) * [-812.112] (-808.383) (-811.898) (-810.945) -- 0:00:45
297000 -- [-811.828] (-813.167) (-808.991) (-815.114) * (-812.588) (-808.589) (-810.111) [-809.884] -- 0:00:44
297500 -- (-812.592) (-811.945) [-810.477] (-812.485) * (-812.956) (-810.379) [-808.993] (-812.617) -- 0:00:44
298000 -- [-812.273] (-812.397) (-812.408) (-813.608) * (-809.844) [-811.135] (-809.889) (-812.429) -- 0:00:44
298500 -- [-809.108] (-809.067) (-812.204) (-816.301) * (-809.995) (-810.871) [-808.462] (-812.721) -- 0:00:44
299000 -- (-809.936) [-809.067] (-811.628) (-810.542) * (-811.460) [-810.598] (-810.607) (-817.059) -- 0:00:44
299500 -- (-808.532) (-810.708) (-811.368) [-810.063] * (-810.466) [-811.010] (-809.511) (-812.274) -- 0:00:44
300000 -- (-809.487) [-811.781] (-811.264) (-813.567) * (-809.532) [-809.224] (-809.595) (-810.757) -- 0:00:44
Average standard deviation of split frequencies: 0.013501
300500 -- (-810.104) (-815.638) [-810.705] (-809.605) * (-811.519) [-812.178] (-812.103) (-813.423) -- 0:00:44
301000 -- (-809.725) [-811.827] (-811.372) (-813.646) * (-809.005) (-811.907) [-811.216] (-811.111) -- 0:00:44
301500 -- [-809.888] (-813.463) (-809.429) (-814.397) * (-812.401) [-811.019] (-812.089) (-811.000) -- 0:00:44
302000 -- (-809.837) [-811.409] (-810.552) (-813.209) * [-811.451] (-810.975) (-810.433) (-810.332) -- 0:00:43
302500 -- (-809.963) [-810.557] (-811.353) (-813.971) * [-809.015] (-812.059) (-810.919) (-810.788) -- 0:00:43
303000 -- [-811.167] (-810.963) (-812.568) (-812.156) * (-810.870) [-811.570] (-809.918) (-810.870) -- 0:00:43
303500 -- [-810.781] (-810.170) (-810.757) (-811.094) * (-812.548) (-810.959) (-811.442) [-811.131] -- 0:00:43
304000 -- (-810.311) (-810.947) [-810.535] (-811.398) * (-813.005) [-811.068] (-809.506) (-810.741) -- 0:00:43
304500 -- (-816.488) (-811.911) (-815.302) [-811.056] * (-813.012) (-813.317) [-809.342] (-809.091) -- 0:00:43
305000 -- (-811.704) [-812.270] (-809.133) (-812.013) * (-808.785) (-812.387) (-811.181) [-809.091] -- 0:00:43
Average standard deviation of split frequencies: 0.014378
305500 -- (-809.691) (-811.391) (-808.851) [-810.145] * (-809.533) (-810.739) [-808.755] (-809.914) -- 0:00:43
306000 -- (-811.494) (-809.830) (-809.553) [-814.103] * (-809.450) (-809.592) [-811.823] (-810.069) -- 0:00:43
306500 -- (-812.349) [-809.973] (-811.487) (-810.365) * [-809.085] (-809.274) (-809.528) (-810.947) -- 0:00:45
307000 -- [-811.058] (-810.609) (-810.097) (-808.343) * (-809.588) (-810.420) [-810.333] (-812.821) -- 0:00:45
307500 -- (-809.910) [-812.327] (-812.965) (-808.687) * (-808.400) (-810.098) [-809.549] (-810.282) -- 0:00:45
308000 -- [-810.347] (-809.949) (-816.406) (-810.653) * (-813.255) (-812.788) [-810.357] (-809.734) -- 0:00:44
308500 -- (-818.075) [-809.552] (-809.195) (-810.736) * (-812.309) (-811.245) (-810.766) [-809.861] -- 0:00:44
309000 -- (-811.710) [-810.556] (-809.498) (-810.224) * (-812.720) [-808.581] (-810.790) (-810.243) -- 0:00:44
309500 -- [-808.903] (-809.651) (-809.217) (-809.646) * (-811.498) [-810.530] (-809.541) (-809.318) -- 0:00:44
310000 -- [-809.936] (-813.425) (-811.983) (-811.434) * (-812.271) [-811.183] (-808.639) (-811.383) -- 0:00:44
Average standard deviation of split frequencies: 0.015090
310500 -- (-811.989) (-813.173) (-811.836) [-808.352] * (-810.056) [-812.712] (-811.155) (-812.490) -- 0:00:44
311000 -- [-811.077] (-813.518) (-809.347) (-809.322) * [-811.128] (-811.204) (-811.616) (-809.257) -- 0:00:44
311500 -- (-812.897) [-810.126] (-809.465) (-810.626) * (-809.875) [-810.586] (-810.573) (-810.310) -- 0:00:44
312000 -- (-808.562) (-810.411) (-813.527) [-811.352] * (-809.681) [-809.795] (-810.573) (-808.761) -- 0:00:44
312500 -- [-808.795] (-810.448) (-811.679) (-809.980) * (-811.770) (-812.131) [-809.171] (-810.589) -- 0:00:44
313000 -- [-809.759] (-810.281) (-810.430) (-810.216) * (-809.881) [-812.545] (-812.303) (-808.903) -- 0:00:43
313500 -- (-818.955) (-810.926) [-810.232] (-809.795) * [-809.822] (-813.730) (-810.602) (-810.311) -- 0:00:43
314000 -- (-811.205) (-808.992) [-809.616] (-810.434) * [-808.835] (-809.284) (-808.832) (-811.921) -- 0:00:43
314500 -- (-809.163) (-809.715) (-810.272) [-810.379] * (-808.632) (-811.295) (-809.066) [-811.655] -- 0:00:43
315000 -- (-818.171) (-809.512) (-809.457) [-809.702] * (-810.106) (-811.825) (-809.258) [-810.055] -- 0:00:43
Average standard deviation of split frequencies: 0.015166
315500 -- (-816.179) (-814.503) (-808.890) [-808.749] * (-813.589) (-811.023) [-809.148] (-808.588) -- 0:00:43
316000 -- (-811.324) [-810.815] (-809.863) (-809.494) * [-810.185] (-812.288) (-811.882) (-809.721) -- 0:00:43
316500 -- (-810.099) [-810.461] (-809.888) (-810.833) * (-808.677) (-813.609) [-809.643] (-808.747) -- 0:00:43
317000 -- [-811.441] (-809.881) (-808.916) (-809.226) * (-808.685) (-810.602) (-814.261) [-809.068] -- 0:00:43
317500 -- (-811.025) (-813.875) [-808.689] (-808.947) * (-811.165) [-809.281] (-810.674) (-809.136) -- 0:00:42
318000 -- (-811.091) (-812.046) (-809.520) [-809.454] * (-809.779) (-809.552) (-809.031) [-808.886] -- 0:00:42
318500 -- (-811.585) (-816.556) (-812.437) [-809.835] * (-808.898) (-809.653) (-809.761) [-809.158] -- 0:00:42
319000 -- (-808.745) [-820.394] (-812.838) (-812.928) * (-811.021) (-810.047) (-809.714) [-811.199] -- 0:00:42
319500 -- (-810.776) [-813.340] (-812.113) (-809.604) * [-811.133] (-810.553) (-810.879) (-809.921) -- 0:00:42
320000 -- (-809.993) (-808.357) [-809.561] (-813.455) * [-810.222] (-809.045) (-811.415) (-812.797) -- 0:00:44
Average standard deviation of split frequencies: 0.014864
320500 -- (-811.528) (-808.649) (-812.455) [-810.257] * [-809.177] (-809.397) (-809.835) (-810.623) -- 0:00:44
321000 -- (-812.628) [-810.622] (-810.031) (-809.497) * [-812.158] (-808.707) (-809.743) (-810.506) -- 0:00:44
321500 -- (-810.456) [-808.834] (-810.060) (-810.219) * (-812.624) [-808.811] (-811.008) (-811.714) -- 0:00:44
322000 -- (-810.517) (-812.243) [-810.376] (-811.541) * (-811.554) (-809.244) (-811.714) [-809.863] -- 0:00:44
322500 -- (-809.674) (-810.925) [-809.539] (-810.071) * (-814.077) (-811.710) (-813.071) [-811.210] -- 0:00:44
323000 -- [-811.551] (-810.455) (-810.560) (-810.820) * [-811.240] (-814.308) (-813.413) (-814.151) -- 0:00:44
323500 -- (-810.911) (-813.767) [-809.349] (-809.661) * (-809.564) [-810.218] (-809.968) (-814.791) -- 0:00:43
324000 -- (-812.548) [-809.502] (-809.332) (-809.486) * (-808.879) (-811.323) [-811.262] (-815.879) -- 0:00:43
324500 -- (-810.038) (-809.250) [-808.771] (-810.395) * (-808.956) (-809.604) (-810.343) [-812.083] -- 0:00:43
325000 -- (-812.944) [-811.730] (-809.668) (-810.395) * [-809.252] (-809.455) (-818.337) (-813.643) -- 0:00:43
Average standard deviation of split frequencies: 0.015069
325500 -- (-810.560) (-809.636) (-810.321) [-808.953] * (-814.672) (-808.431) [-816.316] (-809.854) -- 0:00:43
326000 -- (-820.012) (-809.333) [-808.741] (-809.709) * (-815.951) (-810.317) (-812.598) [-813.119] -- 0:00:43
326500 -- (-812.178) (-810.068) (-813.254) [-812.014] * (-812.364) [-812.136] (-809.501) (-814.595) -- 0:00:43
327000 -- (-812.016) [-809.464] (-809.839) (-810.963) * (-810.182) (-810.257) [-811.623] (-808.991) -- 0:00:43
327500 -- (-813.194) (-811.724) [-808.640] (-809.955) * (-812.294) [-809.772] (-812.801) (-811.415) -- 0:00:43
328000 -- (-811.150) (-812.236) (-810.318) [-810.484] * (-811.034) (-810.068) [-810.974] (-815.084) -- 0:00:43
328500 -- (-809.202) (-813.083) (-810.551) [-809.623] * (-810.797) (-810.634) [-810.302] (-811.585) -- 0:00:42
329000 -- [-809.096] (-809.831) (-811.694) (-809.028) * (-812.474) [-810.240] (-810.649) (-809.118) -- 0:00:42
329500 -- [-809.229] (-811.072) (-812.870) (-808.643) * (-809.233) (-810.679) (-814.692) [-811.378] -- 0:00:42
330000 -- (-809.444) (-809.731) (-816.512) [-809.237] * (-808.864) [-810.277] (-816.592) (-808.615) -- 0:00:42
Average standard deviation of split frequencies: 0.014731
330500 -- (-811.442) [-808.834] (-813.443) (-811.760) * (-810.916) (-810.936) (-809.359) [-809.080] -- 0:00:42
331000 -- (-810.124) (-811.420) (-813.314) [-812.615] * (-812.159) (-808.955) [-810.021] (-809.847) -- 0:00:42
331500 -- (-809.912) [-811.172] (-811.232) (-810.781) * (-814.338) [-809.824] (-809.700) (-809.118) -- 0:00:42
332000 -- (-810.185) [-809.769] (-810.791) (-809.769) * (-812.852) (-809.792) [-811.468] (-810.992) -- 0:00:42
332500 -- (-809.591) (-810.931) [-809.640] (-810.271) * (-810.822) (-809.878) (-810.636) [-808.904] -- 0:00:42
333000 -- (-812.329) (-811.655) [-809.203] (-811.714) * (-809.907) [-810.051] (-810.423) (-809.281) -- 0:00:42
333500 -- (-810.673) [-810.499] (-809.128) (-811.056) * (-811.980) [-809.681] (-809.889) (-812.845) -- 0:00:41
334000 -- (-809.780) (-809.103) (-810.265) [-811.439] * [-810.888] (-809.149) (-809.218) (-813.026) -- 0:00:41
334500 -- (-811.036) [-815.412] (-811.381) (-809.862) * (-815.944) (-808.599) (-810.609) [-810.655] -- 0:00:41
335000 -- (-810.241) (-809.673) (-809.639) [-811.276] * (-811.235) (-809.311) [-810.593] (-812.307) -- 0:00:41
Average standard deviation of split frequencies: 0.015043
335500 -- (-810.330) (-809.927) [-808.844] (-812.606) * [-812.408] (-809.040) (-809.952) (-810.319) -- 0:00:41
336000 -- [-809.470] (-813.646) (-811.805) (-808.712) * (-815.383) [-809.248] (-810.977) (-811.723) -- 0:00:41
336500 -- (-808.959) [-809.610] (-817.883) (-808.971) * (-808.855) (-811.257) [-808.479] (-811.045) -- 0:00:43
337000 -- [-809.155] (-809.960) (-809.901) (-809.586) * [-809.231] (-809.241) (-808.638) (-812.769) -- 0:00:43
337500 -- (-808.507) (-812.102) [-811.435] (-811.414) * [-808.801] (-810.773) (-809.719) (-811.509) -- 0:00:43
338000 -- (-812.513) (-809.105) [-811.286] (-808.984) * (-810.421) (-808.921) [-808.780] (-812.138) -- 0:00:43
338500 -- (-809.616) [-809.820] (-812.277) (-809.020) * [-810.206] (-811.216) (-809.847) (-811.296) -- 0:00:42
339000 -- (-809.441) (-810.228) [-813.408] (-809.951) * (-810.823) [-811.350] (-812.231) (-816.310) -- 0:00:42
339500 -- (-808.564) (-809.855) [-809.168] (-811.158) * [-813.258] (-813.754) (-811.412) (-813.968) -- 0:00:42
340000 -- (-809.973) (-811.671) (-811.465) [-809.112] * [-809.226] (-813.795) (-809.503) (-813.361) -- 0:00:42
Average standard deviation of split frequencies: 0.014837
340500 -- (-810.497) (-810.168) [-812.450] (-811.173) * [-810.128] (-813.353) (-817.716) (-809.995) -- 0:00:42
341000 -- (-812.494) (-814.662) [-809.614] (-811.436) * [-813.139] (-812.616) (-808.646) (-810.493) -- 0:00:42
341500 -- (-810.782) [-810.552] (-811.363) (-809.733) * (-812.146) (-809.332) (-809.539) [-810.579] -- 0:00:42
342000 -- (-810.481) (-811.266) (-809.595) [-808.908] * [-813.346] (-810.148) (-809.127) (-812.273) -- 0:00:42
342500 -- (-811.558) [-812.348] (-809.434) (-814.336) * [-811.485] (-812.410) (-812.480) (-812.660) -- 0:00:42
343000 -- (-809.429) [-810.225] (-810.890) (-809.799) * (-810.267) (-811.322) [-809.204] (-810.916) -- 0:00:42
343500 -- (-810.547) (-810.884) [-810.606] (-813.334) * (-809.884) (-811.204) [-808.984] (-810.840) -- 0:00:42
344000 -- (-809.426) (-811.034) [-809.575] (-814.636) * (-810.655) (-817.904) [-810.995] (-810.407) -- 0:00:41
344500 -- [-809.519] (-809.417) (-810.350) (-810.112) * (-813.396) (-814.212) [-809.794] (-811.442) -- 0:00:41
345000 -- (-809.623) [-811.832] (-811.050) (-810.146) * (-814.629) (-814.622) (-814.119) [-812.953] -- 0:00:41
Average standard deviation of split frequencies: 0.013170
345500 -- [-811.107] (-811.796) (-809.758) (-810.788) * (-818.715) (-811.717) (-810.468) [-810.597] -- 0:00:41
346000 -- [-808.687] (-808.225) (-809.637) (-811.372) * [-809.356] (-810.713) (-811.701) (-809.434) -- 0:00:41
346500 -- (-811.361) (-809.562) (-811.462) [-811.572] * (-810.191) (-810.554) [-810.285] (-811.216) -- 0:00:41
347000 -- (-810.902) [-812.087] (-812.859) (-810.917) * (-811.617) (-810.474) [-811.356] (-810.370) -- 0:00:41
347500 -- (-809.426) (-810.524) (-813.108) [-810.754] * [-808.404] (-810.241) (-818.048) (-810.540) -- 0:00:41
348000 -- (-810.259) (-810.303) [-810.991] (-809.461) * (-808.760) (-810.577) (-811.280) [-812.235] -- 0:00:41
348500 -- (-811.799) [-809.737] (-810.646) (-811.722) * (-808.689) (-809.076) [-811.431] (-808.927) -- 0:00:41
349000 -- (-814.446) [-810.063] (-810.423) (-813.207) * (-810.918) (-809.918) [-809.839] (-810.052) -- 0:00:41
349500 -- (-813.134) (-810.180) (-809.845) [-812.905] * (-809.357) (-811.095) (-809.297) [-809.465] -- 0:00:40
350000 -- (-813.968) [-809.656] (-810.218) (-810.883) * [-812.854] (-810.609) (-810.580) (-810.624) -- 0:00:40
Average standard deviation of split frequencies: 0.012173
350500 -- (-810.733) (-809.418) (-812.489) [-812.177] * [-811.989] (-811.974) (-809.800) (-808.608) -- 0:00:40
351000 -- (-808.524) (-809.989) [-813.536] (-814.135) * (-812.362) [-814.186] (-808.407) (-810.941) -- 0:00:40
351500 -- (-808.556) (-809.477) (-814.093) [-809.378] * [-809.435] (-813.917) (-811.145) (-815.545) -- 0:00:40
352000 -- [-809.858] (-809.850) (-814.032) (-811.156) * [-809.987] (-812.285) (-811.440) (-811.473) -- 0:00:40
352500 -- (-814.226) (-809.191) [-809.139] (-811.597) * [-814.359] (-811.164) (-811.865) (-810.803) -- 0:00:40
353000 -- (-809.880) (-809.297) (-811.624) [-810.004] * (-812.759) (-809.540) [-809.601] (-812.758) -- 0:00:42
353500 -- (-812.169) (-810.845) (-810.974) [-809.710] * (-812.856) [-809.678] (-813.709) (-809.279) -- 0:00:42
354000 -- (-811.313) (-813.909) (-810.151) [-808.877] * (-811.096) [-809.768] (-810.192) (-810.106) -- 0:00:41
354500 -- [-809.709] (-809.985) (-814.190) (-809.956) * (-809.606) (-811.086) (-810.935) [-813.040] -- 0:00:41
355000 -- (-808.976) (-810.099) (-809.627) [-811.946] * (-809.709) (-809.843) [-810.570] (-813.076) -- 0:00:41
Average standard deviation of split frequencies: 0.012359
355500 -- (-808.703) (-809.937) [-810.991] (-811.243) * (-809.534) [-810.723] (-811.987) (-810.177) -- 0:00:41
356000 -- [-809.206] (-810.280) (-810.418) (-809.172) * (-812.629) (-813.593) (-812.282) [-811.158] -- 0:00:41
356500 -- [-813.542] (-808.738) (-809.390) (-809.500) * (-812.595) (-817.903) [-812.016] (-814.839) -- 0:00:41
357000 -- (-815.599) [-808.748] (-810.327) (-810.009) * (-824.622) (-811.408) (-811.949) [-810.598] -- 0:00:41
357500 -- (-815.745) (-810.849) (-809.952) [-810.791] * (-817.936) (-808.800) [-811.150] (-815.532) -- 0:00:41
358000 -- (-811.749) (-809.961) [-810.992] (-812.269) * (-808.828) [-811.367] (-815.187) (-810.557) -- 0:00:41
358500 -- [-809.194] (-809.430) (-812.055) (-813.191) * (-809.303) (-809.105) (-809.935) [-809.157] -- 0:00:41
359000 -- (-809.496) [-811.490] (-812.038) (-811.065) * (-814.769) (-809.665) (-809.054) [-811.155] -- 0:00:41
359500 -- (-812.859) (-815.451) (-810.816) [-810.457] * (-812.362) (-809.346) [-810.446] (-813.074) -- 0:00:40
360000 -- (-810.660) (-814.027) [-810.785] (-810.774) * (-812.691) (-812.385) [-810.656] (-814.749) -- 0:00:40
Average standard deviation of split frequencies: 0.012780
360500 -- (-809.751) (-810.277) (-812.337) [-808.555] * (-810.167) (-810.155) [-810.198] (-815.462) -- 0:00:40
361000 -- (-810.113) (-810.966) (-808.889) [-810.079] * (-810.756) (-809.543) [-810.807] (-810.484) -- 0:00:40
361500 -- [-815.628] (-811.706) (-810.666) (-811.943) * (-808.668) [-810.400] (-808.710) (-809.979) -- 0:00:40
362000 -- (-812.691) (-810.297) (-811.798) [-812.249] * (-808.731) (-809.534) [-809.539] (-808.377) -- 0:00:40
362500 -- [-811.809] (-808.858) (-811.785) (-813.286) * (-809.732) (-810.180) [-812.413] (-809.860) -- 0:00:40
363000 -- (-811.815) [-812.224] (-810.455) (-813.994) * (-811.745) [-810.949] (-813.266) (-809.692) -- 0:00:40
363500 -- (-810.031) (-809.610) [-809.414] (-812.714) * (-813.960) (-810.649) [-810.771] (-810.337) -- 0:00:40
364000 -- [-809.842] (-809.134) (-813.313) (-810.564) * (-816.390) (-810.803) (-811.296) [-811.474] -- 0:00:40
364500 -- [-810.673] (-809.204) (-810.464) (-810.774) * (-811.093) [-808.613] (-811.937) (-809.696) -- 0:00:40
365000 -- (-809.753) [-811.164] (-809.821) (-809.606) * (-810.684) (-808.391) [-811.935] (-809.839) -- 0:00:40
Average standard deviation of split frequencies: 0.013381
365500 -- (-813.584) [-812.417] (-808.753) (-809.142) * (-810.064) (-811.733) (-811.632) [-814.953] -- 0:00:39
366000 -- (-811.979) (-809.159) (-814.844) [-809.208] * (-809.005) (-809.385) [-808.699] (-812.308) -- 0:00:39
366500 -- (-818.855) (-809.759) [-811.658] (-810.274) * (-813.658) [-810.514] (-809.925) (-808.846) -- 0:00:39
367000 -- (-813.256) (-811.282) (-811.464) [-809.951] * [-812.943] (-810.257) (-811.136) (-811.013) -- 0:00:39
367500 -- (-812.938) [-814.662] (-810.994) (-810.123) * (-811.789) (-810.142) (-810.387) [-812.888] -- 0:00:39
368000 -- (-809.284) [-813.613] (-810.014) (-813.637) * (-813.517) (-813.374) (-812.048) [-811.477] -- 0:00:39
368500 -- (-808.875) [-811.320] (-809.326) (-812.494) * (-810.884) (-811.971) (-811.428) [-810.008] -- 0:00:39
369000 -- (-808.597) (-809.499) [-809.335] (-809.771) * (-809.213) (-810.415) [-811.403] (-810.780) -- 0:00:39
369500 -- [-811.164] (-812.067) (-808.462) (-811.257) * (-809.397) [-808.889] (-810.369) (-808.685) -- 0:00:39
370000 -- [-809.640] (-812.501) (-811.302) (-810.360) * (-813.054) [-810.099] (-810.764) (-808.219) -- 0:00:40
Average standard deviation of split frequencies: 0.013212
370500 -- (-809.011) (-812.622) (-812.123) [-810.687] * (-810.887) (-808.467) (-810.340) [-809.525] -- 0:00:40
371000 -- [-809.292] (-814.963) (-812.602) (-812.640) * (-813.578) [-811.609] (-812.308) (-811.039) -- 0:00:40
371500 -- (-811.686) (-813.214) [-810.973] (-810.466) * (-811.930) (-810.853) [-810.413] (-811.672) -- 0:00:40
372000 -- (-810.409) [-809.295] (-811.342) (-811.260) * (-811.214) (-810.881) [-810.975] (-811.229) -- 0:00:40
372500 -- (-812.170) [-809.244] (-812.157) (-813.534) * [-814.456] (-810.403) (-812.262) (-810.588) -- 0:00:40
373000 -- [-810.257] (-810.661) (-817.087) (-810.534) * (-811.915) (-809.953) [-811.857] (-810.798) -- 0:00:40
373500 -- (-810.311) (-812.514) (-809.750) [-813.753] * [-808.581] (-809.721) (-809.471) (-812.860) -- 0:00:40
374000 -- (-808.672) [-811.370] (-809.499) (-813.299) * [-810.627] (-812.800) (-810.692) (-812.105) -- 0:00:40
374500 -- (-808.763) (-810.743) (-810.443) [-809.076] * (-809.742) (-809.592) (-809.270) [-811.058] -- 0:00:40
375000 -- [-809.329] (-808.558) (-810.395) (-809.104) * (-809.495) [-810.780] (-811.216) (-813.778) -- 0:00:40
Average standard deviation of split frequencies: 0.013025
375500 -- (-810.623) (-811.549) (-813.817) [-810.690] * [-815.062] (-813.389) (-809.140) (-810.676) -- 0:00:39
376000 -- (-808.449) (-810.402) [-810.577] (-810.410) * [-810.166] (-809.759) (-814.529) (-810.997) -- 0:00:39
376500 -- (-808.438) (-811.633) [-809.918] (-809.697) * (-808.964) [-809.634] (-813.509) (-809.661) -- 0:00:39
377000 -- (-810.776) (-814.716) (-809.752) [-812.345] * [-813.027] (-809.870) (-814.183) (-811.248) -- 0:00:39
377500 -- (-810.533) (-811.709) (-808.569) [-814.880] * (-814.138) [-810.974] (-812.830) (-813.185) -- 0:00:39
378000 -- (-809.252) (-809.895) (-809.223) [-812.924] * (-810.525) [-812.175] (-809.608) (-812.925) -- 0:00:39
378500 -- (-809.440) (-808.367) [-809.275] (-813.583) * (-811.209) (-817.225) [-810.127] (-812.942) -- 0:00:39
379000 -- (-810.022) [-811.270] (-809.058) (-810.475) * [-810.838] (-808.522) (-815.936) (-808.421) -- 0:00:39
379500 -- (-810.918) [-810.335] (-812.017) (-810.843) * (-811.330) (-814.000) [-814.456] (-808.794) -- 0:00:39
380000 -- [-810.808] (-809.412) (-810.273) (-809.445) * (-811.214) [-808.510] (-810.516) (-809.284) -- 0:00:39
Average standard deviation of split frequencies: 0.011437
380500 -- [-809.936] (-810.312) (-811.594) (-811.821) * [-809.992] (-808.523) (-810.707) (-808.786) -- 0:00:39
381000 -- (-814.912) (-809.542) (-810.638) [-809.874] * (-809.710) (-811.487) (-811.025) [-809.378] -- 0:00:38
381500 -- (-816.062) [-808.934] (-810.864) (-809.871) * [-813.338] (-810.124) (-811.407) (-809.012) -- 0:00:38
382000 -- (-811.036) (-808.504) (-815.650) [-810.214] * (-809.148) (-814.355) [-812.123] (-809.681) -- 0:00:38
382500 -- (-812.438) [-810.618] (-809.026) (-811.948) * (-808.888) (-812.037) [-811.747] (-814.158) -- 0:00:38
383000 -- [-809.082] (-811.684) (-810.062) (-811.569) * [-812.729] (-809.340) (-817.927) (-811.422) -- 0:00:38
383500 -- (-809.266) [-809.569] (-809.659) (-817.280) * (-809.219) (-809.007) (-813.071) [-810.120] -- 0:00:38
384000 -- [-811.954] (-812.878) (-809.505) (-810.796) * [-809.671] (-812.148) (-813.946) (-812.121) -- 0:00:38
384500 -- (-815.334) [-812.314] (-811.230) (-813.793) * (-813.209) (-811.205) (-809.342) [-808.323] -- 0:00:38
385000 -- [-815.027] (-812.920) (-810.707) (-810.417) * (-812.762) (-810.602) [-808.720] (-809.321) -- 0:00:38
Average standard deviation of split frequencies: 0.011925
385500 -- (-810.244) (-810.534) [-812.693] (-814.545) * (-809.911) (-819.823) (-808.688) [-809.152] -- 0:00:38
386000 -- (-810.034) [-811.585] (-819.741) (-812.110) * (-812.870) (-809.948) [-809.555] (-809.555) -- 0:00:39
386500 -- (-809.951) (-812.035) (-814.980) [-813.963] * [-811.624] (-813.973) (-810.505) (-808.985) -- 0:00:39
387000 -- [-811.467] (-808.945) (-813.306) (-809.910) * (-809.723) [-808.396] (-814.641) (-809.052) -- 0:00:39
387500 -- (-812.471) [-810.288] (-812.108) (-808.206) * (-809.988) (-809.457) (-811.459) [-808.316] -- 0:00:39
388000 -- [-809.672] (-809.390) (-813.816) (-809.804) * [-809.771] (-810.000) (-811.112) (-809.111) -- 0:00:39
388500 -- [-810.444] (-809.240) (-810.205) (-813.153) * (-809.403) (-812.606) (-812.969) [-809.494] -- 0:00:39
389000 -- (-811.237) (-808.423) [-808.247] (-813.118) * [-809.389] (-809.275) (-817.239) (-810.797) -- 0:00:39
389500 -- (-810.795) (-815.919) [-811.486] (-810.827) * (-809.840) (-808.969) (-811.299) [-808.669] -- 0:00:39
390000 -- (-811.937) (-809.822) [-813.318] (-809.846) * (-809.392) [-808.973] (-810.554) (-809.784) -- 0:00:39
Average standard deviation of split frequencies: 0.013005
390500 -- (-811.559) (-811.711) (-810.917) [-810.195] * (-812.706) (-810.901) [-810.306] (-812.316) -- 0:00:39
391000 -- (-811.724) (-808.835) (-810.221) [-811.968] * (-811.685) [-814.459] (-809.741) (-810.545) -- 0:00:38
391500 -- (-810.431) [-808.335] (-815.185) (-812.679) * (-810.120) [-808.603] (-811.543) (-809.815) -- 0:00:38
392000 -- (-808.537) (-810.752) (-811.379) [-810.086] * (-814.110) (-810.361) [-814.882] (-812.997) -- 0:00:38
392500 -- (-809.407) [-808.643] (-810.102) (-809.090) * [-813.333] (-812.408) (-812.164) (-813.641) -- 0:00:38
393000 -- (-810.258) (-810.312) (-813.633) [-810.140] * (-811.042) [-813.202] (-810.630) (-810.866) -- 0:00:38
393500 -- (-813.434) (-808.627) (-813.321) [-809.168] * (-809.585) (-811.786) (-810.405) [-810.046] -- 0:00:38
394000 -- (-811.909) (-808.628) (-811.554) [-810.513] * (-808.842) (-812.574) (-808.638) [-810.079] -- 0:00:38
394500 -- (-814.560) (-811.792) [-809.006] (-810.557) * (-809.762) (-810.725) [-808.581] (-809.419) -- 0:00:38
395000 -- [-811.994] (-814.870) (-809.749) (-814.822) * (-810.776) (-812.830) (-810.271) [-808.494] -- 0:00:38
Average standard deviation of split frequencies: 0.012764
395500 -- (-818.415) (-810.078) [-810.897] (-812.326) * (-808.772) [-810.639] (-809.079) (-810.048) -- 0:00:38
396000 -- (-812.116) (-809.244) (-811.487) [-814.368] * (-810.407) [-809.649] (-809.566) (-809.623) -- 0:00:38
396500 -- (-813.238) (-808.934) (-809.015) [-808.979] * (-810.247) (-808.896) (-810.180) [-809.650] -- 0:00:38
397000 -- (-811.821) (-812.114) (-813.334) [-809.232] * (-810.084) [-809.614] (-808.996) (-812.148) -- 0:00:37
397500 -- (-808.829) (-811.390) [-812.748] (-809.064) * (-810.458) (-809.340) [-810.727] (-809.646) -- 0:00:37
398000 -- [-809.638] (-810.788) (-811.754) (-808.499) * (-811.364) (-811.550) (-809.994) [-811.346] -- 0:00:37
398500 -- [-812.234] (-812.509) (-813.427) (-808.657) * (-814.212) [-812.057] (-809.319) (-808.959) -- 0:00:37
399000 -- [-810.972] (-809.835) (-811.585) (-810.157) * [-809.775] (-812.596) (-809.840) (-812.631) -- 0:00:37
399500 -- (-808.810) (-811.593) (-815.926) [-810.206] * (-811.969) (-812.020) [-811.034] (-812.226) -- 0:00:37
400000 -- (-809.501) [-810.908] (-810.948) (-812.509) * (-813.487) [-809.860] (-811.683) (-808.533) -- 0:00:37
Average standard deviation of split frequencies: 0.012615
400500 -- (-810.727) (-808.539) [-810.689] (-810.258) * (-813.770) [-811.054] (-808.822) (-810.988) -- 0:00:37
401000 -- (-809.556) [-808.760] (-811.812) (-809.514) * (-815.336) [-808.414] (-808.429) (-810.353) -- 0:00:37
401500 -- [-810.792] (-810.988) (-810.425) (-809.329) * (-809.955) (-810.185) (-808.429) [-810.340] -- 0:00:37
402000 -- (-811.089) (-811.527) [-809.210] (-809.254) * (-809.130) [-808.721] (-808.723) (-814.500) -- 0:00:37
402500 -- (-809.396) [-811.290] (-810.458) (-809.895) * (-809.138) (-809.444) (-808.602) [-812.846] -- 0:00:38
403000 -- (-810.297) [-812.687] (-815.470) (-809.865) * (-816.696) [-809.739] (-808.648) (-809.605) -- 0:00:38
403500 -- (-810.724) (-815.270) [-817.577] (-809.341) * (-811.518) [-812.561] (-808.910) (-809.560) -- 0:00:38
404000 -- (-809.684) (-808.675) [-814.799] (-821.397) * (-812.455) (-811.737) (-808.557) [-809.098] -- 0:00:38
404500 -- [-809.042] (-809.352) (-814.589) (-813.663) * [-812.180] (-814.081) (-808.666) (-809.481) -- 0:00:38
405000 -- (-810.147) (-814.714) (-810.752) [-808.401] * [-810.404] (-810.989) (-812.466) (-815.374) -- 0:00:38
Average standard deviation of split frequencies: 0.012579
405500 -- (-810.401) (-812.608) (-811.735) [-809.136] * (-810.048) [-809.418] (-809.652) (-809.270) -- 0:00:38
406000 -- (-810.585) (-809.819) (-809.745) [-809.049] * (-810.722) (-809.718) (-812.115) [-808.771] -- 0:00:38
406500 -- (-810.556) (-808.408) (-810.962) [-808.930] * (-809.454) (-812.574) [-813.478] (-810.179) -- 0:00:37
407000 -- (-810.019) (-808.336) [-810.210] (-808.450) * [-810.859] (-811.214) (-810.122) (-811.181) -- 0:00:37
407500 -- (-809.426) (-810.336) [-810.036] (-808.869) * (-813.261) (-810.646) (-809.823) [-808.508] -- 0:00:37
408000 -- (-809.233) (-809.135) [-811.591] (-809.502) * (-809.702) (-810.207) (-809.279) [-808.707] -- 0:00:37
408500 -- [-808.575] (-810.916) (-811.026) (-808.936) * (-810.109) (-810.197) [-808.444] (-808.738) -- 0:00:37
409000 -- (-808.487) [-808.419] (-811.917) (-814.898) * [-808.620] (-809.638) (-808.589) (-809.497) -- 0:00:37
409500 -- (-810.675) [-813.666] (-811.454) (-811.303) * (-816.215) [-809.933] (-810.356) (-812.783) -- 0:00:37
410000 -- [-810.273] (-811.086) (-812.166) (-812.333) * (-811.126) (-808.919) (-810.117) [-809.170] -- 0:00:37
Average standard deviation of split frequencies: 0.012244
410500 -- (-811.724) [-809.253] (-812.664) (-809.426) * (-811.659) (-808.845) [-808.939] (-812.174) -- 0:00:37
411000 -- [-809.647] (-809.102) (-814.796) (-810.830) * (-817.061) (-811.974) [-808.882] (-812.248) -- 0:00:37
411500 -- (-808.767) [-808.359] (-813.771) (-810.975) * (-809.337) (-808.540) (-808.447) [-811.655] -- 0:00:37
412000 -- (-809.512) [-808.515] (-814.594) (-811.276) * (-813.450) (-811.427) (-808.970) [-813.795] -- 0:00:37
412500 -- (-811.805) (-809.902) (-810.702) [-808.527] * (-809.580) (-811.787) [-809.491] (-811.801) -- 0:00:37
413000 -- (-810.804) (-812.564) [-811.754] (-808.751) * (-808.678) [-810.047] (-809.983) (-813.190) -- 0:00:36
413500 -- (-813.979) (-813.417) (-809.567) [-808.755] * (-810.010) [-809.745] (-809.379) (-811.182) -- 0:00:36
414000 -- (-811.549) (-811.170) (-811.801) [-808.605] * (-808.797) [-809.657] (-808.844) (-811.088) -- 0:00:36
414500 -- (-810.653) (-808.773) [-809.536] (-811.301) * (-808.953) (-808.459) [-810.068] (-811.175) -- 0:00:36
415000 -- (-811.794) (-816.220) [-809.575] (-811.574) * (-810.170) [-810.013] (-809.650) (-810.621) -- 0:00:36
Average standard deviation of split frequencies: 0.012780
415500 -- (-812.137) (-812.882) [-809.809] (-811.931) * (-812.188) (-812.873) [-811.208] (-814.593) -- 0:00:36
416000 -- (-813.791) (-809.698) (-810.473) [-812.586] * (-812.331) (-809.994) [-811.588] (-812.804) -- 0:00:36
416500 -- (-811.816) [-810.583] (-809.726) (-810.658) * (-811.613) (-809.507) (-811.852) [-809.712] -- 0:00:36
417000 -- (-810.152) (-810.319) [-809.155] (-810.964) * (-815.673) (-809.589) (-809.202) [-810.408] -- 0:00:36
417500 -- (-809.295) (-813.847) [-810.112] (-811.290) * (-818.310) [-809.214] (-812.884) (-813.330) -- 0:00:36
418000 -- (-811.125) [-810.210] (-809.449) (-812.340) * (-813.789) [-809.136] (-809.522) (-810.687) -- 0:00:36
418500 -- (-810.478) (-810.256) [-809.118] (-809.801) * [-810.433] (-810.582) (-809.878) (-810.477) -- 0:00:36
419000 -- (-810.342) [-812.007] (-812.551) (-811.825) * [-808.308] (-810.262) (-811.369) (-808.982) -- 0:00:36
419500 -- (-810.480) (-810.300) (-818.007) [-813.934] * (-811.808) [-809.347] (-811.300) (-808.772) -- 0:00:37
420000 -- [-811.145] (-810.374) (-812.376) (-814.208) * (-809.672) [-809.346] (-808.993) (-809.171) -- 0:00:37
Average standard deviation of split frequencies: 0.012700
420500 -- (-812.190) (-811.339) [-812.314] (-817.630) * (-811.839) [-814.131] (-812.131) (-810.905) -- 0:00:37
421000 -- [-812.877] (-810.682) (-809.929) (-809.230) * (-809.608) [-811.205] (-811.751) (-813.299) -- 0:00:37
421500 -- [-812.963] (-809.730) (-811.332) (-813.112) * [-808.974] (-812.898) (-811.674) (-811.840) -- 0:00:37
422000 -- (-809.450) [-810.525] (-810.702) (-810.529) * [-814.149] (-811.357) (-810.564) (-809.899) -- 0:00:36
422500 -- (-809.315) (-810.934) (-809.689) [-811.988] * [-810.295] (-810.026) (-810.799) (-810.123) -- 0:00:36
423000 -- (-809.099) [-809.930] (-813.730) (-810.462) * (-813.448) [-813.253] (-810.165) (-810.773) -- 0:00:36
423500 -- (-809.859) (-818.185) [-811.023] (-811.094) * (-810.355) (-810.201) (-811.928) [-809.024] -- 0:00:36
424000 -- (-811.113) (-810.931) (-811.985) [-808.380] * (-810.653) (-809.071) (-811.559) [-810.969] -- 0:00:36
424500 -- (-812.015) (-812.731) [-814.312] (-809.519) * [-810.440] (-813.158) (-809.150) (-813.291) -- 0:00:36
425000 -- [-812.863] (-810.127) (-809.179) (-810.613) * (-812.626) (-814.888) [-809.856] (-811.788) -- 0:00:36
Average standard deviation of split frequencies: 0.012726
425500 -- (-809.749) [-811.085] (-810.041) (-810.243) * (-811.884) (-810.346) (-812.021) [-812.376] -- 0:00:36
426000 -- (-811.107) (-811.251) [-810.986] (-809.057) * [-810.719] (-809.358) (-809.766) (-812.060) -- 0:00:36
426500 -- (-809.902) [-809.756] (-811.381) (-811.925) * (-809.662) (-812.139) [-809.946] (-809.146) -- 0:00:36
427000 -- (-809.197) [-809.611] (-810.331) (-811.887) * (-812.398) (-809.511) [-809.432] (-809.084) -- 0:00:36
427500 -- [-812.729] (-810.516) (-814.020) (-809.002) * (-811.154) (-810.377) (-809.610) [-809.015] -- 0:00:36
428000 -- (-810.834) (-808.940) (-812.625) [-814.076] * [-812.475] (-815.762) (-811.691) (-810.885) -- 0:00:36
428500 -- [-810.580] (-811.769) (-810.084) (-809.825) * (-810.902) [-810.379] (-812.701) (-811.105) -- 0:00:36
429000 -- (-810.475) [-809.367] (-810.644) (-814.958) * [-812.567] (-810.267) (-811.002) (-812.226) -- 0:00:35
429500 -- (-810.161) (-809.088) (-811.281) [-811.434] * (-812.086) (-815.074) (-810.251) [-810.043] -- 0:00:35
430000 -- (-812.213) [-809.770] (-812.275) (-811.404) * (-816.630) [-813.332] (-810.378) (-809.835) -- 0:00:35
Average standard deviation of split frequencies: 0.012041
430500 -- [-809.743] (-808.720) (-811.796) (-811.601) * [-808.883] (-808.965) (-809.268) (-810.440) -- 0:00:35
431000 -- [-810.394] (-813.003) (-811.972) (-808.282) * (-812.185) [-808.781] (-810.195) (-814.401) -- 0:00:35
431500 -- [-811.478] (-810.252) (-808.386) (-810.351) * (-815.577) [-808.865] (-812.519) (-808.201) -- 0:00:35
432000 -- [-812.474] (-810.842) (-810.545) (-808.962) * (-810.920) (-811.908) [-812.416] (-810.612) -- 0:00:35
432500 -- (-808.781) (-808.613) [-811.120] (-810.280) * [-811.234] (-814.874) (-812.205) (-813.153) -- 0:00:35
433000 -- [-811.635] (-808.410) (-813.399) (-810.063) * (-812.146) (-814.373) (-812.589) [-812.953] -- 0:00:35
433500 -- (-813.003) (-810.516) [-813.633] (-811.115) * (-810.716) [-811.439] (-809.729) (-810.695) -- 0:00:35
434000 -- (-815.674) (-809.902) [-812.825] (-810.885) * [-810.449] (-813.597) (-808.634) (-809.383) -- 0:00:35
434500 -- [-810.195] (-811.866) (-808.503) (-809.042) * (-811.095) (-811.239) (-809.699) [-809.912] -- 0:00:35
435000 -- [-811.492] (-811.739) (-808.714) (-809.778) * (-812.053) (-808.880) (-815.324) [-810.926] -- 0:00:35
Average standard deviation of split frequencies: 0.012013
435500 -- (-812.797) [-812.278] (-810.415) (-810.517) * (-810.086) [-808.845] (-811.750) (-809.327) -- 0:00:34
436000 -- (-809.618) (-809.129) [-811.303] (-810.744) * (-810.529) [-808.900] (-811.373) (-808.382) -- 0:00:36
436500 -- (-814.035) (-810.447) (-811.520) [-815.337] * (-818.472) (-811.203) (-812.763) [-811.630] -- 0:00:36
437000 -- (-813.556) (-809.051) (-808.871) [-809.158] * (-809.898) (-810.784) (-810.131) [-813.898] -- 0:00:36
437500 -- (-812.738) (-810.418) (-808.643) [-811.898] * (-812.166) (-813.832) (-811.093) [-809.873] -- 0:00:36
438000 -- [-810.235] (-811.049) (-809.847) (-809.486) * [-812.901] (-815.989) (-809.511) (-813.759) -- 0:00:35
438500 -- (-808.845) [-808.926] (-814.305) (-816.985) * (-814.544) (-812.080) [-811.012] (-812.611) -- 0:00:35
439000 -- (-810.872) (-808.235) [-816.513] (-812.340) * [-812.018] (-813.023) (-809.478) (-811.376) -- 0:00:35
439500 -- (-809.278) (-810.376) [-813.613] (-811.999) * (-808.932) (-813.921) [-810.387] (-810.499) -- 0:00:35
440000 -- (-811.037) [-811.442] (-813.016) (-809.626) * (-811.695) (-809.300) [-811.070] (-809.759) -- 0:00:35
Average standard deviation of split frequencies: 0.011530
440500 -- (-810.356) (-809.421) (-813.261) [-809.397] * (-813.765) (-813.594) [-809.139] (-811.487) -- 0:00:35
441000 -- [-809.030] (-812.397) (-816.803) (-811.172) * (-811.320) [-811.129] (-809.301) (-811.051) -- 0:00:35
441500 -- (-808.449) (-811.829) (-811.074) [-811.587] * (-813.265) (-812.962) [-809.115] (-814.271) -- 0:00:35
442000 -- [-809.188] (-810.028) (-813.569) (-811.386) * (-811.978) [-814.269] (-808.946) (-814.145) -- 0:00:35
442500 -- (-813.636) (-809.208) [-808.471] (-811.779) * (-812.178) (-810.880) [-812.377] (-810.559) -- 0:00:35
443000 -- (-808.838) (-808.856) (-813.122) [-809.511] * (-809.503) (-809.463) [-809.301] (-813.338) -- 0:00:35
443500 -- (-811.090) (-809.436) [-811.631] (-811.689) * (-809.368) (-809.925) [-809.999] (-814.128) -- 0:00:35
444000 -- (-810.818) (-810.341) [-809.691] (-809.253) * (-809.392) (-809.782) [-812.422] (-808.584) -- 0:00:35
444500 -- (-809.685) (-808.972) (-810.615) [-810.708] * (-810.097) (-809.650) [-812.195] (-810.378) -- 0:00:34
445000 -- (-809.837) [-808.806] (-809.417) (-808.583) * (-811.728) (-809.386) (-813.230) [-810.187] -- 0:00:34
Average standard deviation of split frequencies: 0.011568
445500 -- (-809.899) (-811.075) [-809.093] (-809.208) * (-810.428) (-811.316) (-814.236) [-809.788] -- 0:00:34
446000 -- (-811.353) (-810.196) (-810.508) [-812.016] * (-811.198) [-809.342] (-810.115) (-812.822) -- 0:00:34
446500 -- [-812.071] (-808.871) (-812.575) (-809.260) * (-810.638) [-808.402] (-809.029) (-817.410) -- 0:00:34
447000 -- (-810.887) (-812.695) [-809.716] (-809.745) * [-810.151] (-810.074) (-809.919) (-809.460) -- 0:00:34
447500 -- (-815.301) [-809.182] (-810.023) (-808.230) * [-808.256] (-813.842) (-809.792) (-814.635) -- 0:00:34
448000 -- (-808.827) (-810.320) [-808.497] (-810.617) * (-808.154) [-809.753] (-810.103) (-813.571) -- 0:00:34
448500 -- (-809.090) (-811.483) (-809.914) [-809.079] * (-810.391) [-810.536] (-815.160) (-814.013) -- 0:00:34
449000 -- (-809.195) (-813.066) (-811.884) [-811.303] * (-810.250) [-810.408] (-810.306) (-813.348) -- 0:00:34
449500 -- [-812.664] (-812.319) (-811.378) (-809.999) * (-809.914) (-811.087) (-813.586) [-815.092] -- 0:00:34
450000 -- (-812.910) [-812.835] (-815.949) (-808.519) * (-810.493) [-811.386] (-809.573) (-810.151) -- 0:00:34
Average standard deviation of split frequencies: 0.011332
450500 -- (-809.378) (-809.970) [-809.696] (-808.609) * (-812.328) (-810.359) (-809.674) [-810.803] -- 0:00:34
451000 -- [-809.648] (-810.895) (-811.932) (-808.408) * (-811.791) (-813.346) [-810.779] (-810.001) -- 0:00:34
451500 -- (-811.266) (-810.482) [-811.780] (-809.322) * (-812.122) [-810.335] (-809.548) (-813.192) -- 0:00:34
452000 -- (-811.027) (-811.361) [-809.372] (-809.471) * (-809.470) (-808.523) (-812.092) [-809.128] -- 0:00:33
452500 -- (-812.769) [-810.951] (-810.996) (-811.140) * (-813.196) [-808.957] (-813.264) (-808.488) -- 0:00:35
453000 -- (-811.594) [-809.897] (-814.284) (-811.115) * [-813.694] (-810.223) (-811.190) (-810.211) -- 0:00:35
453500 -- (-810.685) [-809.822] (-811.452) (-810.331) * [-809.274] (-811.467) (-810.224) (-810.065) -- 0:00:34
454000 -- [-808.906] (-812.432) (-812.704) (-809.578) * (-810.360) [-808.430] (-810.105) (-808.889) -- 0:00:34
454500 -- (-809.206) (-812.580) [-809.317] (-810.210) * (-808.518) (-817.226) (-810.277) [-808.410] -- 0:00:34
455000 -- (-810.133) (-811.237) [-809.604] (-811.133) * [-809.924] (-811.848) (-814.878) (-809.450) -- 0:00:34
Average standard deviation of split frequencies: 0.011429
455500 -- [-811.030] (-808.392) (-810.154) (-810.754) * (-810.847) (-816.408) [-810.767] (-812.312) -- 0:00:34
456000 -- (-814.474) (-810.478) [-810.627] (-813.110) * (-809.167) (-809.609) [-809.358] (-809.884) -- 0:00:34
456500 -- (-810.298) (-809.023) [-809.851] (-809.961) * (-811.357) (-809.706) [-809.766] (-809.132) -- 0:00:34
457000 -- [-810.503] (-812.873) (-810.584) (-809.296) * [-808.658] (-809.849) (-809.643) (-808.789) -- 0:00:34
457500 -- [-811.573] (-808.393) (-816.195) (-813.392) * (-810.260) (-809.600) [-808.620] (-810.429) -- 0:00:34
458000 -- [-808.954] (-809.583) (-812.866) (-810.185) * [-810.408] (-811.520) (-808.776) (-815.401) -- 0:00:34
458500 -- (-816.927) (-810.263) (-811.933) [-809.933] * (-810.646) [-811.558] (-809.043) (-809.144) -- 0:00:34
459000 -- [-810.972] (-812.974) (-812.207) (-810.539) * (-811.704) (-809.900) (-809.234) [-814.112] -- 0:00:34
459500 -- [-810.998] (-811.034) (-813.658) (-810.434) * [-810.166] (-815.438) (-809.213) (-809.354) -- 0:00:34
460000 -- (-808.971) (-811.976) (-809.983) [-810.402] * [-809.519] (-810.722) (-812.713) (-814.194) -- 0:00:34
Average standard deviation of split frequencies: 0.010654
460500 -- [-815.939] (-811.332) (-815.534) (-811.546) * [-810.229] (-809.450) (-810.291) (-811.954) -- 0:00:33
461000 -- (-812.614) (-815.689) (-809.390) [-808.627] * (-811.938) (-812.259) (-814.370) [-810.986] -- 0:00:33
461500 -- (-813.275) [-809.596] (-811.329) (-809.632) * [-812.248] (-811.368) (-812.229) (-809.216) -- 0:00:33
462000 -- [-812.886] (-810.188) (-810.069) (-809.687) * (-810.414) (-813.972) (-811.696) [-811.332] -- 0:00:33
462500 -- [-813.749] (-808.630) (-812.449) (-812.886) * (-813.159) [-809.133] (-809.380) (-808.760) -- 0:00:33
463000 -- (-811.812) [-809.385] (-811.452) (-811.208) * (-809.442) (-809.262) (-814.537) [-810.290] -- 0:00:33
463500 -- (-809.467) (-810.475) [-809.852] (-809.251) * [-814.544] (-811.974) (-812.464) (-808.978) -- 0:00:33
464000 -- (-810.307) (-813.156) [-810.837] (-808.750) * [-809.938] (-810.024) (-808.246) (-811.239) -- 0:00:33
464500 -- (-809.034) (-813.824) (-812.311) [-808.456] * [-812.040] (-809.791) (-810.844) (-809.026) -- 0:00:33
465000 -- (-809.942) (-812.163) [-809.256] (-808.565) * [-808.295] (-810.794) (-813.479) (-810.506) -- 0:00:33
Average standard deviation of split frequencies: 0.010354
465500 -- (-815.806) (-811.590) [-810.954] (-810.474) * [-809.739] (-809.574) (-811.504) (-812.069) -- 0:00:33
466000 -- [-811.523] (-810.237) (-812.512) (-811.327) * [-812.334] (-810.906) (-810.734) (-809.160) -- 0:00:33
466500 -- (-813.458) (-811.151) (-810.784) [-811.445] * [-812.638] (-811.600) (-810.204) (-813.388) -- 0:00:33
467000 -- [-811.264] (-811.122) (-813.148) (-810.357) * (-810.099) (-814.018) (-811.019) [-811.177] -- 0:00:33
467500 -- (-812.181) (-810.735) (-811.497) [-808.994] * (-810.586) (-810.063) (-812.557) [-809.538] -- 0:00:33
468000 -- (-809.326) [-810.736] (-811.630) (-814.323) * (-808.351) (-808.565) (-811.141) [-810.510] -- 0:00:32
468500 -- (-809.423) [-809.896] (-812.554) (-809.911) * [-810.433] (-812.430) (-810.113) (-811.267) -- 0:00:32
469000 -- (-809.735) [-811.842] (-815.044) (-813.072) * [-814.339] (-811.275) (-809.564) (-809.109) -- 0:00:32
469500 -- [-811.960] (-810.746) (-812.952) (-814.084) * (-812.332) (-811.318) (-809.345) [-814.243] -- 0:00:33
470000 -- (-809.894) [-811.316] (-814.387) (-810.543) * [-810.667] (-809.833) (-810.350) (-812.509) -- 0:00:33
Average standard deviation of split frequencies: 0.010664
470500 -- (-811.642) (-809.808) [-809.211] (-811.236) * (-810.790) [-813.321] (-814.518) (-808.750) -- 0:00:33
471000 -- [-810.666] (-812.351) (-808.857) (-809.854) * (-811.363) [-808.861] (-814.029) (-810.709) -- 0:00:33
471500 -- (-809.650) [-814.184] (-809.161) (-809.311) * (-814.412) (-808.931) (-808.614) [-811.274] -- 0:00:33
472000 -- (-813.394) (-814.035) [-811.427] (-809.080) * (-812.780) (-809.445) [-809.063] (-809.696) -- 0:00:33
472500 -- (-810.113) [-814.481] (-811.348) (-810.052) * (-810.914) (-810.242) (-809.041) [-812.062] -- 0:00:33
473000 -- (-808.986) (-811.638) (-809.087) [-813.292] * (-814.824) (-810.218) (-810.160) [-810.872] -- 0:00:33
473500 -- [-809.034] (-810.417) (-810.614) (-815.049) * (-810.048) [-811.945] (-809.089) (-810.142) -- 0:00:33
474000 -- (-812.279) (-812.191) [-808.909] (-809.215) * (-809.448) (-813.533) [-809.144] (-811.507) -- 0:00:33
474500 -- [-810.859] (-809.776) (-810.983) (-812.802) * [-811.173] (-810.337) (-808.537) (-810.762) -- 0:00:33
475000 -- (-811.912) (-812.489) [-809.086] (-808.692) * (-810.086) (-809.227) (-810.911) [-810.063] -- 0:00:33
Average standard deviation of split frequencies: 0.010195
475500 -- (-809.854) (-812.413) [-809.807] (-816.252) * (-811.290) (-809.298) (-808.851) [-809.291] -- 0:00:33
476000 -- (-811.325) [-810.282] (-809.698) (-813.917) * (-811.380) (-809.297) (-813.043) [-809.792] -- 0:00:33
476500 -- [-810.505] (-808.761) (-813.299) (-810.058) * [-813.225] (-809.152) (-809.706) (-812.640) -- 0:00:32
477000 -- (-812.974) (-815.580) (-813.130) [-812.108] * (-810.974) (-814.403) (-810.058) [-813.726] -- 0:00:32
477500 -- (-810.783) (-810.088) (-812.506) [-809.164] * (-808.692) (-809.143) [-810.894] (-810.788) -- 0:00:32
478000 -- (-813.396) (-810.616) (-809.893) [-809.465] * (-808.913) (-813.431) (-810.404) [-815.754] -- 0:00:32
478500 -- (-809.161) (-812.753) [-812.126] (-811.035) * (-809.260) [-813.799] (-810.306) (-813.196) -- 0:00:32
479000 -- (-812.433) (-812.202) (-811.101) [-813.753] * [-809.609] (-810.640) (-810.025) (-811.124) -- 0:00:32
479500 -- (-810.717) [-813.979] (-812.550) (-810.522) * (-811.770) [-811.057] (-812.472) (-811.263) -- 0:00:32
480000 -- [-812.474] (-808.947) (-810.878) (-810.798) * (-811.670) [-810.747] (-813.631) (-809.275) -- 0:00:32
Average standard deviation of split frequencies: 0.009346
480500 -- (-811.631) (-810.192) [-810.919] (-812.583) * (-811.483) (-815.623) [-811.019] (-811.717) -- 0:00:32
481000 -- (-809.779) [-810.094] (-812.202) (-810.629) * [-814.228] (-813.068) (-812.370) (-809.493) -- 0:00:32
481500 -- (-813.117) (-809.392) (-810.083) [-810.730] * (-810.303) (-811.815) [-812.497] (-808.320) -- 0:00:32
482000 -- (-811.933) (-810.070) [-808.886] (-809.327) * [-811.954] (-809.525) (-811.016) (-810.408) -- 0:00:32
482500 -- (-815.798) (-810.993) (-811.925) [-809.395] * (-811.333) [-811.313] (-808.926) (-814.842) -- 0:00:32
483000 -- (-809.035) [-810.974] (-815.680) (-809.313) * (-810.310) [-812.730] (-811.899) (-812.033) -- 0:00:32
483500 -- (-809.812) (-809.852) [-809.129] (-810.060) * [-811.431] (-819.291) (-808.571) (-809.175) -- 0:00:32
484000 -- (-810.781) (-810.092) [-809.704] (-813.466) * (-809.451) (-810.614) [-809.171] (-808.781) -- 0:00:31
484500 -- (-809.312) (-813.975) [-811.496] (-808.871) * (-811.275) (-808.973) (-813.579) [-810.017] -- 0:00:31
485000 -- (-811.858) (-813.977) [-814.191] (-810.040) * (-811.923) [-812.084] (-811.757) (-811.470) -- 0:00:31
Average standard deviation of split frequencies: 0.009414
485500 -- [-808.401] (-809.276) (-808.607) (-809.143) * [-810.216] (-809.278) (-812.894) (-810.795) -- 0:00:31
486000 -- [-808.648] (-808.663) (-810.613) (-812.273) * (-810.105) [-809.388] (-814.194) (-808.752) -- 0:00:32
486500 -- (-812.313) (-809.660) [-810.214] (-811.568) * (-812.902) (-810.260) (-810.078) [-811.172] -- 0:00:32
487000 -- (-809.694) [-809.109] (-811.359) (-816.426) * (-811.324) (-810.264) (-813.154) [-808.515] -- 0:00:32
487500 -- (-809.529) (-809.182) (-809.949) [-809.378] * (-811.016) (-809.701) (-809.063) [-808.748] -- 0:00:32
488000 -- (-812.418) (-811.832) (-813.811) [-810.979] * (-810.983) (-811.663) (-810.696) [-809.405] -- 0:00:32
488500 -- (-813.320) [-810.132] (-811.934) (-810.822) * (-810.853) (-810.936) [-809.531] (-812.209) -- 0:00:32
489000 -- (-814.101) (-809.032) (-811.934) [-810.365] * (-809.339) [-812.337] (-809.223) (-814.568) -- 0:00:32
489500 -- (-809.661) [-810.038] (-809.524) (-809.521) * [-809.983] (-814.447) (-809.938) (-810.898) -- 0:00:32
490000 -- (-817.296) (-808.253) (-809.411) [-809.306] * (-810.653) (-810.171) [-812.623] (-811.467) -- 0:00:32
Average standard deviation of split frequencies: 0.009720
490500 -- (-816.947) [-813.539] (-809.961) (-814.029) * [-811.286] (-811.229) (-813.193) (-814.617) -- 0:00:32
491000 -- (-814.611) (-811.315) (-808.617) [-810.201] * (-809.858) (-810.807) (-810.476) [-817.192] -- 0:00:32
491500 -- (-811.409) [-809.807] (-811.868) (-812.205) * [-809.754] (-812.120) (-810.099) (-811.379) -- 0:00:32
492000 -- (-808.684) (-812.243) [-810.688] (-814.100) * (-808.855) [-809.378] (-809.080) (-810.728) -- 0:00:32
492500 -- (-809.527) (-808.633) (-813.736) [-810.788] * (-809.345) (-809.754) [-810.093] (-810.606) -- 0:00:31
493000 -- (-811.685) (-811.963) (-819.071) [-812.225] * (-813.045) (-811.720) (-811.712) [-811.851] -- 0:00:31
493500 -- [-808.803] (-811.985) (-811.390) (-812.905) * (-809.337) (-809.398) [-809.836] (-809.558) -- 0:00:31
494000 -- [-808.682] (-812.607) (-809.219) (-810.554) * (-812.593) (-812.199) [-810.471] (-808.916) -- 0:00:31
494500 -- (-808.759) (-809.990) (-809.750) [-809.390] * (-808.598) (-812.698) (-809.295) [-809.857] -- 0:00:31
495000 -- (-815.643) (-811.766) [-812.035] (-809.248) * (-808.629) (-811.150) [-810.086] (-812.600) -- 0:00:31
Average standard deviation of split frequencies: 0.009951
495500 -- (-809.209) (-809.195) [-813.158] (-810.980) * (-809.097) (-812.506) [-816.188] (-813.905) -- 0:00:31
496000 -- [-809.447] (-811.696) (-812.596) (-810.148) * (-808.894) (-810.937) [-810.086] (-810.856) -- 0:00:31
496500 -- (-809.121) (-809.407) (-810.405) [-810.214] * (-808.764) [-810.228] (-810.261) (-812.013) -- 0:00:31
497000 -- (-809.367) (-809.000) (-809.334) [-810.357] * [-808.545] (-809.727) (-811.772) (-810.848) -- 0:00:31
497500 -- (-809.590) (-810.784) (-812.314) [-809.539] * (-808.985) (-810.512) (-810.356) [-808.599] -- 0:00:31
498000 -- (-811.575) [-810.322] (-808.881) (-810.350) * [-809.292] (-811.751) (-809.669) (-818.628) -- 0:00:31
498500 -- (-813.656) (-809.715) (-814.630) [-811.090] * (-810.055) [-810.240] (-810.061) (-812.114) -- 0:00:31
499000 -- (-812.589) (-815.016) [-813.218] (-810.984) * (-810.611) (-809.680) [-810.100] (-809.983) -- 0:00:31
499500 -- (-811.092) (-809.053) [-810.148] (-813.400) * (-809.484) (-813.299) [-810.962] (-812.544) -- 0:00:31
500000 -- (-812.668) [-814.012] (-810.275) (-813.463) * (-809.371) [-810.009] (-811.453) (-809.201) -- 0:00:31
Average standard deviation of split frequencies: 0.010246
500500 -- [-809.463] (-812.663) (-809.904) (-810.010) * (-809.371) [-812.804] (-810.821) (-812.680) -- 0:00:30
501000 -- (-811.919) (-814.924) (-812.536) [-811.454] * (-808.971) [-809.245] (-809.674) (-813.112) -- 0:00:30
501500 -- (-810.146) (-812.751) [-809.324] (-811.283) * [-808.368] (-817.427) (-812.053) (-812.030) -- 0:00:30
502000 -- (-810.769) (-812.654) [-810.740] (-809.690) * (-809.298) (-810.276) [-810.363] (-818.058) -- 0:00:30
502500 -- (-810.295) [-809.687] (-812.475) (-809.856) * (-808.998) (-812.839) (-811.436) [-811.645] -- 0:00:31
503000 -- (-811.900) (-810.767) [-812.917] (-811.711) * (-808.969) (-809.526) (-809.686) [-813.738] -- 0:00:31
503500 -- (-812.130) [-810.468] (-809.154) (-811.161) * (-809.623) (-809.083) (-809.490) [-809.825] -- 0:00:31
504000 -- (-816.638) (-809.856) (-808.463) [-808.330] * (-810.522) (-810.962) [-809.315] (-812.602) -- 0:00:31
504500 -- [-814.773] (-812.241) (-808.881) (-809.796) * (-809.557) [-812.331] (-812.251) (-813.020) -- 0:00:31
505000 -- (-810.556) [-812.624] (-808.882) (-813.499) * (-809.813) (-809.429) (-810.347) [-811.187] -- 0:00:31
Average standard deviation of split frequencies: 0.010921
505500 -- (-808.665) (-809.295) [-809.154] (-811.525) * (-810.121) [-809.507] (-811.520) (-809.990) -- 0:00:31
506000 -- (-808.678) (-812.661) [-809.659] (-808.656) * (-811.730) [-809.021] (-810.306) (-809.797) -- 0:00:31
506500 -- (-810.654) (-811.546) (-815.821) [-809.116] * (-810.146) (-809.402) (-810.602) [-809.765] -- 0:00:31
507000 -- (-811.771) (-810.743) (-813.430) [-810.105] * (-812.424) [-808.879] (-809.040) (-810.010) -- 0:00:31
507500 -- (-808.939) (-810.728) (-809.576) [-810.189] * (-812.807) (-808.617) (-809.574) [-810.047] -- 0:00:31
508000 -- (-811.531) (-810.374) [-810.672] (-810.473) * (-810.752) (-810.257) [-810.657] (-812.111) -- 0:00:30
508500 -- (-810.818) (-810.626) [-810.089] (-809.454) * [-810.351] (-809.871) (-810.416) (-813.578) -- 0:00:30
509000 -- (-810.900) (-810.683) (-810.652) [-812.016] * (-810.854) (-810.445) [-810.878] (-808.903) -- 0:00:30
509500 -- (-810.536) (-812.575) (-810.417) [-808.401] * [-811.320] (-812.153) (-809.207) (-809.732) -- 0:00:30
510000 -- (-808.939) [-809.081] (-811.481) (-810.833) * (-810.138) (-810.881) [-809.426] (-810.092) -- 0:00:30
Average standard deviation of split frequencies: 0.010770
510500 -- [-809.492] (-812.940) (-809.533) (-813.288) * [-809.365] (-812.399) (-809.748) (-811.506) -- 0:00:30
511000 -- (-809.744) [-809.460] (-808.709) (-809.440) * [-810.632] (-812.494) (-809.142) (-812.076) -- 0:00:30
511500 -- (-812.040) (-809.425) [-808.507] (-810.644) * [-808.684] (-813.288) (-811.197) (-811.525) -- 0:00:30
512000 -- (-808.145) (-811.813) (-809.029) [-811.891] * (-812.479) [-811.571] (-812.345) (-813.175) -- 0:00:30
512500 -- (-809.224) (-812.425) (-810.353) [-809.229] * [-809.769] (-809.550) (-808.451) (-809.691) -- 0:00:30
513000 -- [-811.181] (-812.110) (-811.703) (-809.351) * (-814.250) (-809.787) [-810.687] (-816.158) -- 0:00:30
513500 -- (-814.443) (-814.980) (-809.800) [-809.285] * (-812.215) (-813.576) [-811.761] (-809.161) -- 0:00:30
514000 -- [-810.650] (-809.529) (-808.926) (-809.491) * (-812.026) [-809.547] (-809.720) (-809.225) -- 0:00:30
514500 -- (-809.172) [-814.157] (-808.531) (-810.658) * (-811.524) (-810.102) (-809.652) [-813.074] -- 0:00:30
515000 -- (-811.122) [-809.565] (-811.388) (-810.084) * (-812.878) [-811.069] (-810.428) (-809.290) -- 0:00:30
Average standard deviation of split frequencies: 0.011017
515500 -- (-812.459) (-809.842) [-810.865] (-811.233) * (-812.065) (-809.829) [-808.704] (-812.052) -- 0:00:30
516000 -- (-813.891) (-809.272) (-811.252) [-812.142] * (-809.618) (-810.249) [-810.798] (-811.001) -- 0:00:30
516500 -- [-814.715] (-813.403) (-811.324) (-808.890) * (-810.293) [-808.522] (-810.203) (-811.916) -- 0:00:29
517000 -- (-813.259) (-812.335) (-809.534) [-810.465] * (-809.304) [-811.226] (-808.733) (-809.495) -- 0:00:29
517500 -- [-810.391] (-812.981) (-809.822) (-809.257) * (-810.521) [-809.398] (-809.556) (-808.690) -- 0:00:29
518000 -- [-808.589] (-808.662) (-811.889) (-809.673) * (-811.770) [-810.294] (-810.481) (-811.513) -- 0:00:29
518500 -- (-810.022) (-815.569) (-810.370) [-811.355] * [-810.976] (-810.455) (-809.446) (-811.820) -- 0:00:30
519000 -- (-815.562) (-809.521) [-809.748] (-809.814) * (-812.348) (-810.567) [-810.723] (-810.710) -- 0:00:30
519500 -- (-808.909) [-808.939] (-809.002) (-811.419) * [-810.842] (-809.470) (-809.225) (-808.924) -- 0:00:30
520000 -- (-808.798) [-812.617] (-811.732) (-817.328) * [-810.457] (-808.227) (-809.904) (-810.247) -- 0:00:30
Average standard deviation of split frequencies: 0.011066
520500 -- (-811.576) (-811.555) [-811.765] (-809.372) * (-810.555) [-808.880] (-808.527) (-813.582) -- 0:00:30
521000 -- [-809.667] (-816.836) (-810.059) (-809.208) * (-811.144) [-808.975] (-810.242) (-813.637) -- 0:00:30
521500 -- (-811.886) [-811.027] (-808.462) (-809.448) * [-809.609] (-810.035) (-811.886) (-814.331) -- 0:00:30
522000 -- (-811.982) [-810.440] (-809.421) (-809.437) * (-809.664) [-809.442] (-810.089) (-809.843) -- 0:00:30
522500 -- (-812.522) [-809.559] (-809.989) (-809.637) * [-808.643] (-811.644) (-809.401) (-811.661) -- 0:00:30
523000 -- (-812.039) (-814.545) [-810.435] (-809.632) * [-809.578] (-810.235) (-811.979) (-809.869) -- 0:00:30
523500 -- (-812.130) [-810.650] (-812.856) (-810.590) * (-814.869) (-810.806) (-811.011) [-810.103] -- 0:00:30
524000 -- (-809.996) (-811.022) (-812.469) [-810.576] * (-809.905) (-809.974) [-810.198] (-808.883) -- 0:00:29
524500 -- [-809.412] (-808.556) (-811.100) (-808.940) * [-808.434] (-811.690) (-814.724) (-811.499) -- 0:00:29
525000 -- (-809.107) [-808.576] (-809.342) (-810.285) * [-809.143] (-810.192) (-812.097) (-811.018) -- 0:00:29
Average standard deviation of split frequencies: 0.010854
525500 -- [-811.219] (-810.251) (-811.921) (-816.664) * (-811.679) [-810.544] (-814.292) (-811.366) -- 0:00:29
526000 -- (-813.244) (-811.585) (-811.487) [-811.897] * (-808.106) [-811.484] (-812.093) (-810.777) -- 0:00:29
526500 -- (-809.478) (-811.425) [-810.942] (-813.610) * [-812.339] (-812.191) (-810.218) (-809.634) -- 0:00:29
527000 -- [-810.069] (-810.675) (-814.042) (-808.830) * [-808.828] (-813.491) (-809.867) (-808.321) -- 0:00:29
527500 -- (-812.471) [-809.421] (-811.152) (-809.469) * (-811.342) (-809.269) [-809.691] (-814.471) -- 0:00:29
528000 -- [-808.474] (-811.443) (-816.019) (-809.892) * (-812.876) (-810.619) (-810.219) [-813.084] -- 0:00:29
528500 -- [-809.397] (-810.911) (-808.635) (-815.697) * [-809.461] (-811.140) (-811.837) (-811.959) -- 0:00:29
529000 -- (-809.394) (-813.999) [-811.409] (-811.415) * (-808.686) (-810.328) (-811.156) [-811.381] -- 0:00:29
529500 -- (-811.075) (-814.142) (-810.454) [-809.195] * [-812.247] (-811.623) (-810.540) (-811.820) -- 0:00:29
530000 -- (-809.573) (-814.062) [-810.023] (-810.230) * (-809.900) (-808.972) (-815.560) [-809.647] -- 0:00:29
Average standard deviation of split frequencies: 0.010907
530500 -- [-808.884] (-809.274) (-812.074) (-810.890) * [-810.913] (-811.301) (-811.690) (-809.587) -- 0:00:29
531000 -- [-808.742] (-808.646) (-813.611) (-812.747) * [-808.474] (-808.604) (-811.382) (-811.506) -- 0:00:29
531500 -- [-808.171] (-808.207) (-811.599) (-810.162) * (-810.593) [-811.252] (-812.040) (-810.418) -- 0:00:29
532000 -- [-810.748] (-808.836) (-810.182) (-810.115) * (-816.094) (-812.988) [-809.977] (-811.348) -- 0:00:29
532500 -- (-810.967) (-810.357) [-808.616] (-809.011) * (-810.046) (-811.970) [-809.532] (-808.420) -- 0:00:28
533000 -- (-811.410) (-814.026) (-812.974) [-812.165] * [-809.426] (-812.766) (-810.504) (-809.555) -- 0:00:29
533500 -- (-811.415) (-811.602) [-810.205] (-810.084) * (-810.131) [-810.605] (-811.810) (-813.696) -- 0:00:29
534000 -- (-811.094) (-811.160) (-810.245) [-809.456] * (-809.424) (-813.898) [-809.850] (-808.293) -- 0:00:29
534500 -- (-811.106) (-808.939) (-815.345) [-810.413] * [-810.988] (-810.959) (-810.217) (-810.278) -- 0:00:29
535000 -- (-813.606) [-811.850] (-814.678) (-811.337) * (-817.968) (-809.497) (-813.357) [-810.483] -- 0:00:29
Average standard deviation of split frequencies: 0.010847
535500 -- (-809.562) (-810.789) (-813.377) [-808.840] * (-809.862) (-808.966) [-810.411] (-808.850) -- 0:00:29
536000 -- (-810.444) (-808.343) [-809.259] (-808.135) * (-810.888) (-810.334) [-808.971] (-809.301) -- 0:00:29
536500 -- (-812.987) (-810.499) (-810.063) [-809.052] * [-809.334] (-810.971) (-810.282) (-808.543) -- 0:00:29
537000 -- (-814.762) [-809.589] (-812.457) (-808.896) * [-809.071] (-811.007) (-811.480) (-812.912) -- 0:00:29
537500 -- (-810.179) [-809.475] (-810.497) (-812.504) * (-808.803) [-810.459] (-809.954) (-810.475) -- 0:00:29
538000 -- (-811.565) [-810.958] (-809.733) (-810.945) * (-810.437) (-811.942) [-809.535] (-812.387) -- 0:00:29
538500 -- (-812.626) [-809.389] (-811.139) (-811.139) * (-810.503) (-812.258) [-809.886] (-808.735) -- 0:00:29
539000 -- (-812.461) (-812.567) [-811.901] (-809.688) * [-812.045] (-810.522) (-810.292) (-810.349) -- 0:00:29
539500 -- (-810.542) [-808.629] (-815.584) (-808.953) * (-808.365) (-809.426) (-815.617) [-811.345] -- 0:00:29
540000 -- (-809.851) [-809.296] (-814.926) (-811.552) * (-810.356) (-810.199) (-816.374) [-811.447] -- 0:00:28
Average standard deviation of split frequencies: 0.011141
540500 -- (-810.932) (-809.774) (-814.809) [-811.810] * (-811.136) (-809.657) [-811.538] (-809.011) -- 0:00:28
541000 -- [-809.024] (-809.310) (-813.817) (-813.624) * (-811.364) (-808.674) [-814.813] (-810.937) -- 0:00:28
541500 -- (-810.856) [-811.278] (-814.812) (-811.688) * [-811.447] (-812.870) (-812.126) (-808.872) -- 0:00:28
542000 -- (-812.457) (-812.106) [-809.166] (-810.286) * (-809.961) (-815.800) (-811.989) [-810.098] -- 0:00:28
542500 -- [-811.114] (-810.675) (-813.489) (-811.174) * [-813.951] (-819.618) (-808.818) (-809.806) -- 0:00:28
543000 -- (-810.325) [-808.353] (-809.881) (-809.958) * (-812.051) [-810.169] (-809.787) (-809.315) -- 0:00:28
543500 -- (-813.009) [-808.672] (-810.254) (-809.192) * (-808.798) (-811.889) (-809.077) [-810.278] -- 0:00:28
544000 -- [-808.819] (-811.739) (-812.461) (-809.403) * (-813.965) (-810.654) [-811.260] (-812.923) -- 0:00:28
544500 -- (-809.615) (-809.400) (-809.384) [-808.377] * (-811.777) [-809.118] (-809.379) (-808.645) -- 0:00:28
545000 -- (-808.842) [-811.563] (-815.619) (-809.910) * [-809.561] (-812.066) (-811.543) (-808.920) -- 0:00:28
Average standard deviation of split frequencies: 0.010542
545500 -- [-810.539] (-808.782) (-816.687) (-809.591) * (-817.636) (-811.849) (-813.423) [-812.877] -- 0:00:28
546000 -- (-809.093) [-811.439] (-809.049) (-809.255) * (-813.997) (-811.094) [-809.936] (-809.082) -- 0:00:28
546500 -- (-809.263) (-813.793) [-808.583] (-809.622) * (-810.415) (-811.322) (-811.200) [-809.807] -- 0:00:28
547000 -- (-812.948) (-812.344) (-809.592) [-811.827] * (-809.798) (-812.705) [-810.766] (-810.538) -- 0:00:28
547500 -- (-813.877) [-809.273] (-814.000) (-810.612) * (-810.331) [-810.938] (-811.389) (-808.440) -- 0:00:28
548000 -- (-810.542) (-809.655) (-810.402) [-809.701] * (-810.826) (-814.169) (-809.828) [-810.131] -- 0:00:28
548500 -- (-812.936) [-810.047] (-810.831) (-809.857) * [-810.036] (-813.401) (-809.982) (-813.696) -- 0:00:27
549000 -- [-809.525] (-809.440) (-809.972) (-810.400) * (-810.431) (-812.497) (-810.836) [-814.079] -- 0:00:27
549500 -- (-809.239) (-808.875) [-808.768] (-811.624) * (-812.714) (-810.912) (-809.793) [-810.398] -- 0:00:28
550000 -- [-814.076] (-811.018) (-810.286) (-811.957) * (-809.081) (-810.981) [-810.494] (-809.181) -- 0:00:28
Average standard deviation of split frequencies: 0.010558
550500 -- (-813.770) (-814.507) [-810.110] (-810.257) * (-809.346) [-809.560] (-809.194) (-809.032) -- 0:00:28
551000 -- (-810.903) [-813.433] (-808.554) (-810.182) * (-809.446) (-808.691) (-809.465) [-812.638] -- 0:00:28
551500 -- [-809.016] (-809.613) (-809.499) (-809.135) * [-810.433] (-809.565) (-811.017) (-809.550) -- 0:00:28
552000 -- (-808.464) [-809.933] (-812.252) (-809.818) * (-810.080) (-809.862) (-810.604) [-812.983] -- 0:00:28
552500 -- [-809.899] (-808.629) (-810.699) (-808.560) * (-810.557) (-812.000) [-809.321] (-811.732) -- 0:00:28
553000 -- (-811.179) [-811.078] (-810.352) (-808.732) * (-809.614) (-810.732) (-812.662) [-811.798] -- 0:00:28
553500 -- [-810.170] (-812.882) (-810.384) (-810.853) * [-808.748] (-809.046) (-814.863) (-812.061) -- 0:00:28
554000 -- (-809.997) (-813.376) (-809.011) [-812.288] * [-812.760] (-812.871) (-813.673) (-811.407) -- 0:00:28
554500 -- [-811.184] (-811.629) (-810.212) (-813.559) * [-811.718] (-810.547) (-811.429) (-809.412) -- 0:00:28
555000 -- [-810.070] (-809.545) (-810.677) (-811.799) * [-813.322] (-811.525) (-813.687) (-810.957) -- 0:00:28
Average standard deviation of split frequencies: 0.009703
555500 -- (-811.563) (-810.684) [-809.029] (-811.286) * (-809.930) (-809.158) [-810.781] (-814.596) -- 0:00:28
556000 -- (-812.184) [-813.086] (-811.344) (-810.696) * (-811.817) (-812.856) [-813.239] (-810.655) -- 0:00:27
556500 -- [-811.462] (-809.950) (-811.399) (-810.868) * [-813.635] (-809.583) (-817.645) (-808.972) -- 0:00:27
557000 -- [-811.221] (-811.133) (-810.268) (-809.982) * (-813.696) [-816.091] (-812.468) (-810.373) -- 0:00:27
557500 -- (-808.435) [-809.707] (-812.383) (-810.513) * (-811.879) (-811.241) [-811.359] (-812.843) -- 0:00:27
558000 -- (-810.909) (-808.654) [-812.251] (-811.102) * (-810.946) (-813.990) [-813.214] (-809.158) -- 0:00:27
558500 -- (-815.453) (-811.241) (-813.014) [-810.192] * [-809.250] (-810.741) (-808.672) (-811.449) -- 0:00:27
559000 -- [-811.626] (-813.474) (-810.150) (-809.782) * (-812.191) [-813.522] (-810.303) (-810.415) -- 0:00:27
559500 -- (-812.319) (-811.740) (-809.715) [-808.410] * [-808.323] (-812.436) (-808.947) (-808.883) -- 0:00:27
560000 -- [-813.378] (-811.409) (-810.244) (-809.124) * (-810.049) (-811.247) (-808.609) [-808.711] -- 0:00:27
Average standard deviation of split frequencies: 0.009001
560500 -- (-811.944) [-810.459] (-810.925) (-810.470) * [-809.020] (-812.288) (-809.615) (-808.276) -- 0:00:27
561000 -- [-809.212] (-809.115) (-810.662) (-813.696) * [-811.706] (-811.896) (-811.892) (-819.386) -- 0:00:27
561500 -- [-810.170] (-812.994) (-809.275) (-810.622) * [-810.401] (-810.507) (-810.844) (-812.087) -- 0:00:27
562000 -- (-809.717) [-810.481] (-809.549) (-811.226) * (-809.961) [-810.876] (-811.803) (-810.155) -- 0:00:27
562500 -- (-815.420) [-809.359] (-809.126) (-808.328) * (-811.178) (-810.274) (-810.448) [-809.869] -- 0:00:27
563000 -- (-808.898) (-812.438) (-809.323) [-809.046] * [-810.238] (-810.537) (-809.983) (-809.090) -- 0:00:27
563500 -- (-810.056) (-814.798) [-808.918] (-809.519) * (-809.477) [-812.895] (-810.388) (-808.686) -- 0:00:27
564000 -- (-813.204) (-811.016) (-809.426) [-817.825] * (-810.520) [-811.431] (-809.510) (-811.064) -- 0:00:27
564500 -- (-811.115) (-809.515) [-811.027] (-810.564) * [-810.597] (-809.259) (-810.448) (-812.690) -- 0:00:27
565000 -- (-813.566) (-809.514) (-810.586) [-812.851] * (-809.412) [-811.047] (-809.015) (-810.160) -- 0:00:26
Average standard deviation of split frequencies: 0.009671
565500 -- (-810.942) [-808.964] (-810.594) (-810.547) * (-810.810) [-810.642] (-809.425) (-808.914) -- 0:00:26
566000 -- (-809.144) [-812.819] (-810.994) (-810.362) * [-810.669] (-809.846) (-813.827) (-809.091) -- 0:00:27
566500 -- (-809.127) (-814.685) [-811.912] (-811.985) * [-809.345] (-809.479) (-811.142) (-812.587) -- 0:00:27
567000 -- [-810.254] (-809.682) (-809.774) (-812.259) * (-809.409) [-812.175] (-811.713) (-811.880) -- 0:00:27
567500 -- (-808.583) [-809.500] (-809.823) (-816.081) * (-809.078) (-812.372) [-812.857] (-810.949) -- 0:00:27
568000 -- (-808.744) (-811.709) (-810.172) [-809.534] * [-809.687] (-811.194) (-812.587) (-812.812) -- 0:00:27
568500 -- (-809.538) (-810.381) [-811.516] (-809.814) * (-810.366) [-812.183] (-813.428) (-811.229) -- 0:00:27
569000 -- [-810.111] (-810.611) (-811.704) (-810.260) * (-809.797) (-812.965) (-814.148) [-811.231] -- 0:00:27
569500 -- (-810.294) (-811.170) [-813.247] (-813.027) * (-809.058) (-810.721) [-809.424] (-809.923) -- 0:00:27
570000 -- (-812.333) [-809.642] (-809.872) (-811.020) * (-812.080) (-812.572) (-812.591) [-814.274] -- 0:00:27
Average standard deviation of split frequencies: 0.009637
570500 -- (-810.813) [-809.680] (-809.458) (-812.635) * (-810.626) [-810.638] (-810.662) (-811.781) -- 0:00:27
571000 -- (-811.388) (-811.927) [-809.452] (-814.656) * (-810.174) [-808.526] (-813.808) (-809.859) -- 0:00:27
571500 -- (-808.750) (-811.785) [-808.749] (-809.628) * (-809.938) [-808.738] (-813.936) (-811.321) -- 0:00:26
572000 -- (-810.137) (-809.210) [-808.723] (-809.476) * (-812.163) [-808.831] (-813.939) (-811.482) -- 0:00:26
572500 -- (-811.213) (-811.275) [-809.323] (-811.529) * [-809.125] (-814.226) (-813.109) (-809.284) -- 0:00:26
573000 -- [-811.977] (-811.250) (-809.934) (-810.218) * (-809.032) (-810.698) [-812.033] (-814.862) -- 0:00:26
573500 -- (-812.672) (-812.891) [-810.796] (-812.254) * (-811.574) (-811.715) [-809.309] (-809.118) -- 0:00:26
574000 -- [-809.448] (-811.032) (-810.698) (-814.140) * [-809.623] (-809.793) (-810.736) (-809.038) -- 0:00:26
574500 -- (-808.902) (-810.757) (-810.608) [-809.019] * (-810.606) [-808.883] (-810.060) (-811.184) -- 0:00:26
575000 -- (-808.322) [-811.142] (-811.405) (-809.697) * (-809.497) (-811.510) [-809.376] (-811.537) -- 0:00:26
Average standard deviation of split frequencies: 0.009484
575500 -- [-810.107] (-813.347) (-810.918) (-809.126) * (-812.439) (-813.153) (-809.384) [-812.461] -- 0:00:26
576000 -- (-809.954) (-808.410) [-810.661] (-812.903) * (-811.385) (-810.928) [-813.580] (-813.228) -- 0:00:26
576500 -- (-810.947) (-811.467) [-811.949] (-814.769) * [-811.161] (-810.241) (-811.713) (-812.297) -- 0:00:26
577000 -- (-809.913) (-813.073) [-810.746] (-811.117) * (-810.608) (-809.297) (-809.381) [-808.916] -- 0:00:26
577500 -- (-808.937) (-808.931) [-813.808] (-811.295) * (-809.731) (-810.512) [-809.265] (-809.550) -- 0:00:26
578000 -- [-809.770] (-809.234) (-810.900) (-810.975) * (-811.146) (-808.521) (-811.571) [-812.396] -- 0:00:26
578500 -- (-809.918) (-813.176) (-810.881) [-813.592] * (-811.251) (-811.145) [-809.970] (-811.857) -- 0:00:26
579000 -- [-811.834] (-813.176) (-810.531) (-810.958) * (-811.696) (-810.420) (-809.252) [-810.320] -- 0:00:26
579500 -- [-813.651] (-809.381) (-810.170) (-810.425) * (-810.798) [-809.266] (-813.339) (-810.821) -- 0:00:26
580000 -- (-812.990) (-812.318) (-810.504) [-810.963] * [-810.109] (-808.531) (-809.990) (-810.081) -- 0:00:26
Average standard deviation of split frequencies: 0.009646
580500 -- [-811.329] (-816.099) (-812.429) (-813.469) * [-810.944] (-808.874) (-813.210) (-809.573) -- 0:00:26
581000 -- (-810.155) (-811.512) [-810.849] (-812.400) * [-810.070] (-808.216) (-810.217) (-816.140) -- 0:00:25
581500 -- (-811.804) [-809.457] (-815.105) (-809.820) * (-817.274) (-809.427) [-811.394] (-810.561) -- 0:00:25
582000 -- [-812.505] (-809.595) (-811.893) (-809.409) * (-811.642) [-809.784] (-814.269) (-809.580) -- 0:00:25
582500 -- [-811.194] (-808.965) (-809.881) (-810.164) * [-812.794] (-811.766) (-813.168) (-818.840) -- 0:00:26
583000 -- (-809.293) (-815.423) (-810.037) [-808.577] * [-811.952] (-812.817) (-809.636) (-816.471) -- 0:00:26
583500 -- [-810.687] (-817.141) (-814.572) (-810.300) * (-815.906) [-809.263] (-811.612) (-810.116) -- 0:00:26
584000 -- (-810.563) [-811.417] (-809.172) (-811.092) * (-815.232) [-813.802] (-811.027) (-811.756) -- 0:00:26
584500 -- (-809.628) (-815.236) (-808.310) [-809.809] * (-815.869) (-812.570) (-811.842) [-811.137] -- 0:00:26
585000 -- [-810.769] (-813.504) (-809.162) (-809.484) * (-813.304) (-810.674) [-810.874] (-810.074) -- 0:00:26
Average standard deviation of split frequencies: 0.010789
585500 -- (-809.518) (-808.535) (-810.734) [-809.660] * (-813.344) (-809.948) [-808.490] (-810.203) -- 0:00:26
586000 -- (-815.180) [-810.188] (-811.344) (-818.318) * (-810.904) (-813.215) [-808.615] (-809.911) -- 0:00:26
586500 -- [-810.973] (-809.216) (-809.736) (-813.135) * [-811.220] (-812.273) (-808.305) (-810.122) -- 0:00:26
587000 -- (-810.613) [-808.897] (-810.732) (-809.840) * [-810.016] (-811.029) (-811.134) (-808.734) -- 0:00:26
587500 -- [-811.598] (-812.842) (-812.947) (-810.674) * (-811.585) (-810.852) (-813.581) [-808.918] -- 0:00:25
588000 -- (-809.307) (-808.891) [-812.148] (-811.211) * (-810.496) (-812.803) (-812.501) [-810.434] -- 0:00:25
588500 -- (-810.259) (-811.571) (-810.720) [-809.645] * [-810.104] (-808.642) (-815.660) (-811.331) -- 0:00:25
589000 -- [-810.040] (-809.019) (-809.851) (-809.156) * (-809.359) [-811.261] (-810.061) (-810.552) -- 0:00:25
589500 -- (-808.759) (-814.049) (-808.620) [-809.045] * (-810.573) (-812.161) (-809.447) [-810.373] -- 0:00:25
590000 -- (-810.374) [-811.749] (-809.615) (-810.523) * [-810.569] (-812.906) (-809.610) (-809.274) -- 0:00:25
Average standard deviation of split frequencies: 0.010469
590500 -- (-811.119) [-812.897] (-810.799) (-810.165) * (-810.891) (-812.336) (-809.905) [-809.717] -- 0:00:25
591000 -- (-809.157) (-813.923) (-811.361) [-808.170] * [-809.826] (-813.112) (-808.537) (-812.413) -- 0:00:25
591500 -- (-809.847) (-809.500) [-810.112] (-814.312) * (-809.254) (-811.695) (-810.513) [-808.505] -- 0:00:25
592000 -- (-811.211) [-809.721] (-810.670) (-811.229) * (-809.907) (-812.994) (-810.685) [-808.678] -- 0:00:25
592500 -- (-810.130) [-810.485] (-809.345) (-813.334) * [-810.712] (-812.415) (-808.274) (-810.503) -- 0:00:25
593000 -- (-810.528) [-809.823] (-808.825) (-811.387) * (-810.566) (-812.650) [-810.462] (-812.111) -- 0:00:25
593500 -- [-810.264] (-810.373) (-809.762) (-811.376) * (-810.626) (-809.543) [-810.373] (-812.768) -- 0:00:25
594000 -- (-808.918) [-809.899] (-810.092) (-811.594) * [-811.309] (-810.006) (-810.360) (-810.518) -- 0:00:25
594500 -- (-809.611) [-809.098] (-809.473) (-809.847) * (-813.501) (-808.564) (-809.356) [-810.233] -- 0:00:25
595000 -- [-808.683] (-809.109) (-808.766) (-810.623) * (-810.841) (-808.884) [-813.836] (-811.286) -- 0:00:25
Average standard deviation of split frequencies: 0.009631
595500 -- (-810.356) [-809.072] (-813.539) (-812.688) * (-809.794) [-810.111] (-808.985) (-811.248) -- 0:00:25
596000 -- (-812.399) [-811.647] (-816.717) (-809.629) * [-810.387] (-810.257) (-810.140) (-814.040) -- 0:00:25
596500 -- [-809.269] (-812.190) (-813.500) (-809.971) * (-814.407) (-809.776) [-810.304] (-811.706) -- 0:00:25
597000 -- (-811.668) (-809.178) (-810.715) [-809.424] * (-808.832) (-811.793) [-812.164] (-812.580) -- 0:00:24
597500 -- [-810.906] (-808.792) (-814.464) (-811.573) * (-809.092) [-810.188] (-811.622) (-810.101) -- 0:00:24
598000 -- (-811.991) (-808.839) [-814.008] (-811.356) * [-810.892] (-809.905) (-811.845) (-812.354) -- 0:00:24
598500 -- (-812.594) (-809.549) (-817.429) [-809.814] * [-810.142] (-808.848) (-809.674) (-811.137) -- 0:00:24
599000 -- (-812.203) (-812.600) (-811.339) [-812.156] * (-809.731) (-810.280) [-808.738] (-810.110) -- 0:00:25
599500 -- (-813.002) [-809.242] (-812.222) (-811.975) * [-808.783] (-811.733) (-812.433) (-814.979) -- 0:00:25
600000 -- (-811.584) [-811.708] (-809.885) (-809.334) * (-810.381) [-809.652] (-813.368) (-809.583) -- 0:00:25
Average standard deviation of split frequencies: 0.009972
600500 -- [-810.505] (-812.661) (-811.307) (-808.651) * (-810.292) (-813.057) (-814.494) [-809.509] -- 0:00:25
601000 -- (-810.509) [-810.140] (-810.624) (-809.846) * (-810.530) (-810.796) [-809.613] (-813.307) -- 0:00:25
601500 -- (-810.325) [-809.322] (-810.939) (-812.055) * (-812.590) [-813.360] (-810.378) (-810.459) -- 0:00:25
602000 -- (-813.581) [-808.696] (-808.995) (-811.829) * (-814.333) (-814.262) (-809.977) [-810.599] -- 0:00:25
602500 -- (-820.625) (-813.139) (-811.599) [-810.581] * (-810.044) [-809.797] (-810.207) (-810.042) -- 0:00:25
603000 -- (-812.309) [-809.701] (-809.860) (-811.694) * (-817.423) (-809.301) (-809.252) [-808.829] -- 0:00:25
603500 -- (-812.122) (-810.382) (-811.258) [-811.781] * (-810.338) (-812.230) (-810.249) [-809.728] -- 0:00:24
604000 -- (-810.969) [-809.296] (-809.479) (-810.360) * [-809.178] (-810.336) (-813.322) (-809.417) -- 0:00:24
604500 -- [-810.974] (-809.316) (-809.907) (-809.972) * [-810.029] (-811.163) (-812.464) (-812.729) -- 0:00:24
605000 -- (-809.231) (-810.532) (-810.424) [-812.167] * (-813.927) (-812.322) (-809.213) [-809.252] -- 0:00:24
Average standard deviation of split frequencies: 0.010387
605500 -- [-813.579] (-809.183) (-809.680) (-814.122) * [-811.433] (-811.134) (-811.196) (-812.191) -- 0:00:24
606000 -- (-810.644) [-810.749] (-812.984) (-813.081) * [-810.800] (-809.573) (-811.974) (-809.123) -- 0:00:24
606500 -- [-809.212] (-814.933) (-811.084) (-813.624) * [-810.206] (-811.286) (-812.291) (-811.794) -- 0:00:24
607000 -- (-813.622) (-810.428) [-809.614] (-811.431) * (-809.599) (-809.441) (-813.808) [-811.235] -- 0:00:24
607500 -- [-810.356] (-812.510) (-808.670) (-810.911) * [-809.438] (-810.541) (-812.395) (-810.900) -- 0:00:24
608000 -- (-812.714) [-810.725] (-810.001) (-809.135) * (-813.144) (-812.718) [-811.473] (-810.199) -- 0:00:24
608500 -- (-809.218) [-810.841] (-808.740) (-813.387) * (-810.678) (-808.471) (-812.695) [-814.319] -- 0:00:24
609000 -- (-810.333) (-808.908) [-811.422] (-814.853) * (-812.113) (-811.685) [-808.809] (-808.887) -- 0:00:24
609500 -- (-809.687) [-808.958] (-809.287) (-811.371) * (-813.645) (-811.887) [-809.029] (-809.198) -- 0:00:24
610000 -- (-812.191) (-811.329) [-809.963] (-809.191) * [-812.257] (-811.719) (-808.905) (-809.517) -- 0:00:24
Average standard deviation of split frequencies: 0.009842
610500 -- (-811.302) (-810.880) (-810.489) [-808.320] * (-811.224) (-812.563) (-809.740) [-810.165] -- 0:00:24
611000 -- (-812.774) (-811.381) [-809.973] (-811.159) * (-814.674) (-809.821) [-811.901] (-809.942) -- 0:00:24
611500 -- (-814.339) (-810.018) (-809.722) [-810.896] * [-808.551] (-810.589) (-818.030) (-809.507) -- 0:00:24
612000 -- (-808.458) [-810.571] (-811.007) (-810.146) * [-809.062] (-809.787) (-811.140) (-811.443) -- 0:00:24
612500 -- (-810.601) (-811.941) (-809.636) [-811.000] * (-813.008) [-810.989] (-812.002) (-810.688) -- 0:00:24
613000 -- [-810.576] (-811.492) (-809.568) (-812.704) * (-811.197) [-810.547] (-809.258) (-812.297) -- 0:00:23
613500 -- (-811.180) [-809.563] (-811.085) (-814.269) * [-810.218] (-811.937) (-811.543) (-812.506) -- 0:00:23
614000 -- (-809.407) (-810.051) [-810.566] (-814.083) * (-809.598) (-810.932) (-814.811) [-811.904] -- 0:00:23
614500 -- (-814.302) [-810.472] (-809.565) (-810.371) * [-810.707] (-810.338) (-809.587) (-809.678) -- 0:00:23
615000 -- [-813.326] (-809.432) (-811.852) (-811.338) * (-809.912) (-809.497) (-810.230) [-809.844] -- 0:00:23
Average standard deviation of split frequencies: 0.009614
615500 -- (-810.752) (-809.463) [-810.251] (-809.710) * (-810.763) (-809.882) (-809.627) [-810.905] -- 0:00:24
616000 -- (-810.526) [-809.251] (-812.073) (-809.568) * (-809.924) [-809.359] (-809.437) (-814.585) -- 0:00:24
616500 -- (-811.879) [-809.869] (-810.390) (-812.352) * (-811.276) [-808.756] (-809.719) (-813.776) -- 0:00:24
617000 -- (-808.793) (-810.190) [-812.621] (-815.231) * (-811.303) (-808.586) [-813.421] (-811.402) -- 0:00:24
617500 -- (-809.877) [-808.973] (-812.601) (-816.051) * (-809.748) (-809.923) (-810.713) [-810.822] -- 0:00:24
618000 -- (-809.919) (-810.513) [-811.305] (-811.961) * (-812.965) (-808.743) (-808.656) [-810.642] -- 0:00:24
618500 -- (-810.346) (-810.903) [-811.360] (-811.513) * (-812.656) (-812.501) (-811.030) [-810.741] -- 0:00:24
619000 -- (-811.413) (-811.120) [-810.471] (-811.149) * (-812.355) (-810.533) [-812.656] (-811.590) -- 0:00:24
619500 -- (-809.337) [-809.661] (-808.825) (-811.291) * (-812.907) (-810.138) [-810.135] (-812.759) -- 0:00:23
620000 -- (-808.837) (-810.090) [-809.166] (-812.091) * (-812.872) (-810.012) (-813.046) [-812.151] -- 0:00:23
Average standard deviation of split frequencies: 0.009257
620500 -- (-808.876) (-809.273) (-809.697) [-808.864] * (-811.100) (-809.839) [-812.809] (-810.536) -- 0:00:23
621000 -- [-809.483] (-809.669) (-810.286) (-810.110) * [-810.572] (-809.127) (-810.547) (-809.780) -- 0:00:23
621500 -- [-808.991] (-809.804) (-812.854) (-808.287) * (-809.470) [-809.315] (-809.628) (-810.159) -- 0:00:23
622000 -- (-808.987) (-809.801) [-808.465] (-811.837) * (-809.289) (-809.579) [-811.748] (-809.249) -- 0:00:23
622500 -- [-811.373] (-808.494) (-809.955) (-809.484) * (-810.415) (-809.840) [-813.809] (-809.810) -- 0:00:23
623000 -- (-813.521) (-809.094) [-808.990] (-811.865) * (-809.525) (-810.285) (-811.308) [-808.776] -- 0:00:23
623500 -- (-814.449) (-811.735) (-809.235) [-811.925] * (-816.892) [-811.055] (-810.877) (-809.601) -- 0:00:23
624000 -- (-810.664) (-809.497) (-811.125) [-809.777] * (-810.360) [-812.112] (-812.410) (-811.527) -- 0:00:23
624500 -- [-811.965] (-813.177) (-812.140) (-809.529) * (-812.029) (-808.798) [-809.904] (-811.924) -- 0:00:23
625000 -- (-810.738) (-812.482) (-810.679) [-810.387] * (-815.506) (-810.135) [-811.514] (-812.290) -- 0:00:23
Average standard deviation of split frequencies: 0.009413
625500 -- (-810.582) (-808.893) (-810.481) [-808.325] * [-808.368] (-810.073) (-817.460) (-813.759) -- 0:00:23
626000 -- [-811.547] (-809.753) (-810.784) (-809.543) * (-809.451) (-809.989) (-810.922) [-810.098] -- 0:00:23
626500 -- (-808.903) (-809.828) [-809.396] (-812.532) * (-809.230) [-810.346] (-809.102) (-813.126) -- 0:00:23
627000 -- (-809.799) (-811.364) [-808.816] (-810.568) * (-811.166) (-810.834) [-808.646] (-815.302) -- 0:00:23
627500 -- (-809.552) (-810.561) [-808.813] (-811.110) * [-810.582] (-810.178) (-810.119) (-814.592) -- 0:00:23
628000 -- (-812.422) (-813.422) (-808.347) [-811.005] * (-811.740) (-811.404) (-810.996) [-809.980] -- 0:00:23
628500 -- [-809.355] (-810.356) (-810.071) (-810.993) * (-810.210) (-810.442) (-809.996) [-808.356] -- 0:00:23
629000 -- (-810.831) (-808.855) [-810.252] (-813.378) * (-811.431) (-812.707) (-809.510) [-810.267] -- 0:00:23
629500 -- (-811.559) [-808.410] (-810.325) (-812.248) * (-810.269) [-811.518] (-812.118) (-809.214) -- 0:00:22
630000 -- (-813.368) [-808.949] (-808.686) (-812.211) * (-809.333) [-814.222] (-809.745) (-814.261) -- 0:00:22
Average standard deviation of split frequencies: 0.009343
630500 -- (-810.969) [-808.957] (-811.022) (-811.758) * [-809.984] (-810.888) (-808.696) (-816.738) -- 0:00:22
631000 -- (-809.611) [-811.729] (-813.599) (-810.307) * (-812.085) (-808.816) [-809.180] (-811.755) -- 0:00:22
631500 -- (-810.550) (-809.696) [-808.864] (-808.996) * (-809.399) [-810.046] (-809.896) (-809.795) -- 0:00:22
632000 -- (-814.128) (-808.904) [-809.440] (-809.522) * (-810.601) [-808.594] (-811.656) (-810.761) -- 0:00:23
632500 -- [-812.571] (-811.726) (-808.853) (-810.608) * [-809.024] (-809.075) (-810.994) (-811.206) -- 0:00:23
633000 -- (-811.681) (-809.182) [-809.776] (-809.917) * (-808.545) [-808.445] (-810.402) (-812.309) -- 0:00:23
633500 -- (-812.003) (-810.566) [-810.936] (-811.862) * (-808.566) [-809.436] (-810.485) (-812.541) -- 0:00:23
634000 -- (-809.665) (-811.828) (-808.951) [-809.018] * (-810.088) (-810.191) (-808.560) [-810.634] -- 0:00:23
634500 -- (-808.988) (-818.023) [-808.695] (-811.101) * (-810.823) (-809.541) [-810.226] (-811.815) -- 0:00:23
635000 -- [-808.740] (-814.740) (-808.522) (-809.695) * (-808.841) (-812.541) [-812.001] (-812.212) -- 0:00:22
Average standard deviation of split frequencies: 0.009821
635500 -- (-808.691) (-812.430) (-815.697) [-809.353] * (-810.135) [-811.155] (-810.098) (-814.206) -- 0:00:22
636000 -- (-808.847) (-812.898) [-808.756] (-811.562) * (-812.165) [-809.041] (-810.330) (-810.973) -- 0:00:22
636500 -- (-809.051) [-809.811] (-808.953) (-813.918) * (-810.366) (-812.084) (-812.355) [-813.336] -- 0:00:22
637000 -- (-808.838) (-812.627) (-809.196) [-810.015] * [-809.944] (-808.375) (-811.751) (-812.864) -- 0:00:22
637500 -- [-810.369] (-813.018) (-810.782) (-810.357) * (-809.574) [-811.694] (-811.385) (-810.018) -- 0:00:22
638000 -- (-809.101) (-811.661) (-810.440) [-811.000] * [-809.806] (-809.823) (-811.220) (-808.863) -- 0:00:22
638500 -- (-810.690) (-813.649) (-809.566) [-810.595] * (-808.626) [-808.778] (-808.708) (-812.522) -- 0:00:22
639000 -- (-810.810) (-814.291) (-812.056) [-812.316] * (-808.510) [-809.904] (-811.516) (-811.487) -- 0:00:22
639500 -- (-810.482) [-809.401] (-810.068) (-810.897) * [-809.483] (-812.213) (-808.532) (-813.967) -- 0:00:22
640000 -- (-810.281) [-808.655] (-812.152) (-813.054) * (-809.541) [-809.161] (-810.862) (-809.297) -- 0:00:22
Average standard deviation of split frequencies: 0.009933
640500 -- (-810.098) [-809.537] (-809.359) (-810.508) * (-810.939) (-809.206) (-809.852) [-810.997] -- 0:00:22
641000 -- [-809.353] (-810.087) (-809.500) (-810.113) * (-810.823) (-809.425) (-813.556) [-813.870] -- 0:00:22
641500 -- (-812.461) (-810.389) (-815.281) [-812.602] * (-812.345) (-810.162) [-810.990] (-811.117) -- 0:00:22
642000 -- (-810.003) [-809.056] (-812.829) (-810.164) * (-814.693) (-809.863) [-810.282] (-811.256) -- 0:00:22
642500 -- [-812.455] (-809.141) (-808.735) (-810.695) * (-812.709) (-809.779) [-809.108] (-813.281) -- 0:00:22
643000 -- (-809.654) [-810.216] (-813.950) (-808.907) * (-810.898) [-810.744] (-810.274) (-813.600) -- 0:00:22
643500 -- (-810.987) (-808.722) [-808.850] (-809.250) * (-811.549) [-810.594] (-811.843) (-810.160) -- 0:00:22
644000 -- [-812.869] (-808.678) (-812.375) (-810.087) * (-809.283) [-811.022] (-809.658) (-810.154) -- 0:00:22
644500 -- (-811.415) [-808.994] (-812.177) (-814.120) * [-810.353] (-810.934) (-814.840) (-814.567) -- 0:00:22
645000 -- (-813.735) (-810.086) (-809.000) [-813.165] * [-811.388] (-810.041) (-817.400) (-812.161) -- 0:00:22
Average standard deviation of split frequencies: 0.010216
645500 -- (-813.536) (-811.372) (-808.454) [-810.661] * (-811.195) [-811.608] (-813.699) (-813.325) -- 0:00:21
646000 -- (-812.829) (-809.861) (-808.565) [-809.923] * (-809.473) [-811.037] (-811.486) (-810.600) -- 0:00:21
646500 -- (-810.725) (-809.625) [-809.303] (-810.539) * (-808.629) (-810.183) [-809.595] (-809.207) -- 0:00:21
647000 -- (-809.398) [-810.417] (-810.692) (-810.851) * (-809.331) (-809.858) (-813.588) [-808.908] -- 0:00:21
647500 -- (-810.201) (-809.243) (-809.441) [-812.501] * [-813.722] (-811.808) (-814.173) (-809.574) -- 0:00:21
648000 -- (-811.099) (-810.540) [-811.613] (-811.226) * (-812.193) (-811.570) (-813.615) [-809.207] -- 0:00:21
648500 -- (-810.419) (-809.659) [-813.289] (-810.531) * (-810.242) (-814.998) (-813.910) [-809.488] -- 0:00:22
649000 -- (-813.849) (-809.902) [-809.441] (-809.159) * [-813.424] (-812.876) (-812.612) (-809.961) -- 0:00:22
649500 -- [-808.864] (-809.048) (-809.347) (-810.840) * [-808.794] (-812.358) (-812.437) (-809.408) -- 0:00:22
650000 -- (-808.662) (-809.238) [-809.154] (-809.254) * (-811.382) (-808.574) (-808.688) [-808.577] -- 0:00:22
Average standard deviation of split frequencies: 0.010188
650500 -- (-810.900) [-808.324] (-811.685) (-812.517) * (-810.699) (-809.801) [-810.138] (-810.108) -- 0:00:22
651000 -- (-810.853) [-811.690] (-811.507) (-814.095) * [-808.464] (-810.560) (-809.702) (-808.655) -- 0:00:21
651500 -- (-810.644) [-809.630] (-813.445) (-810.781) * [-809.023] (-811.175) (-809.757) (-810.483) -- 0:00:21
652000 -- (-811.791) (-810.978) (-810.112) [-809.055] * [-809.430] (-812.175) (-810.103) (-811.613) -- 0:00:21
652500 -- (-810.215) [-812.241] (-809.573) (-811.189) * [-809.945] (-810.642) (-810.219) (-809.631) -- 0:00:21
653000 -- [-809.406] (-808.897) (-811.009) (-816.164) * (-809.304) (-809.479) (-809.114) [-810.708] -- 0:00:21
653500 -- (-811.363) (-809.042) [-811.247] (-810.984) * [-809.192] (-809.566) (-808.950) (-810.737) -- 0:00:21
654000 -- (-811.863) (-810.697) [-810.521] (-811.290) * [-810.749] (-810.647) (-811.400) (-813.064) -- 0:00:21
654500 -- (-815.401) [-808.506] (-810.720) (-808.858) * [-812.226] (-810.077) (-808.824) (-813.821) -- 0:00:21
655000 -- [-812.556] (-808.739) (-809.965) (-808.822) * [-809.969] (-809.215) (-811.822) (-814.145) -- 0:00:21
Average standard deviation of split frequencies: 0.009965
655500 -- (-812.134) (-809.531) (-810.038) [-808.568] * (-816.638) [-812.047] (-814.126) (-813.228) -- 0:00:21
656000 -- (-809.236) [-816.388] (-812.956) (-808.324) * [-808.981] (-812.334) (-817.119) (-811.502) -- 0:00:21
656500 -- (-814.979) (-811.409) (-815.591) [-808.514] * (-810.455) [-809.188] (-810.861) (-813.125) -- 0:00:21
657000 -- [-813.741] (-811.064) (-818.008) (-809.223) * (-811.885) [-809.151] (-810.757) (-814.702) -- 0:00:21
657500 -- [-812.421] (-811.392) (-812.164) (-810.626) * (-811.650) (-813.062) [-810.120] (-808.663) -- 0:00:21
658000 -- [-810.856] (-810.015) (-810.463) (-815.998) * (-812.893) (-811.480) (-808.350) [-809.954] -- 0:00:21
658500 -- (-812.539) (-810.278) (-809.674) [-812.736] * [-808.606] (-809.786) (-809.469) (-811.031) -- 0:00:21
659000 -- (-812.859) [-810.775] (-809.673) (-810.408) * [-813.268] (-809.584) (-810.722) (-809.968) -- 0:00:21
659500 -- (-810.134) (-812.131) (-810.360) [-810.288] * [-812.013] (-808.380) (-808.707) (-810.593) -- 0:00:21
660000 -- (-809.909) (-811.587) (-808.792) [-812.415] * [-809.434] (-808.365) (-811.004) (-814.281) -- 0:00:21
Average standard deviation of split frequencies: 0.009419
660500 -- (-810.536) (-809.869) [-808.411] (-813.599) * (-810.041) (-811.405) [-809.701] (-813.365) -- 0:00:21
661000 -- (-811.119) [-810.955] (-810.156) (-808.574) * (-809.332) (-811.813) [-809.600] (-809.767) -- 0:00:21
661500 -- (-809.692) (-812.426) [-810.153] (-808.404) * [-809.190] (-809.874) (-811.227) (-808.799) -- 0:00:20
662000 -- (-811.587) [-810.089] (-809.845) (-811.906) * (-811.268) (-809.650) [-811.138] (-809.825) -- 0:00:20
662500 -- (-810.281) [-810.377] (-810.451) (-809.339) * [-811.593] (-811.326) (-810.259) (-810.933) -- 0:00:20
663000 -- (-810.310) (-811.217) (-812.135) [-809.617] * (-809.159) (-810.418) (-811.715) [-809.883] -- 0:00:20
663500 -- [-810.701] (-811.138) (-809.552) (-809.469) * (-810.710) (-809.631) (-811.562) [-809.493] -- 0:00:20
664000 -- (-812.548) (-812.007) [-809.697] (-810.180) * (-811.483) [-809.326] (-809.437) (-810.912) -- 0:00:20
664500 -- (-813.658) [-809.056] (-811.369) (-809.408) * (-809.182) [-809.064] (-811.895) (-810.908) -- 0:00:20
665000 -- (-813.362) [-809.211] (-810.624) (-809.014) * (-811.593) [-809.339] (-808.890) (-809.912) -- 0:00:21
Average standard deviation of split frequencies: 0.009249
665500 -- (-810.756) (-809.508) [-813.506] (-809.305) * (-812.334) (-811.122) [-809.678] (-811.146) -- 0:00:21
666000 -- (-810.108) [-808.980] (-812.603) (-811.343) * (-812.569) (-814.031) (-809.909) [-809.417] -- 0:00:21
666500 -- [-811.157] (-809.206) (-810.957) (-812.532) * (-811.677) [-809.264] (-810.253) (-813.013) -- 0:00:21
667000 -- (-813.083) (-812.271) (-811.840) [-810.834] * [-814.882] (-811.226) (-812.608) (-809.358) -- 0:00:20
667500 -- (-812.724) (-810.743) (-810.517) [-809.053] * (-813.474) (-809.419) (-813.396) [-810.495] -- 0:00:20
668000 -- (-810.737) [-808.877] (-810.419) (-819.019) * (-809.403) (-808.654) (-812.145) [-811.690] -- 0:00:20
668500 -- (-809.702) (-809.657) [-809.135] (-813.038) * (-809.405) [-810.781] (-812.970) (-810.810) -- 0:00:20
669000 -- (-809.279) (-810.026) [-808.967] (-810.685) * (-809.749) (-809.865) (-812.594) [-811.280] -- 0:00:20
669500 -- (-812.280) (-810.741) (-809.926) [-809.555] * (-814.494) [-810.284] (-809.582) (-811.246) -- 0:00:20
670000 -- [-810.840] (-808.593) (-810.171) (-811.936) * (-810.983) [-809.712] (-809.644) (-812.275) -- 0:00:20
Average standard deviation of split frequencies: 0.008856
670500 -- (-809.080) (-809.207) [-811.179] (-809.517) * (-810.895) [-809.104] (-811.362) (-809.080) -- 0:00:20
671000 -- (-812.244) (-809.634) [-810.042] (-810.356) * (-809.282) (-810.820) (-813.847) [-809.054] -- 0:00:20
671500 -- [-811.931] (-809.409) (-813.344) (-811.615) * (-813.586) (-810.884) (-810.557) [-809.177] -- 0:00:20
672000 -- [-808.817] (-809.409) (-814.666) (-810.046) * [-810.177] (-809.439) (-810.071) (-809.866) -- 0:00:20
672500 -- (-813.049) (-809.192) (-811.414) [-809.899] * (-813.128) (-810.178) [-809.548] (-808.276) -- 0:00:20
673000 -- (-812.194) [-809.368] (-812.940) (-808.754) * (-813.991) [-810.782] (-808.646) (-809.524) -- 0:00:20
673500 -- [-809.720] (-810.681) (-812.674) (-808.645) * (-811.739) (-810.094) [-810.170] (-810.851) -- 0:00:20
674000 -- [-809.493] (-814.086) (-815.926) (-810.871) * (-810.773) (-810.006) (-813.488) [-809.021] -- 0:00:20
674500 -- (-809.175) (-819.049) (-812.781) [-813.157] * (-809.951) (-809.805) [-811.662] (-812.034) -- 0:00:20
675000 -- (-811.463) (-810.619) [-811.262] (-810.407) * (-812.412) (-809.805) (-812.735) [-810.980] -- 0:00:20
Average standard deviation of split frequencies: 0.009065
675500 -- (-809.368) (-809.172) (-812.200) [-810.994] * (-810.543) (-813.013) [-808.841] (-809.314) -- 0:00:20
676000 -- [-810.526] (-811.245) (-810.760) (-810.817) * [-811.626] (-811.262) (-808.895) (-810.123) -- 0:00:20
676500 -- [-809.240] (-811.055) (-809.362) (-812.287) * (-810.017) (-810.838) [-811.184] (-810.144) -- 0:00:20
677000 -- [-808.878] (-809.330) (-810.671) (-814.119) * (-810.224) (-810.159) (-810.171) [-809.749] -- 0:00:20
677500 -- (-808.596) (-810.094) (-811.967) [-810.484] * [-809.421] (-810.962) (-808.943) (-811.563) -- 0:00:19
678000 -- (-810.161) (-811.916) (-809.165) [-810.941] * (-811.275) (-810.617) (-810.701) [-808.534] -- 0:00:19
678500 -- (-811.389) (-809.975) [-810.177] (-812.236) * [-809.884] (-812.154) (-809.338) (-809.678) -- 0:00:19
679000 -- (-810.266) [-808.996] (-809.026) (-814.347) * (-809.203) (-810.709) (-810.291) [-811.226] -- 0:00:19
679500 -- [-808.967] (-810.335) (-810.560) (-809.755) * (-809.092) (-814.337) (-810.800) [-809.761] -- 0:00:19
680000 -- [-809.636] (-811.048) (-809.558) (-811.426) * (-810.303) (-813.653) [-811.863] (-809.132) -- 0:00:19
Average standard deviation of split frequencies: 0.008726
680500 -- (-809.549) (-811.080) (-809.282) [-815.352] * (-809.246) (-809.666) [-811.119] (-809.214) -- 0:00:19
681000 -- (-809.366) (-811.757) (-811.194) [-808.868] * (-809.463) (-809.170) (-809.551) [-810.477] -- 0:00:19
681500 -- (-811.073) (-810.280) (-809.636) [-809.641] * (-810.571) [-809.087] (-809.870) (-816.702) -- 0:00:20
682000 -- [-813.560] (-809.931) (-810.882) (-812.846) * (-813.249) (-811.614) [-812.733] (-810.932) -- 0:00:20
682500 -- (-815.504) (-810.275) (-809.281) [-811.015] * (-814.296) (-808.370) [-812.055] (-812.083) -- 0:00:20
683000 -- (-809.444) [-809.411] (-809.710) (-810.366) * (-814.438) (-808.426) (-808.861) [-809.319] -- 0:00:19
683500 -- (-810.655) (-811.941) (-811.611) [-810.092] * [-811.402] (-808.351) (-810.520) (-811.757) -- 0:00:19
684000 -- (-810.286) [-812.753] (-812.223) (-813.292) * (-811.978) [-811.764] (-809.332) (-809.710) -- 0:00:19
684500 -- (-809.792) [-808.394] (-812.550) (-812.340) * (-809.281) (-809.101) [-809.274] (-811.549) -- 0:00:19
685000 -- [-809.622] (-812.669) (-811.869) (-809.537) * [-809.394] (-809.859) (-809.220) (-816.208) -- 0:00:19
Average standard deviation of split frequencies: 0.008658
685500 -- (-811.907) (-809.673) (-813.296) [-809.479] * [-810.127] (-810.860) (-809.964) (-809.127) -- 0:00:19
686000 -- (-808.318) [-809.875] (-813.209) (-809.640) * [-813.147] (-811.882) (-810.781) (-814.532) -- 0:00:19
686500 -- (-808.480) (-811.023) [-811.521] (-817.007) * (-813.576) (-810.159) (-810.424) [-810.934] -- 0:00:19
687000 -- [-811.139] (-809.192) (-809.409) (-809.806) * (-811.509) (-813.499) (-810.657) [-810.187] -- 0:00:19
687500 -- (-811.649) (-813.212) [-811.322] (-808.694) * [-809.074] (-810.308) (-810.878) (-809.839) -- 0:00:19
688000 -- (-813.050) (-809.564) (-810.102) [-809.749] * (-808.294) (-811.417) (-810.389) [-810.776] -- 0:00:19
688500 -- (-811.003) (-812.373) [-811.949] (-811.366) * [-809.782] (-810.130) (-808.703) (-809.596) -- 0:00:19
689000 -- (-810.801) (-810.582) (-812.467) [-809.392] * (-809.032) (-810.903) [-810.056] (-809.827) -- 0:00:19
689500 -- (-809.302) (-813.716) (-813.514) [-809.644] * (-813.083) [-813.178] (-810.094) (-809.578) -- 0:00:19
690000 -- [-812.093] (-814.563) (-810.859) (-810.880) * [-809.463] (-809.568) (-809.148) (-813.728) -- 0:00:19
Average standard deviation of split frequencies: 0.008489
690500 -- [-812.552] (-810.258) (-810.659) (-810.954) * (-814.809) (-811.381) [-809.326] (-809.171) -- 0:00:19
691000 -- (-813.480) (-810.940) (-812.759) [-809.852] * (-810.323) [-810.634] (-810.214) (-809.428) -- 0:00:19
691500 -- (-811.830) [-812.068] (-809.784) (-808.686) * [-810.486] (-810.653) (-810.050) (-809.775) -- 0:00:19
692000 -- (-810.260) [-808.598] (-812.401) (-809.430) * (-809.487) (-810.740) [-817.425] (-808.903) -- 0:00:19
692500 -- [-809.790] (-809.660) (-810.226) (-813.517) * (-812.624) (-811.290) (-813.765) [-808.565] -- 0:00:19
693000 -- (-809.387) [-811.328] (-808.447) (-811.709) * (-815.914) (-813.051) [-808.681] (-809.107) -- 0:00:19
693500 -- (-811.363) [-811.568] (-811.331) (-817.812) * (-809.553) (-814.213) [-809.781] (-808.720) -- 0:00:19
694000 -- (-811.591) (-812.714) [-811.437] (-815.624) * (-809.937) (-814.793) [-811.323] (-808.859) -- 0:00:18
694500 -- (-810.773) (-814.098) (-812.036) [-808.920] * [-811.669] (-815.915) (-809.112) (-809.305) -- 0:00:18
695000 -- (-812.666) (-811.367) [-810.217] (-808.718) * (-814.920) (-809.607) [-809.092] (-809.418) -- 0:00:18
Average standard deviation of split frequencies: 0.008940
695500 -- (-808.937) (-810.409) [-810.389] (-809.197) * [-810.444] (-811.931) (-809.324) (-809.756) -- 0:00:18
696000 -- [-811.866] (-810.094) (-808.692) (-811.086) * (-809.367) (-812.946) [-810.467] (-811.872) -- 0:00:18
696500 -- [-808.897] (-808.786) (-811.463) (-811.927) * (-810.867) (-810.163) [-810.151] (-811.364) -- 0:00:18
697000 -- [-811.567] (-809.562) (-813.400) (-811.055) * (-810.302) [-809.302] (-810.319) (-813.379) -- 0:00:18
697500 -- [-811.092] (-813.120) (-814.671) (-809.933) * (-811.098) [-808.968] (-810.193) (-812.016) -- 0:00:18
698000 -- (-811.020) (-808.392) (-812.600) [-809.195] * (-809.617) (-809.178) [-813.430] (-810.244) -- 0:00:18
698500 -- (-810.909) (-811.478) (-814.774) [-810.296] * [-810.229] (-810.791) (-811.949) (-809.861) -- 0:00:18
699000 -- (-809.760) (-812.578) [-809.055] (-810.111) * [-810.928] (-811.406) (-811.694) (-810.279) -- 0:00:18
699500 -- (-818.328) [-810.491] (-810.575) (-812.175) * (-810.123) [-815.886] (-813.116) (-812.082) -- 0:00:18
700000 -- (-823.355) [-811.563] (-811.115) (-811.875) * (-809.970) (-813.426) [-808.917] (-809.367) -- 0:00:18
Average standard deviation of split frequencies: 0.009195
700500 -- (-809.676) (-809.613) (-810.616) [-809.409] * (-810.614) [-809.668] (-808.994) (-809.309) -- 0:00:18
701000 -- (-809.251) [-809.730] (-814.043) (-809.247) * (-814.300) (-813.799) [-810.250] (-809.889) -- 0:00:18
701500 -- (-811.296) (-810.812) [-810.602] (-809.936) * (-809.508) (-812.022) (-810.767) [-813.601] -- 0:00:18
702000 -- [-809.355] (-810.267) (-811.546) (-814.523) * (-810.257) (-811.928) (-815.305) [-811.876] -- 0:00:18
702500 -- (-812.017) (-809.271) [-809.916] (-809.145) * (-809.047) (-810.614) (-813.587) [-811.935] -- 0:00:18
703000 -- (-811.970) (-814.006) [-812.442] (-811.619) * (-809.436) (-815.036) (-812.608) [-811.862] -- 0:00:18
703500 -- (-809.586) (-810.569) (-808.679) [-811.877] * (-810.422) (-810.999) [-812.692] (-811.489) -- 0:00:18
704000 -- (-810.702) (-810.733) [-809.232] (-813.231) * (-809.422) (-809.281) (-813.776) [-812.236] -- 0:00:18
704500 -- [-810.701] (-809.687) (-808.988) (-813.964) * [-813.606] (-813.562) (-808.660) (-810.706) -- 0:00:18
705000 -- [-809.933] (-813.633) (-810.009) (-809.568) * [-809.395] (-810.244) (-810.888) (-808.726) -- 0:00:18
Average standard deviation of split frequencies: 0.008597
705500 -- [-811.884] (-810.672) (-810.961) (-810.188) * (-812.329) (-810.003) [-811.402] (-808.596) -- 0:00:18
706000 -- (-810.352) (-808.985) (-811.802) [-809.575] * (-812.063) (-809.941) (-810.121) [-810.053] -- 0:00:18
706500 -- [-809.500] (-810.024) (-810.432) (-809.575) * (-811.829) (-810.082) (-810.846) [-814.303] -- 0:00:18
707000 -- [-811.836] (-809.299) (-812.170) (-809.394) * (-812.342) [-810.720] (-815.728) (-808.953) -- 0:00:18
707500 -- (-809.857) (-808.854) (-810.708) [-809.744] * (-810.408) (-808.544) [-814.516] (-809.892) -- 0:00:18
708000 -- (-812.298) [-809.884] (-808.803) (-809.102) * (-812.048) (-811.113) [-812.695] (-811.050) -- 0:00:18
708500 -- (-810.870) (-809.394) [-809.058] (-810.882) * (-811.017) (-810.946) (-811.851) [-814.456] -- 0:00:18
709000 -- (-811.983) (-810.026) [-809.811] (-812.557) * (-810.321) (-810.199) [-809.234] (-812.842) -- 0:00:18
709500 -- (-810.131) (-811.846) [-814.237] (-813.802) * (-813.669) [-810.953] (-811.285) (-810.091) -- 0:00:18
710000 -- (-809.099) (-810.377) [-808.817] (-811.373) * (-811.059) (-812.264) [-812.798] (-810.864) -- 0:00:17
Average standard deviation of split frequencies: 0.008582
710500 -- (-809.170) [-809.141] (-813.947) (-813.175) * (-812.799) [-809.567] (-809.323) (-809.983) -- 0:00:17
711000 -- (-811.484) [-810.201] (-811.702) (-816.272) * (-809.831) (-809.301) (-808.670) [-812.415] -- 0:00:17
711500 -- [-809.171] (-813.049) (-812.132) (-811.492) * (-808.732) (-811.613) [-808.642] (-812.512) -- 0:00:17
712000 -- (-809.309) [-811.853] (-810.715) (-813.686) * (-809.513) (-811.649) [-808.653] (-811.064) -- 0:00:17
712500 -- (-809.366) (-810.788) (-809.710) [-810.890] * (-809.460) [-811.110] (-810.304) (-811.025) -- 0:00:17
713000 -- [-811.143] (-815.477) (-808.999) (-809.091) * [-808.584] (-817.102) (-810.719) (-809.314) -- 0:00:17
713500 -- (-809.785) (-813.686) [-810.323] (-808.897) * (-810.855) [-810.142] (-809.636) (-810.355) -- 0:00:17
714000 -- (-810.092) (-814.346) [-811.664] (-809.649) * (-810.337) (-812.526) [-809.899] (-810.931) -- 0:00:17
714500 -- (-809.165) (-813.022) (-812.039) [-810.857] * (-809.646) (-810.313) (-810.160) [-810.347] -- 0:00:17
715000 -- (-809.941) [-815.903] (-811.489) (-810.358) * (-811.220) (-812.338) (-811.670) [-811.007] -- 0:00:17
Average standard deviation of split frequencies: 0.008353
715500 -- [-809.604] (-816.893) (-809.317) (-808.649) * (-811.459) (-808.915) [-811.035] (-812.181) -- 0:00:17
716000 -- (-809.138) [-812.528] (-809.898) (-809.063) * (-809.908) (-809.039) [-809.989] (-810.124) -- 0:00:17
716500 -- (-808.976) (-812.987) [-811.528] (-808.868) * (-810.555) (-810.682) (-813.322) [-808.654] -- 0:00:17
717000 -- (-809.968) (-810.094) [-813.580] (-811.736) * (-809.643) (-813.033) [-814.830] (-810.397) -- 0:00:17
717500 -- (-812.124) (-814.216) [-810.890] (-809.889) * (-809.796) (-811.184) (-811.530) [-809.216] -- 0:00:17
718000 -- (-812.994) [-809.745] (-812.342) (-809.571) * (-811.017) [-810.285] (-813.016) (-813.084) -- 0:00:17
718500 -- (-809.911) [-809.424] (-811.930) (-810.350) * (-809.137) [-808.944] (-810.728) (-811.221) -- 0:00:17
719000 -- (-811.588) [-812.026] (-810.329) (-809.747) * (-810.916) (-810.081) (-810.736) [-812.949] -- 0:00:17
719500 -- (-811.478) (-812.024) (-812.325) [-808.874] * (-811.291) [-809.019] (-813.564) (-808.943) -- 0:00:17
720000 -- (-812.075) [-812.620] (-810.461) (-814.999) * [-811.087] (-812.888) (-808.947) (-808.561) -- 0:00:17
Average standard deviation of split frequencies: 0.007522
720500 -- (-814.717) (-812.254) [-810.086] (-810.691) * (-812.768) (-809.879) [-808.532] (-811.178) -- 0:00:17
721000 -- [-815.520] (-812.663) (-811.845) (-811.271) * [-811.903] (-810.573) (-809.170) (-813.021) -- 0:00:17
721500 -- (-812.903) (-810.006) [-810.659] (-810.612) * [-811.426] (-809.072) (-811.448) (-810.529) -- 0:00:17
722000 -- (-813.983) [-811.021] (-810.803) (-811.952) * [-810.205] (-809.106) (-811.087) (-809.597) -- 0:00:17
722500 -- (-814.553) [-810.782] (-809.702) (-810.439) * [-810.560] (-809.196) (-809.631) (-812.535) -- 0:00:17
723000 -- (-813.223) (-811.869) (-813.248) [-810.325] * [-811.353] (-808.668) (-811.697) (-813.491) -- 0:00:17
723500 -- (-811.232) (-810.027) (-810.318) [-810.618] * (-812.482) [-808.671] (-811.439) (-811.247) -- 0:00:17
724000 -- (-808.681) (-811.022) (-817.108) [-811.793] * (-810.075) (-812.679) [-811.998] (-809.546) -- 0:00:17
724500 -- (-809.234) (-813.245) [-810.346] (-810.934) * [-809.721] (-810.195) (-808.612) (-810.748) -- 0:00:17
725000 -- (-809.997) [-808.832] (-811.337) (-809.363) * (-815.913) (-812.355) [-809.768] (-811.102) -- 0:00:17
Average standard deviation of split frequencies: 0.007711
725500 -- (-808.519) (-808.787) [-809.620] (-811.811) * (-812.926) [-810.023] (-812.373) (-812.196) -- 0:00:17
726000 -- (-810.527) [-810.689] (-809.763) (-809.501) * (-812.177) (-808.510) (-813.072) [-809.544] -- 0:00:16
726500 -- [-810.737] (-813.474) (-811.090) (-810.056) * (-815.470) [-808.973] (-810.681) (-810.351) -- 0:00:16
727000 -- (-809.022) [-811.104] (-811.103) (-809.635) * [-809.519] (-809.370) (-810.094) (-810.217) -- 0:00:16
727500 -- (-810.967) (-815.369) [-810.118] (-814.630) * (-810.567) (-808.844) [-810.012] (-810.317) -- 0:00:16
728000 -- (-811.183) (-813.176) [-809.627] (-814.342) * [-810.711] (-811.315) (-812.421) (-814.389) -- 0:00:16
728500 -- (-810.564) (-809.937) (-808.873) [-808.632] * (-810.274) (-810.366) [-812.922] (-814.244) -- 0:00:16
729000 -- (-814.691) [-808.750] (-814.235) (-811.663) * (-808.659) [-808.940] (-811.928) (-811.452) -- 0:00:16
729500 -- [-809.749] (-811.916) (-809.870) (-809.392) * (-809.901) (-808.544) (-813.478) [-811.358] -- 0:00:16
730000 -- (-812.734) (-812.518) (-810.216) [-809.199] * [-809.961] (-810.088) (-811.637) (-810.826) -- 0:00:16
Average standard deviation of split frequencies: 0.006815
730500 -- (-810.921) [-812.468] (-810.775) (-812.916) * (-810.178) [-808.897] (-812.546) (-809.618) -- 0:00:16
731000 -- [-811.668] (-808.546) (-810.523) (-808.880) * (-810.297) [-808.953] (-809.198) (-809.405) -- 0:00:16
731500 -- [-808.871] (-808.551) (-811.778) (-810.721) * (-811.605) (-810.864) [-810.594] (-809.269) -- 0:00:16
732000 -- (-813.362) [-808.441] (-809.847) (-809.974) * (-810.037) (-812.736) [-809.000] (-811.784) -- 0:00:16
732500 -- (-811.741) [-809.303] (-809.959) (-811.656) * (-811.075) (-811.474) [-809.951] (-809.473) -- 0:00:16
733000 -- [-809.769] (-809.860) (-808.967) (-810.179) * (-812.141) [-811.335] (-811.008) (-809.364) -- 0:00:16
733500 -- (-811.344) (-810.710) [-812.719] (-809.478) * (-810.116) (-811.565) [-810.261] (-809.563) -- 0:00:16
734000 -- (-812.661) (-811.785) [-813.684] (-808.824) * [-808.606] (-811.052) (-810.541) (-809.583) -- 0:00:16
734500 -- [-811.931] (-813.511) (-808.669) (-809.472) * (-809.565) (-811.505) [-810.687] (-809.571) -- 0:00:16
735000 -- (-815.816) (-811.068) [-811.317] (-810.394) * (-812.285) [-809.820] (-812.063) (-810.424) -- 0:00:16
Average standard deviation of split frequencies: 0.007005
735500 -- [-809.594] (-808.807) (-812.006) (-812.152) * [-809.339] (-811.157) (-814.420) (-812.399) -- 0:00:16
736000 -- (-820.070) [-809.016] (-810.246) (-813.009) * (-809.986) (-810.008) (-816.752) [-808.689] -- 0:00:16
736500 -- (-811.154) [-810.773] (-816.206) (-813.045) * [-810.677] (-809.701) (-810.560) (-809.938) -- 0:00:16
737000 -- [-810.021] (-811.762) (-809.391) (-811.440) * [-811.450] (-809.232) (-810.226) (-811.062) -- 0:00:16
737500 -- (-809.484) [-810.114] (-816.961) (-812.055) * (-809.109) [-811.895] (-811.174) (-808.752) -- 0:00:16
738000 -- [-809.762] (-813.141) (-816.060) (-811.641) * (-809.352) (-815.252) (-812.545) [-809.685] -- 0:00:16
738500 -- (-811.224) (-813.034) (-811.716) [-808.969] * (-810.573) (-811.951) (-815.343) [-809.977] -- 0:00:16
739000 -- [-810.500] (-814.709) (-814.451) (-808.663) * (-813.160) (-810.281) (-808.654) [-808.487] -- 0:00:16
739500 -- (-808.985) [-812.446] (-810.786) (-809.707) * (-812.862) [-812.401] (-809.697) (-808.631) -- 0:00:16
740000 -- (-809.348) (-813.666) [-811.856] (-809.351) * (-813.310) [-812.511] (-809.451) (-808.577) -- 0:00:16
Average standard deviation of split frequencies: 0.007128
740500 -- (-808.931) [-815.739] (-811.587) (-810.598) * (-810.941) [-811.312] (-808.750) (-811.525) -- 0:00:16
741000 -- (-809.144) [-810.759] (-809.451) (-809.384) * (-809.594) (-812.609) [-808.713] (-811.056) -- 0:00:16
741500 -- [-813.781] (-815.653) (-811.242) (-809.036) * [-809.377] (-812.103) (-809.270) (-812.634) -- 0:00:16
742000 -- (-809.022) (-809.013) (-810.555) [-808.450] * (-810.320) [-812.494] (-808.946) (-810.236) -- 0:00:15
742500 -- (-809.309) [-810.669] (-810.204) (-808.694) * (-810.124) [-809.567] (-809.305) (-811.088) -- 0:00:15
743000 -- [-810.979] (-808.824) (-808.984) (-811.027) * (-812.055) (-810.285) (-808.416) [-810.793] -- 0:00:15
743500 -- [-811.777] (-808.872) (-810.573) (-811.104) * [-809.737] (-809.697) (-808.614) (-810.713) -- 0:00:15
744000 -- (-810.550) (-812.167) (-810.076) [-812.068] * (-810.110) [-812.625] (-811.418) (-809.011) -- 0:00:15
744500 -- [-810.491] (-808.587) (-809.894) (-812.267) * (-810.615) (-812.153) (-812.072) [-811.655] -- 0:00:15
745000 -- [-810.309] (-810.052) (-809.939) (-812.445) * [-809.324] (-810.945) (-814.453) (-809.300) -- 0:00:15
Average standard deviation of split frequencies: 0.007878
745500 -- [-808.349] (-809.735) (-810.303) (-812.785) * (-811.935) [-811.426] (-811.080) (-809.011) -- 0:00:15
746000 -- (-815.805) (-810.117) [-810.928] (-811.883) * (-808.767) [-809.506] (-810.941) (-812.254) -- 0:00:15
746500 -- (-811.506) (-811.260) (-810.702) [-810.634] * (-813.101) [-808.688] (-810.244) (-811.313) -- 0:00:15
747000 -- [-813.662] (-813.433) (-810.677) (-812.544) * (-812.435) (-808.709) [-809.159] (-812.845) -- 0:00:15
747500 -- [-809.683] (-810.518) (-809.799) (-813.140) * (-811.771) [-808.960] (-809.426) (-810.131) -- 0:00:15
748000 -- (-812.036) (-814.161) (-813.166) [-810.354] * (-811.235) [-809.867] (-815.419) (-813.201) -- 0:00:15
748500 -- (-817.881) [-814.995] (-810.922) (-810.978) * (-809.153) [-811.966] (-808.869) (-811.099) -- 0:00:15
749000 -- (-813.053) (-814.599) [-809.178] (-811.443) * (-810.023) (-812.684) [-809.764] (-810.048) -- 0:00:15
749500 -- (-812.372) [-809.527] (-812.214) (-808.758) * (-808.578) (-811.420) [-811.481] (-811.840) -- 0:00:15
750000 -- (-809.964) (-811.548) [-809.009] (-816.356) * (-811.148) [-808.790] (-814.672) (-813.597) -- 0:00:15
Average standard deviation of split frequencies: 0.007829
750500 -- (-813.880) [-810.859] (-809.886) (-812.603) * (-812.218) (-808.970) (-811.784) [-810.562] -- 0:00:15
751000 -- (-817.112) (-811.604) [-814.981] (-809.117) * (-810.931) (-810.993) [-808.466] (-808.798) -- 0:00:15
751500 -- (-815.024) (-809.987) [-813.318] (-812.432) * [-811.119] (-815.066) (-816.566) (-813.440) -- 0:00:15
752000 -- (-813.202) (-812.951) [-811.220] (-808.775) * (-809.029) (-813.061) [-809.243] (-811.094) -- 0:00:15
752500 -- (-809.418) (-809.849) (-809.916) [-809.457] * (-809.234) (-811.434) (-810.393) [-810.049] -- 0:00:15
753000 -- (-810.409) (-813.001) (-809.660) [-810.970] * (-813.071) (-812.575) (-810.958) [-811.216] -- 0:00:15
753500 -- (-810.407) (-810.543) (-815.651) [-809.241] * (-814.476) (-809.742) (-812.003) [-812.016] -- 0:00:15
754000 -- (-812.207) (-811.508) [-809.948] (-814.149) * (-814.625) [-813.295] (-810.847) (-812.006) -- 0:00:15
754500 -- (-813.460) (-810.422) [-809.991] (-811.442) * (-813.583) (-811.781) (-810.821) [-810.081] -- 0:00:15
755000 -- (-812.716) (-811.513) (-811.831) [-808.812] * (-810.935) (-811.020) (-810.134) [-811.926] -- 0:00:15
Average standard deviation of split frequencies: 0.008023
755500 -- (-810.953) (-810.695) [-812.671] (-809.133) * (-809.851) [-810.535] (-809.901) (-809.714) -- 0:00:15
756000 -- [-811.449] (-813.574) (-810.467) (-811.461) * (-809.385) (-810.502) [-811.737] (-811.198) -- 0:00:15
756500 -- (-810.643) (-812.102) [-809.132] (-808.889) * (-816.341) (-811.933) (-813.732) [-808.935] -- 0:00:15
757000 -- [-809.573] (-811.440) (-808.741) (-809.222) * (-810.378) [-809.023] (-812.360) (-810.864) -- 0:00:15
757500 -- (-811.311) (-814.163) (-809.952) [-812.046] * [-810.397] (-809.019) (-811.205) (-809.846) -- 0:00:15
758000 -- (-812.854) (-812.738) [-808.716] (-809.780) * (-812.147) [-809.351] (-809.907) (-811.473) -- 0:00:15
758500 -- [-812.318] (-812.327) (-810.720) (-811.217) * (-813.571) (-812.462) [-810.460] (-814.997) -- 0:00:14
759000 -- (-813.217) [-811.824] (-811.174) (-811.376) * (-809.636) (-813.202) (-810.412) [-810.260] -- 0:00:14
759500 -- (-813.333) (-813.715) [-809.382] (-809.064) * [-813.030] (-810.262) (-810.092) (-812.389) -- 0:00:14
760000 -- (-811.564) [-811.823] (-808.450) (-809.686) * (-810.565) (-809.344) [-809.704] (-812.926) -- 0:00:14
Average standard deviation of split frequencies: 0.007809
760500 -- (-811.010) (-810.145) (-814.399) [-813.628] * (-810.201) [-814.072] (-809.753) (-811.438) -- 0:00:14
761000 -- (-811.238) (-808.736) (-810.828) [-811.568] * (-810.150) (-810.275) [-808.832] (-812.153) -- 0:00:14
761500 -- (-811.966) [-810.299] (-810.528) (-809.475) * (-809.649) (-811.419) [-809.352] (-811.902) -- 0:00:14
762000 -- [-811.392] (-808.149) (-812.904) (-808.636) * (-812.621) (-811.273) [-809.600] (-808.551) -- 0:00:14
762500 -- (-812.315) (-808.601) [-813.824] (-810.215) * (-810.807) (-814.618) [-810.353] (-809.680) -- 0:00:14
763000 -- (-808.966) (-812.524) (-815.330) [-809.878] * (-810.784) [-810.444] (-810.263) (-810.041) -- 0:00:14
763500 -- (-815.355) (-811.469) [-815.589] (-816.020) * (-811.032) (-813.039) [-810.053] (-809.294) -- 0:00:14
764000 -- (-812.427) [-812.198] (-812.493) (-811.542) * (-810.621) [-808.934] (-810.777) (-808.836) -- 0:00:14
764500 -- (-813.518) [-811.575] (-811.424) (-813.155) * (-810.536) [-808.936] (-809.270) (-815.191) -- 0:00:14
765000 -- (-812.542) (-810.921) [-811.214] (-809.052) * (-811.787) [-811.259] (-810.320) (-810.851) -- 0:00:14
Average standard deviation of split frequencies: 0.007631
765500 -- (-813.490) [-811.201] (-812.113) (-819.725) * (-811.400) (-810.373) (-809.476) [-809.865] -- 0:00:14
766000 -- (-813.046) [-814.406] (-811.724) (-809.787) * (-809.763) (-813.471) (-810.787) [-812.676] -- 0:00:14
766500 -- [-814.261] (-810.821) (-811.717) (-811.489) * [-810.515] (-810.052) (-814.028) (-811.219) -- 0:00:14
767000 -- (-812.439) (-811.630) (-810.670) [-809.107] * [-808.985] (-812.702) (-810.193) (-811.610) -- 0:00:14
767500 -- (-811.003) (-811.483) (-810.717) [-810.784] * (-812.144) [-812.929] (-808.502) (-812.639) -- 0:00:14
768000 -- (-809.243) [-810.080] (-810.595) (-812.074) * (-810.412) (-808.518) [-809.955] (-812.238) -- 0:00:14
768500 -- [-810.667] (-813.833) (-808.853) (-810.036) * [-808.326] (-809.533) (-810.266) (-812.006) -- 0:00:14
769000 -- [-812.641] (-811.180) (-809.802) (-809.606) * (-809.096) (-809.396) [-810.705] (-810.759) -- 0:00:14
769500 -- (-810.893) (-810.851) (-810.191) [-815.079] * (-809.803) (-809.564) (-810.271) [-813.989] -- 0:00:14
770000 -- (-810.011) (-809.143) [-809.138] (-809.378) * (-809.888) [-809.634] (-811.780) (-810.537) -- 0:00:14
Average standard deviation of split frequencies: 0.007136
770500 -- [-809.294] (-810.174) (-811.220) (-809.633) * (-810.065) (-811.177) [-812.577] (-811.596) -- 0:00:14
771000 -- (-811.095) [-814.097] (-813.273) (-811.369) * (-813.952) (-810.623) (-813.208) [-809.752] -- 0:00:14
771500 -- [-809.397] (-810.358) (-810.801) (-810.289) * (-815.448) (-812.156) (-809.121) [-810.651] -- 0:00:14
772000 -- (-810.167) (-810.326) (-811.300) [-809.537] * (-809.404) [-814.855] (-812.479) (-809.225) -- 0:00:14
772500 -- (-809.981) [-810.217] (-813.050) (-813.568) * (-811.577) (-814.574) [-811.301] (-809.765) -- 0:00:14
773000 -- [-809.429] (-810.253) (-812.796) (-809.906) * [-811.902] (-813.245) (-813.461) (-809.472) -- 0:00:14
773500 -- [-815.191] (-810.238) (-811.076) (-814.311) * (-812.898) (-811.600) (-811.514) [-809.081] -- 0:00:14
774000 -- (-811.367) [-809.112] (-813.937) (-811.803) * (-812.264) [-811.105] (-815.093) (-808.561) -- 0:00:14
774500 -- [-812.493] (-813.518) (-810.116) (-816.712) * [-808.597] (-810.997) (-811.281) (-812.869) -- 0:00:13
775000 -- (-809.247) (-813.965) [-811.594] (-812.201) * (-808.614) (-808.556) [-809.386] (-810.179) -- 0:00:13
Average standard deviation of split frequencies: 0.006601
775500 -- (-809.990) (-808.761) [-810.515] (-810.672) * (-809.431) [-810.124] (-809.605) (-812.033) -- 0:00:13
776000 -- (-815.631) (-809.373) (-808.923) [-811.377] * [-809.626] (-808.306) (-809.091) (-808.403) -- 0:00:13
776500 -- [-811.750] (-810.230) (-810.405) (-811.377) * (-814.105) (-808.302) [-809.600] (-812.360) -- 0:00:13
777000 -- (-810.499) (-810.418) (-811.042) [-808.752] * [-811.019] (-809.822) (-812.039) (-812.621) -- 0:00:13
777500 -- (-813.526) [-809.576] (-810.607) (-809.027) * (-808.820) (-812.089) (-812.937) [-813.297] -- 0:00:13
778000 -- (-811.036) [-810.187] (-810.803) (-810.904) * (-809.601) [-809.942] (-810.011) (-810.114) -- 0:00:13
778500 -- (-810.089) (-809.962) (-810.513) [-810.255] * [-810.266] (-809.703) (-813.271) (-810.023) -- 0:00:13
779000 -- (-809.260) (-812.553) [-808.958] (-810.681) * (-809.649) (-810.748) (-818.742) [-809.046] -- 0:00:13
779500 -- (-811.257) (-811.777) (-809.292) [-810.661] * (-811.055) [-809.177] (-811.621) (-808.998) -- 0:00:13
780000 -- (-811.047) [-809.764] (-809.841) (-809.974) * (-811.330) (-811.753) [-809.803] (-809.758) -- 0:00:13
Average standard deviation of split frequencies: 0.006079
780500 -- [-814.200] (-810.008) (-808.819) (-809.364) * [-812.189] (-811.225) (-811.239) (-808.857) -- 0:00:13
781000 -- [-810.955] (-809.847) (-811.135) (-812.799) * [-809.205] (-810.248) (-813.297) (-809.148) -- 0:00:13
781500 -- (-812.748) (-808.746) (-810.928) [-810.050] * (-809.402) [-811.016] (-809.016) (-809.514) -- 0:00:13
782000 -- [-812.646] (-810.508) (-809.489) (-811.637) * (-808.772) (-811.687) (-809.434) [-810.110] -- 0:00:13
782500 -- (-811.864) (-809.897) [-809.989] (-810.579) * (-808.780) [-811.049] (-808.372) (-811.332) -- 0:00:13
783000 -- [-812.451] (-813.835) (-811.563) (-809.841) * (-809.259) (-811.874) [-808.734] (-809.024) -- 0:00:13
783500 -- (-808.425) (-818.711) [-809.435] (-809.487) * (-810.184) (-808.989) (-809.340) [-810.119] -- 0:00:13
784000 -- [-812.161] (-811.420) (-812.429) (-812.172) * (-818.314) [-808.431] (-810.802) (-809.099) -- 0:00:13
784500 -- [-811.593] (-811.006) (-812.806) (-809.265) * (-814.016) [-811.068] (-810.433) (-810.636) -- 0:00:13
785000 -- (-810.732) [-809.128] (-816.320) (-808.224) * (-810.500) (-809.962) [-808.439] (-811.006) -- 0:00:13
Average standard deviation of split frequencies: 0.006677
785500 -- (-811.484) (-809.201) (-811.532) [-812.256] * [-809.345] (-812.998) (-811.281) (-810.406) -- 0:00:13
786000 -- [-813.205] (-809.630) (-808.606) (-813.116) * (-811.831) (-809.032) [-809.921] (-810.366) -- 0:00:13
786500 -- (-810.425) (-810.720) (-809.246) [-812.325] * (-813.237) (-810.174) [-809.693] (-809.299) -- 0:00:13
787000 -- (-814.084) [-810.639] (-809.630) (-809.961) * (-810.217) (-808.724) [-810.178] (-810.686) -- 0:00:13
787500 -- (-813.381) (-811.258) [-810.038] (-811.784) * (-810.581) [-808.669] (-809.017) (-810.067) -- 0:00:13
788000 -- (-813.157) (-809.786) (-809.483) [-813.273] * (-813.964) (-813.098) (-814.077) [-809.066] -- 0:00:13
788500 -- [-810.723] (-809.751) (-808.947) (-810.892) * (-812.254) (-814.393) (-809.147) [-808.922] -- 0:00:13
789000 -- [-811.428] (-810.106) (-812.884) (-812.357) * (-814.233) (-808.529) (-809.095) [-808.848] -- 0:00:13
789500 -- (-810.253) [-809.505] (-811.468) (-812.521) * (-809.726) (-811.015) [-809.968] (-809.996) -- 0:00:13
790000 -- [-810.086] (-810.213) (-813.342) (-810.752) * [-810.319] (-810.499) (-809.841) (-810.989) -- 0:00:13
Average standard deviation of split frequencies: 0.006996
790500 -- (-809.099) [-809.975] (-810.587) (-808.922) * [-810.157] (-810.364) (-809.728) (-811.065) -- 0:00:12
791000 -- (-809.668) [-809.964] (-810.541) (-814.871) * (-809.758) (-810.244) [-809.413] (-810.482) -- 0:00:12
791500 -- (-809.717) [-810.516] (-811.829) (-810.066) * (-809.790) (-812.954) (-810.929) [-814.717] -- 0:00:12
792000 -- (-813.982) [-809.408] (-809.582) (-810.254) * (-809.672) (-809.397) [-809.430] (-809.112) -- 0:00:12
792500 -- (-809.913) [-811.718] (-813.740) (-810.910) * (-810.986) [-809.305] (-809.126) (-808.974) -- 0:00:12
793000 -- (-810.829) (-812.169) [-808.900] (-813.067) * (-810.007) [-810.461] (-810.262) (-809.311) -- 0:00:12
793500 -- (-809.016) (-812.592) [-810.878] (-810.214) * (-810.103) (-809.706) (-810.831) [-812.286] -- 0:00:12
794000 -- (-813.475) (-812.780) [-810.865] (-814.699) * (-809.506) (-809.514) [-812.119] (-812.049) -- 0:00:12
794500 -- [-809.231] (-809.783) (-811.916) (-812.397) * (-811.410) (-808.788) [-811.254] (-811.935) -- 0:00:12
795000 -- (-812.130) (-810.727) (-811.962) [-812.097] * (-809.235) (-813.998) [-808.785] (-811.921) -- 0:00:12
Average standard deviation of split frequencies: 0.007225
795500 -- [-811.120] (-810.535) (-810.326) (-812.586) * (-810.587) (-812.904) [-809.060] (-812.572) -- 0:00:12
796000 -- [-810.249] (-809.391) (-811.175) (-809.790) * (-811.386) (-811.093) (-809.900) [-812.617] -- 0:00:12
796500 -- (-809.518) (-809.087) [-808.733] (-808.996) * (-816.827) (-812.505) [-810.298] (-812.644) -- 0:00:12
797000 -- [-810.226] (-813.554) (-810.095) (-809.533) * (-813.566) (-808.916) (-810.649) [-810.465] -- 0:00:12
797500 -- [-810.597] (-809.808) (-810.818) (-810.301) * (-813.028) (-809.547) [-809.144] (-809.881) -- 0:00:12
798000 -- (-809.174) (-811.646) (-810.512) [-809.036] * (-812.644) (-811.914) [-812.700] (-810.438) -- 0:00:12
798500 -- (-810.057) (-812.130) (-809.783) [-812.012] * (-812.026) (-808.823) [-810.178] (-809.561) -- 0:00:12
799000 -- (-813.088) [-809.968] (-809.274) (-808.802) * [-808.572] (-812.777) (-810.159) (-810.336) -- 0:00:12
799500 -- (-811.344) (-811.390) (-808.929) [-809.869] * (-811.429) (-809.725) (-810.029) [-812.655] -- 0:00:12
800000 -- [-809.516] (-812.023) (-810.253) (-811.769) * (-809.659) [-809.281] (-808.723) (-810.873) -- 0:00:12
Average standard deviation of split frequencies: 0.007144
800500 -- (-811.027) [-808.938] (-812.276) (-808.840) * (-815.243) (-813.330) [-809.222] (-809.410) -- 0:00:12
801000 -- [-809.991] (-809.200) (-811.876) (-809.917) * (-814.898) (-809.618) (-809.517) [-810.530] -- 0:00:12
801500 -- (-808.364) [-812.464] (-814.681) (-812.209) * (-817.828) [-809.625] (-810.154) (-812.137) -- 0:00:12
802000 -- [-810.846] (-812.690) (-813.291) (-811.960) * (-808.792) [-810.873] (-810.708) (-810.435) -- 0:00:12
802500 -- (-810.646) [-810.011] (-810.742) (-810.964) * [-809.471] (-810.450) (-811.887) (-814.593) -- 0:00:12
803000 -- (-809.251) [-810.513] (-811.938) (-814.572) * (-809.514) (-811.060) (-810.622) [-811.429] -- 0:00:12
803500 -- (-809.714) [-810.457] (-811.610) (-810.599) * (-810.146) (-810.696) (-808.887) [-811.567] -- 0:00:12
804000 -- [-810.296] (-809.804) (-808.889) (-809.117) * (-810.667) (-809.627) [-809.974] (-811.252) -- 0:00:12
804500 -- (-808.641) [-810.614] (-808.695) (-812.036) * [-811.130] (-810.694) (-810.580) (-812.490) -- 0:00:12
805000 -- [-808.656] (-814.118) (-814.480) (-810.910) * [-813.377] (-812.630) (-809.077) (-809.597) -- 0:00:12
Average standard deviation of split frequencies: 0.007096
805500 -- (-810.061) (-811.695) [-809.941] (-811.868) * (-810.021) (-811.094) [-812.318] (-810.857) -- 0:00:12
806000 -- (-811.379) (-809.802) (-810.100) [-812.804] * (-811.605) [-811.121] (-809.437) (-812.144) -- 0:00:12
806500 -- [-809.369] (-809.073) (-816.043) (-810.712) * [-809.240] (-810.577) (-816.682) (-810.000) -- 0:00:11
807000 -- (-809.941) [-809.567] (-813.697) (-809.435) * (-810.884) (-810.550) (-810.694) [-811.312] -- 0:00:11
807500 -- (-811.713) (-810.327) (-809.267) [-810.115] * (-811.352) (-810.571) [-812.789] (-810.375) -- 0:00:11
808000 -- (-809.983) (-813.528) [-812.078] (-809.705) * (-812.334) (-812.427) (-812.892) [-811.191] -- 0:00:11
808500 -- [-809.336] (-809.600) (-810.525) (-810.041) * [-809.195] (-813.691) (-815.199) (-808.628) -- 0:00:11
809000 -- (-810.326) [-810.013] (-810.467) (-809.737) * (-812.670) (-814.903) [-811.980] (-808.827) -- 0:00:11
809500 -- [-810.633] (-809.984) (-814.048) (-809.054) * (-811.391) [-809.685] (-813.138) (-811.104) -- 0:00:11
810000 -- (-811.463) (-810.467) [-809.947] (-813.166) * [-810.284] (-809.337) (-814.769) (-809.587) -- 0:00:11
Average standard deviation of split frequencies: 0.006784
810500 -- [-810.583] (-810.146) (-810.209) (-812.408) * [-810.401] (-808.892) (-810.371) (-809.910) -- 0:00:11
811000 -- (-809.680) (-811.754) [-810.875] (-811.743) * [-810.564] (-810.101) (-809.527) (-811.413) -- 0:00:11
811500 -- (-809.150) (-810.142) (-811.798) [-809.315] * [-810.410] (-813.284) (-810.609) (-810.029) -- 0:00:11
812000 -- (-808.859) (-811.070) [-808.749] (-812.874) * (-812.518) (-812.744) [-808.427] (-809.567) -- 0:00:11
812500 -- (-810.833) (-811.104) (-815.827) [-811.670] * (-809.746) (-817.809) (-808.347) [-811.340] -- 0:00:11
813000 -- [-811.341] (-812.271) (-811.512) (-814.902) * (-822.602) (-813.711) (-808.910) [-809.488] -- 0:00:11
813500 -- (-810.984) [-813.621] (-810.523) (-810.207) * (-810.826) (-812.475) [-811.511] (-810.956) -- 0:00:11
814000 -- [-812.943] (-809.055) (-809.425) (-809.616) * [-815.247] (-811.836) (-812.220) (-809.290) -- 0:00:11
814500 -- (-812.738) [-808.965] (-809.264) (-809.614) * (-817.330) (-811.510) (-810.913) [-809.173] -- 0:00:11
815000 -- (-814.776) (-810.979) (-809.317) [-809.158] * (-809.905) (-815.388) (-809.278) [-810.462] -- 0:00:11
Average standard deviation of split frequencies: 0.006740
815500 -- (-812.749) (-812.618) [-810.015] (-811.484) * (-810.703) (-809.105) (-813.318) [-810.343] -- 0:00:11
816000 -- (-810.269) (-810.809) [-810.353] (-809.248) * (-809.211) (-810.406) [-809.775] (-811.795) -- 0:00:11
816500 -- (-810.615) [-811.254] (-809.139) (-808.912) * [-809.302] (-810.534) (-809.270) (-811.078) -- 0:00:11
817000 -- [-810.853] (-811.733) (-812.858) (-814.512) * (-810.242) (-808.813) (-808.810) [-810.948] -- 0:00:11
817500 -- (-810.675) (-810.190) [-810.137] (-810.221) * (-810.554) (-814.526) [-810.120] (-811.669) -- 0:00:11
818000 -- [-809.040] (-810.315) (-808.775) (-809.710) * (-813.094) (-812.144) [-810.164] (-809.835) -- 0:00:11
818500 -- (-811.262) (-810.719) (-812.757) [-809.176] * (-811.870) (-809.306) [-811.333] (-809.048) -- 0:00:11
819000 -- (-808.980) (-810.605) (-813.915) [-810.861] * (-812.355) [-810.006] (-809.277) (-808.617) -- 0:00:11
819500 -- (-810.057) (-811.080) (-820.141) [-808.926] * (-811.303) (-810.736) [-808.743] (-810.093) -- 0:00:11
820000 -- [-810.202] (-811.808) (-813.600) (-810.793) * (-812.126) [-811.433] (-809.682) (-809.948) -- 0:00:11
Average standard deviation of split frequencies: 0.007046
820500 -- (-809.890) (-812.133) (-809.169) [-809.488] * [-813.165] (-810.297) (-813.967) (-811.064) -- 0:00:11
821000 -- (-810.897) (-811.767) [-810.307] (-810.873) * [-811.519] (-811.039) (-809.293) (-812.429) -- 0:00:11
821500 -- (-811.082) (-809.133) [-812.305] (-812.224) * [-809.389] (-813.271) (-810.198) (-812.814) -- 0:00:11
822000 -- (-811.082) [-809.330] (-813.747) (-809.697) * (-809.442) (-813.621) (-814.608) [-808.761] -- 0:00:11
822500 -- (-810.983) (-810.634) (-810.872) [-811.599] * (-810.703) (-811.891) [-809.471] (-810.752) -- 0:00:11
823000 -- (-809.927) (-809.471) (-812.728) [-809.016] * [-809.629] (-814.789) (-811.365) (-810.811) -- 0:00:10
823500 -- (-812.087) [-809.272] (-811.723) (-810.288) * (-809.432) (-815.023) (-812.013) [-810.382] -- 0:00:10
824000 -- (-811.503) (-809.520) (-811.439) [-811.715] * (-811.650) (-811.590) (-810.129) [-814.160] -- 0:00:10
824500 -- (-810.215) [-810.655] (-809.938) (-811.440) * (-810.696) (-809.228) [-809.160] (-812.648) -- 0:00:10
825000 -- (-812.266) (-810.976) [-811.208] (-812.108) * (-811.020) [-812.027] (-809.973) (-812.955) -- 0:00:10
Average standard deviation of split frequencies: 0.007001
825500 -- (-808.951) (-809.711) [-810.335] (-814.278) * (-809.776) [-809.815] (-811.451) (-816.729) -- 0:00:10
826000 -- [-813.364] (-810.009) (-809.477) (-811.994) * (-812.644) (-813.507) [-810.121] (-813.514) -- 0:00:10
826500 -- (-810.646) [-812.886] (-811.503) (-815.844) * (-810.033) [-809.413] (-809.241) (-813.747) -- 0:00:10
827000 -- (-811.689) [-809.830] (-811.194) (-810.513) * [-809.482] (-811.649) (-808.350) (-808.366) -- 0:00:10
827500 -- (-812.257) (-810.278) (-812.401) [-811.711] * (-809.370) (-814.358) [-809.619] (-808.481) -- 0:00:10
828000 -- (-815.428) (-810.822) (-810.867) [-810.511] * [-809.270] (-809.833) (-811.543) (-810.070) -- 0:00:10
828500 -- [-811.850] (-809.605) (-810.760) (-809.161) * (-809.133) (-810.683) (-814.785) [-810.372] -- 0:00:10
829000 -- [-809.815] (-812.212) (-814.024) (-814.220) * (-809.822) [-809.828] (-811.836) (-810.819) -- 0:00:10
829500 -- [-811.484] (-809.251) (-810.598) (-816.216) * (-810.612) (-808.853) [-809.133] (-814.040) -- 0:00:10
830000 -- [-813.342] (-814.082) (-812.270) (-810.052) * (-811.114) (-812.185) [-810.975] (-815.708) -- 0:00:10
Average standard deviation of split frequencies: 0.006545
830500 -- [-809.498] (-816.296) (-810.184) (-811.891) * (-811.105) (-812.252) [-811.768] (-811.616) -- 0:00:10
831000 -- (-808.339) (-815.257) (-809.101) [-809.563] * (-812.948) (-809.701) (-813.301) [-810.657] -- 0:00:10
831500 -- [-808.612] (-812.885) (-811.150) (-809.216) * (-816.258) [-808.480] (-809.767) (-809.519) -- 0:00:10
832000 -- (-808.623) (-811.545) (-810.765) [-810.882] * (-817.277) [-809.914] (-809.807) (-809.355) -- 0:00:10
832500 -- (-811.259) (-811.287) [-810.421] (-814.950) * (-810.016) [-812.947] (-809.773) (-809.760) -- 0:00:10
833000 -- (-810.478) (-810.698) [-808.892] (-812.464) * (-814.789) (-810.620) (-813.734) [-815.067] -- 0:00:10
833500 -- (-814.006) (-811.129) [-808.917] (-808.981) * (-815.085) [-809.400] (-812.946) (-810.441) -- 0:00:10
834000 -- (-813.085) [-811.882] (-809.463) (-809.128) * (-817.683) [-809.430] (-812.273) (-811.057) -- 0:00:10
834500 -- (-809.667) (-809.713) [-810.398] (-809.288) * (-812.247) [-810.753] (-812.426) (-809.964) -- 0:00:10
835000 -- [-811.961] (-813.263) (-810.650) (-811.802) * [-810.682] (-810.117) (-812.785) (-811.822) -- 0:00:10
Average standard deviation of split frequencies: 0.006466
835500 -- [-810.523] (-819.167) (-810.719) (-809.079) * [-812.787] (-810.013) (-810.728) (-809.942) -- 0:00:10
836000 -- (-811.497) (-811.865) (-809.946) [-810.893] * (-814.372) [-815.654] (-811.032) (-810.367) -- 0:00:10
836500 -- (-810.094) [-810.304] (-812.728) (-816.539) * [-810.861] (-811.314) (-811.792) (-810.930) -- 0:00:10
837000 -- (-808.793) [-810.385] (-811.939) (-810.492) * [-814.405] (-809.932) (-809.035) (-808.251) -- 0:00:10
837500 -- (-808.398) [-808.266] (-811.639) (-809.464) * [-809.112] (-810.786) (-810.273) (-809.168) -- 0:00:10
838000 -- [-808.975] (-813.080) (-811.796) (-810.304) * (-813.024) (-810.680) (-811.722) [-809.810] -- 0:00:10
838500 -- [-809.605] (-811.799) (-810.491) (-809.022) * [-810.646] (-809.851) (-809.274) (-810.414) -- 0:00:10
839000 -- (-810.210) [-811.608] (-809.951) (-809.589) * (-815.759) (-809.807) (-811.504) [-808.716] -- 0:00:09
839500 -- (-811.031) (-809.323) (-809.676) [-809.204] * (-813.519) (-811.158) (-809.980) [-808.467] -- 0:00:09
840000 -- (-809.176) [-808.854] (-810.427) (-810.327) * (-809.832) (-811.212) [-810.230] (-809.346) -- 0:00:09
Average standard deviation of split frequencies: 0.006280
840500 -- [-808.833] (-809.033) (-808.758) (-809.544) * (-810.013) (-812.675) [-810.085] (-809.108) -- 0:00:09
841000 -- (-809.235) [-815.361] (-813.312) (-810.603) * (-810.701) (-814.394) [-812.984] (-809.975) -- 0:00:09
841500 -- (-809.586) (-812.386) (-813.412) [-810.162] * (-809.566) (-811.322) [-809.422] (-808.753) -- 0:00:09
842000 -- (-815.423) (-812.918) (-812.620) [-810.524] * (-809.935) (-809.161) [-811.838] (-812.460) -- 0:00:09
842500 -- (-812.097) (-817.033) (-814.014) [-809.021] * (-810.267) (-812.989) [-811.102] (-808.745) -- 0:00:09
843000 -- (-812.529) (-809.280) [-814.491] (-809.483) * [-809.749] (-819.407) (-815.467) (-813.333) -- 0:00:09
843500 -- (-809.988) (-809.090) (-811.752) [-808.777] * (-809.495) [-810.605] (-809.818) (-809.906) -- 0:00:09
844000 -- [-808.567] (-808.921) (-811.406) (-809.584) * (-812.583) [-809.655] (-810.714) (-810.996) -- 0:00:09
844500 -- (-809.387) (-811.148) [-809.855] (-809.584) * [-809.093] (-814.702) (-811.779) (-810.285) -- 0:00:09
845000 -- (-814.192) [-810.450] (-811.011) (-811.388) * (-808.794) (-809.332) (-810.549) [-811.085] -- 0:00:09
Average standard deviation of split frequencies: 0.006798
845500 -- (-814.561) [-810.153] (-811.992) (-810.631) * (-815.876) [-809.662] (-816.930) (-810.450) -- 0:00:09
846000 -- (-809.876) (-809.606) [-811.207] (-810.418) * (-811.069) (-808.963) [-811.658] (-810.910) -- 0:00:09
846500 -- (-810.134) (-810.773) [-808.823] (-809.810) * [-810.636] (-811.983) (-810.946) (-808.750) -- 0:00:09
847000 -- (-811.955) [-811.248] (-809.190) (-809.980) * [-809.479] (-808.838) (-809.749) (-810.023) -- 0:00:09
847500 -- [-812.415] (-810.235) (-809.150) (-809.529) * (-812.530) [-809.074] (-810.478) (-811.227) -- 0:00:09
848000 -- (-811.385) [-810.393] (-810.520) (-814.002) * (-814.166) (-809.840) (-809.413) [-809.897] -- 0:00:09
848500 -- (-812.480) [-811.886] (-810.130) (-814.000) * (-811.053) [-808.264] (-810.243) (-811.810) -- 0:00:09
849000 -- (-811.760) (-809.084) [-812.301] (-810.590) * [-810.749] (-809.196) (-811.346) (-809.918) -- 0:00:09
849500 -- (-809.208) (-808.780) [-813.284] (-812.343) * (-809.163) (-809.416) [-811.638] (-812.521) -- 0:00:09
850000 -- (-809.249) (-812.165) (-811.734) [-811.043] * (-809.415) (-811.067) (-811.534) [-810.400] -- 0:00:09
Average standard deviation of split frequencies: 0.006724
850500 -- (-809.244) [-810.376] (-815.070) (-813.196) * (-808.718) (-809.545) [-809.654] (-810.421) -- 0:00:09
851000 -- (-809.436) [-809.411] (-816.046) (-812.005) * (-810.803) (-809.469) [-808.945] (-810.643) -- 0:00:09
851500 -- (-810.980) [-809.400] (-810.039) (-816.250) * (-809.025) [-810.246] (-808.990) (-811.648) -- 0:00:09
852000 -- (-810.811) [-808.924] (-809.678) (-815.025) * (-809.333) (-811.308) (-808.963) [-810.694] -- 0:00:09
852500 -- [-814.015] (-815.073) (-810.706) (-810.395) * (-808.990) [-812.410] (-811.790) (-810.678) -- 0:00:09
853000 -- [-810.844] (-809.502) (-810.704) (-809.535) * (-809.146) (-815.698) [-809.591] (-812.333) -- 0:00:09
853500 -- (-808.202) (-808.825) [-812.005] (-809.120) * [-808.823] (-815.046) (-814.581) (-813.386) -- 0:00:09
854000 -- (-808.685) (-814.550) (-816.594) [-810.733] * (-809.721) (-817.261) [-812.350] (-810.631) -- 0:00:09
854500 -- [-809.149] (-810.481) (-811.820) (-810.798) * (-809.547) [-810.101] (-809.362) (-815.143) -- 0:00:09
855000 -- (-809.319) (-811.900) (-810.507) [-808.895] * (-809.404) (-812.292) [-811.344] (-815.883) -- 0:00:08
Average standard deviation of split frequencies: 0.006462
855500 -- [-811.341] (-810.549) (-810.253) (-811.937) * [-810.034] (-811.745) (-810.889) (-808.648) -- 0:00:08
856000 -- (-809.592) (-812.207) (-810.249) [-811.088] * (-810.675) [-811.496] (-808.449) (-809.078) -- 0:00:08
856500 -- (-810.097) (-816.243) [-810.431] (-810.655) * (-809.304) [-810.229] (-810.219) (-810.425) -- 0:00:08
857000 -- (-812.520) (-809.365) [-808.776] (-810.080) * (-810.784) (-810.277) [-814.469] (-812.959) -- 0:00:08
857500 -- (-810.847) (-809.274) (-809.224) [-810.199] * (-808.384) (-811.190) (-814.616) [-811.522] -- 0:00:08
858000 -- (-818.224) [-809.370] (-808.459) (-811.015) * (-808.243) (-810.223) [-808.586] (-808.298) -- 0:00:08
858500 -- (-809.492) [-810.374] (-808.983) (-810.238) * [-809.153] (-809.157) (-808.408) (-812.661) -- 0:00:08
859000 -- (-812.070) (-809.739) [-809.379] (-811.650) * (-810.621) (-808.826) (-808.979) [-809.857] -- 0:00:08
859500 -- (-810.799) (-812.293) (-808.570) [-811.598] * [-812.970] (-809.274) (-808.505) (-811.823) -- 0:00:08
860000 -- (-810.732) (-817.842) [-810.764] (-809.457) * (-811.991) [-809.334] (-810.031) (-810.714) -- 0:00:08
Average standard deviation of split frequencies: 0.006609
860500 -- (-811.259) (-809.200) (-810.529) [-809.416] * (-811.067) [-809.049] (-809.242) (-808.876) -- 0:00:08
861000 -- [-810.086] (-808.655) (-809.218) (-809.774) * (-811.449) (-809.758) (-809.099) [-808.846] -- 0:00:08
861500 -- (-811.119) [-808.655] (-809.961) (-812.410) * (-811.161) (-809.792) (-809.308) [-809.531] -- 0:00:08
862000 -- (-814.365) (-808.549) [-812.619] (-809.555) * (-811.604) [-809.917] (-813.236) (-809.765) -- 0:00:08
862500 -- [-812.630] (-811.003) (-813.749) (-812.562) * (-810.650) [-810.606] (-812.180) (-809.284) -- 0:00:08
863000 -- (-812.566) [-808.667] (-814.964) (-811.867) * [-808.748] (-809.944) (-813.738) (-816.002) -- 0:00:08
863500 -- (-817.238) (-809.544) [-812.346] (-813.393) * (-812.124) [-811.756] (-810.296) (-809.072) -- 0:00:08
864000 -- (-817.186) [-810.230] (-809.965) (-808.932) * (-811.407) (-813.905) (-809.854) [-810.687] -- 0:00:08
864500 -- (-811.791) (-809.946) [-809.594] (-809.446) * (-811.827) [-813.943] (-809.868) (-810.364) -- 0:00:08
865000 -- (-809.223) [-809.255] (-810.316) (-809.701) * (-811.559) [-811.038] (-811.927) (-809.643) -- 0:00:08
Average standard deviation of split frequencies: 0.006460
865500 -- [-809.728] (-810.534) (-809.378) (-814.839) * (-810.456) (-809.523) (-812.374) [-812.037] -- 0:00:08
866000 -- (-810.196) [-810.682] (-811.174) (-810.503) * (-810.543) (-809.213) [-811.664] (-809.128) -- 0:00:08
866500 -- [-809.950] (-809.214) (-808.822) (-809.818) * (-809.390) [-810.440] (-810.890) (-809.558) -- 0:00:08
867000 -- (-814.035) (-811.748) [-809.457] (-809.186) * (-809.360) (-809.107) (-809.718) [-809.486] -- 0:00:08
867500 -- (-809.908) (-811.498) (-809.980) [-809.075] * (-813.092) (-816.728) [-809.077] (-808.830) -- 0:00:08
868000 -- [-812.153] (-809.933) (-808.925) (-810.509) * (-814.868) (-809.869) [-809.820] (-810.686) -- 0:00:08
868500 -- (-812.606) (-810.457) (-810.805) [-810.623] * (-810.710) (-810.922) (-812.801) [-811.013] -- 0:00:08
869000 -- (-809.835) [-810.133] (-813.577) (-809.044) * (-810.300) (-809.658) [-810.707] (-810.014) -- 0:00:08
869500 -- (-811.132) [-808.342] (-811.738) (-812.127) * (-810.891) [-809.582] (-808.403) (-810.586) -- 0:00:08
870000 -- (-810.129) [-808.343] (-813.224) (-810.164) * [-815.428] (-808.803) (-808.453) (-811.524) -- 0:00:08
Average standard deviation of split frequencies: 0.007002
870500 -- (-808.577) [-810.235] (-811.456) (-811.281) * (-810.118) [-808.704] (-808.814) (-809.392) -- 0:00:08
871000 -- (-809.184) (-809.667) (-811.492) [-809.876] * (-814.087) [-809.513] (-810.493) (-808.757) -- 0:00:07
871500 -- (-809.039) (-814.707) (-808.978) [-809.671] * (-813.663) (-809.042) [-809.263] (-811.441) -- 0:00:07
872000 -- (-809.134) (-812.796) (-809.341) [-809.988] * (-809.982) (-809.042) [-812.058] (-810.333) -- 0:00:07
872500 -- (-809.103) (-810.299) [-808.886] (-810.281) * [-809.939] (-809.176) (-813.578) (-810.442) -- 0:00:07
873000 -- [-810.171] (-810.948) (-814.266) (-811.684) * (-810.169) (-811.177) [-808.443] (-811.003) -- 0:00:07
873500 -- (-811.364) [-811.239] (-811.009) (-810.763) * [-809.811] (-810.558) (-809.206) (-812.379) -- 0:00:07
874000 -- (-809.580) [-809.768] (-810.446) (-810.519) * (-810.607) (-809.909) (-811.827) [-808.935] -- 0:00:07
874500 -- [-808.396] (-808.915) (-808.644) (-809.175) * (-809.713) (-809.701) (-809.909) [-808.419] -- 0:00:07
875000 -- (-808.354) [-808.644] (-810.028) (-811.024) * (-808.568) (-808.540) (-811.885) [-810.268] -- 0:00:07
Average standard deviation of split frequencies: 0.006852
875500 -- (-809.164) (-809.189) [-811.597] (-810.533) * (-809.885) [-809.419] (-812.356) (-809.418) -- 0:00:07
876000 -- (-809.174) [-810.199] (-808.808) (-814.156) * (-813.775) (-809.090) [-809.218] (-808.318) -- 0:00:07
876500 -- (-811.510) [-809.876] (-810.667) (-812.057) * (-811.425) [-812.013] (-809.956) (-810.535) -- 0:00:07
877000 -- [-810.023] (-809.341) (-809.507) (-813.751) * (-809.201) (-810.993) [-811.739] (-809.557) -- 0:00:07
877500 -- (-809.793) [-809.641] (-809.780) (-813.634) * [-808.660] (-811.002) (-813.261) (-811.096) -- 0:00:07
878000 -- (-811.150) [-809.225] (-808.642) (-814.789) * (-809.849) (-812.883) (-812.838) [-812.947] -- 0:00:07
878500 -- (-809.070) [-811.657] (-808.160) (-809.776) * [-809.051] (-816.898) (-813.152) (-811.149) -- 0:00:07
879000 -- (-808.719) (-809.666) [-808.207] (-810.945) * (-811.124) (-810.265) [-810.959] (-815.582) -- 0:00:07
879500 -- (-812.897) (-808.610) [-808.563] (-813.428) * (-811.829) (-808.703) (-812.550) [-810.104] -- 0:00:07
880000 -- (-814.677) [-809.611] (-811.343) (-808.736) * [-811.778] (-808.955) (-812.078) (-811.844) -- 0:00:07
Average standard deviation of split frequencies: 0.007208
880500 -- (-808.952) (-808.677) (-810.655) [-809.193] * [-811.029] (-815.688) (-811.760) (-811.049) -- 0:00:07
881000 -- (-808.887) [-811.545] (-813.213) (-810.730) * (-809.337) (-813.918) (-811.587) [-811.002] -- 0:00:07
881500 -- (-808.350) [-810.977] (-809.201) (-810.098) * (-808.876) (-809.708) [-809.230] (-810.951) -- 0:00:07
882000 -- [-809.347] (-808.802) (-810.387) (-812.518) * (-815.498) [-809.582] (-812.220) (-810.716) -- 0:00:07
882500 -- (-810.184) (-810.055) (-808.741) [-809.496] * (-810.221) (-809.161) [-812.241] (-811.878) -- 0:00:07
883000 -- (-813.202) [-812.071] (-810.104) (-808.944) * (-809.703) (-809.075) [-811.887] (-809.613) -- 0:00:07
883500 -- (-813.009) [-808.873] (-809.766) (-811.145) * (-810.889) (-809.283) [-809.757] (-809.919) -- 0:00:07
884000 -- (-812.338) (-813.434) [-810.933] (-812.940) * (-813.192) [-810.990] (-809.772) (-810.661) -- 0:00:07
884500 -- (-808.854) [-810.042] (-811.778) (-810.021) * (-810.414) (-810.367) [-810.976] (-812.319) -- 0:00:07
885000 -- (-809.064) [-808.530] (-812.458) (-811.201) * (-808.877) (-809.849) (-809.764) [-808.450] -- 0:00:07
Average standard deviation of split frequencies: 0.007626
885500 -- [-809.294] (-810.092) (-808.662) (-810.629) * (-811.390) (-809.061) [-809.176] (-813.047) -- 0:00:07
886000 -- (-811.037) (-813.041) (-808.732) [-808.982] * [-809.815] (-808.974) (-808.472) (-812.338) -- 0:00:07
886500 -- (-809.113) [-809.220] (-808.498) (-809.313) * (-808.406) [-808.279] (-809.151) (-810.923) -- 0:00:07
887000 -- [-809.737] (-810.799) (-812.595) (-808.618) * [-808.260] (-808.281) (-810.768) (-810.963) -- 0:00:07
887500 -- (-808.717) (-813.901) (-809.271) [-809.795] * (-808.459) (-809.597) [-808.624] (-810.275) -- 0:00:06
888000 -- (-812.648) (-811.625) (-810.271) [-812.620] * (-808.997) (-812.867) (-810.781) [-809.739] -- 0:00:06
888500 -- (-812.170) [-811.294] (-810.112) (-814.739) * (-811.160) [-810.102] (-809.990) (-812.984) -- 0:00:06
889000 -- (-809.288) (-809.079) [-810.938] (-818.417) * (-810.128) (-809.979) [-809.308] (-811.717) -- 0:00:06
889500 -- (-811.769) (-810.548) (-811.340) [-809.075] * (-811.575) [-810.231] (-809.333) (-814.260) -- 0:00:06
890000 -- (-813.286) (-809.872) (-812.922) [-809.880] * (-809.966) (-812.029) (-811.915) [-810.123] -- 0:00:06
Average standard deviation of split frequencies: 0.007657
890500 -- (-810.565) (-809.858) (-813.455) [-808.579] * (-809.596) (-810.334) [-811.421] (-810.989) -- 0:00:06
891000 -- [-812.314] (-810.502) (-809.680) (-809.554) * [-811.402] (-810.585) (-811.684) (-811.136) -- 0:00:06
891500 -- (-811.006) (-813.779) [-810.199] (-811.386) * (-813.151) (-813.810) [-811.326] (-809.941) -- 0:00:06
892000 -- [-809.032] (-810.173) (-810.008) (-813.182) * (-812.306) [-812.305] (-809.903) (-810.141) -- 0:00:06
892500 -- (-811.926) (-814.410) [-812.291] (-811.065) * (-808.769) (-811.428) (-810.275) [-809.246] -- 0:00:06
893000 -- (-813.458) (-812.508) (-809.300) [-810.266] * [-809.228] (-808.288) (-809.070) (-816.269) -- 0:00:06
893500 -- (-812.746) (-812.695) (-810.053) [-810.095] * [-811.710] (-809.609) (-810.562) (-809.311) -- 0:00:06
894000 -- (-813.355) [-809.432] (-810.053) (-810.867) * (-811.022) (-809.400) [-810.712] (-809.549) -- 0:00:06
894500 -- (-811.671) [-809.837] (-808.913) (-813.589) * [-810.047] (-809.412) (-815.771) (-811.318) -- 0:00:06
895000 -- (-813.225) (-808.897) [-811.263] (-812.817) * [-812.522] (-811.102) (-811.049) (-812.751) -- 0:00:06
Average standard deviation of split frequencies: 0.007541
895500 -- [-810.179] (-808.614) (-818.612) (-812.391) * (-814.453) (-809.294) [-815.535] (-812.160) -- 0:00:06
896000 -- (-812.732) [-809.268] (-811.992) (-808.894) * (-813.650) [-813.614] (-810.402) (-809.185) -- 0:00:06
896500 -- (-811.076) [-810.634] (-812.780) (-810.287) * (-809.973) (-809.822) [-808.954] (-810.639) -- 0:00:06
897000 -- (-810.713) (-809.841) (-811.978) [-808.779] * (-811.623) (-810.495) (-808.965) [-811.382] -- 0:00:06
897500 -- (-811.305) [-811.897] (-809.701) (-808.844) * (-812.214) (-810.872) [-810.967] (-813.557) -- 0:00:06
898000 -- (-811.811) (-811.779) (-812.080) [-809.022] * (-811.204) (-813.678) (-815.855) [-814.175] -- 0:00:06
898500 -- [-810.782] (-809.471) (-814.679) (-808.708) * [-813.864] (-808.771) (-812.648) (-810.883) -- 0:00:06
899000 -- (-811.962) (-809.048) [-812.299] (-809.355) * (-812.284) (-808.628) (-809.737) [-815.734] -- 0:00:06
899500 -- (-813.277) (-810.311) (-809.334) [-810.708] * (-811.122) [-811.377] (-811.691) (-812.310) -- 0:00:06
900000 -- [-810.110] (-810.022) (-810.003) (-812.015) * [-808.951] (-810.620) (-809.844) (-810.618) -- 0:00:06
Average standard deviation of split frequencies: 0.007572
900500 -- (-809.271) (-809.839) [-811.360] (-810.125) * (-810.479) (-808.974) [-810.679] (-812.168) -- 0:00:06
901000 -- (-814.775) (-810.388) [-811.424] (-809.324) * (-808.792) (-809.096) (-809.916) [-810.761] -- 0:00:06
901500 -- [-810.952] (-810.276) (-809.204) (-810.544) * (-808.682) (-810.401) [-813.075] (-809.896) -- 0:00:06
902000 -- (-809.976) (-808.802) [-811.216] (-811.410) * (-808.700) [-809.041] (-813.012) (-810.132) -- 0:00:06
902500 -- (-811.926) [-810.076] (-811.440) (-810.296) * (-809.510) [-810.093] (-811.393) (-810.270) -- 0:00:06
903000 -- [-809.344] (-813.098) (-810.237) (-808.444) * (-809.231) (-808.410) [-814.392] (-814.309) -- 0:00:06
903500 -- (-809.931) [-809.561] (-810.013) (-809.646) * (-809.703) [-808.412] (-813.053) (-810.883) -- 0:00:05
904000 -- (-811.423) (-808.395) [-810.708] (-810.831) * [-808.768] (-812.362) (-811.234) (-811.090) -- 0:00:05
904500 -- (-810.765) (-813.409) (-810.336) [-810.267] * (-811.639) (-810.616) [-808.765] (-814.579) -- 0:00:05
905000 -- (-810.638) (-814.744) [-812.523] (-810.485) * (-808.614) (-809.634) (-813.114) [-813.428] -- 0:00:05
Average standard deviation of split frequencies: 0.007215
905500 -- [-810.414] (-811.853) (-815.533) (-809.308) * (-809.999) (-810.763) [-810.574] (-812.730) -- 0:00:05
906000 -- [-809.971] (-809.821) (-815.204) (-810.832) * (-813.477) [-808.966] (-814.351) (-809.548) -- 0:00:05
906500 -- (-809.548) (-808.606) (-809.363) [-812.199] * (-808.229) (-809.927) (-811.782) [-808.463] -- 0:00:05
907000 -- (-809.881) (-810.473) [-812.366] (-810.838) * (-808.771) (-813.753) (-810.681) [-809.732] -- 0:00:05
907500 -- [-810.311] (-810.030) (-813.036) (-809.151) * (-811.283) [-812.501] (-811.806) (-809.438) -- 0:00:05
908000 -- (-810.602) (-808.564) (-814.427) [-810.149] * (-812.744) (-811.308) (-813.025) [-808.969] -- 0:00:05
908500 -- (-810.497) [-810.669] (-818.280) (-813.274) * (-809.669) (-810.943) [-811.349] (-812.103) -- 0:00:05
909000 -- (-809.978) (-808.615) (-812.115) [-811.341] * [-811.224] (-812.119) (-810.344) (-808.465) -- 0:00:05
909500 -- (-813.416) (-809.050) [-809.133] (-814.646) * (-812.475) (-811.771) (-811.149) [-812.198] -- 0:00:05
910000 -- (-814.023) (-809.256) (-816.551) [-810.262] * [-809.971] (-811.901) (-809.593) (-810.052) -- 0:00:05
Average standard deviation of split frequencies: 0.007420
910500 -- [-810.974] (-808.608) (-812.140) (-810.166) * [-810.792] (-812.850) (-811.764) (-811.098) -- 0:00:05
911000 -- (-811.826) (-810.728) (-811.704) [-814.174] * [-812.169] (-811.512) (-811.399) (-811.911) -- 0:00:05
911500 -- (-813.057) (-811.466) [-815.837] (-811.029) * (-812.701) (-809.845) [-809.330] (-811.821) -- 0:00:05
912000 -- (-809.346) (-810.494) (-810.051) [-810.949] * (-812.250) (-810.582) (-813.373) [-812.616] -- 0:00:05
912500 -- (-810.315) [-811.155] (-809.892) (-811.158) * (-812.008) (-812.679) (-815.766) [-809.213] -- 0:00:05
913000 -- [-809.273] (-811.340) (-811.579) (-810.900) * (-823.298) (-815.325) (-814.077) [-812.107] -- 0:00:05
913500 -- (-813.317) (-811.231) (-811.915) [-810.443] * (-813.493) [-809.718] (-810.335) (-809.581) -- 0:00:05
914000 -- (-810.822) (-809.526) [-813.540] (-809.910) * (-814.075) (-809.631) (-808.822) [-809.256] -- 0:00:05
914500 -- (-816.230) (-811.328) [-810.975] (-815.510) * [-809.350] (-809.074) (-812.850) (-808.263) -- 0:00:05
915000 -- [-813.478] (-809.069) (-810.939) (-810.150) * (-810.200) (-808.796) (-811.288) [-809.019] -- 0:00:05
Average standard deviation of split frequencies: 0.007788
915500 -- (-814.883) (-809.954) (-809.179) [-812.692] * (-810.810) (-809.111) [-809.188] (-809.955) -- 0:00:05
916000 -- [-815.045] (-812.344) (-811.044) (-809.756) * (-814.679) (-813.370) [-812.684] (-808.685) -- 0:00:05
916500 -- (-816.181) [-809.518] (-815.312) (-809.688) * (-810.414) (-815.977) [-810.376] (-808.167) -- 0:00:05
917000 -- (-813.252) (-811.372) [-809.159] (-811.884) * (-809.203) (-813.749) [-812.405] (-809.779) -- 0:00:05
917500 -- (-812.658) (-810.988) (-809.975) [-809.534] * (-809.483) (-813.647) (-809.561) [-809.696] -- 0:00:05
918000 -- (-808.740) (-812.574) [-809.820] (-810.206) * (-810.751) [-811.961] (-809.589) (-811.106) -- 0:00:05
918500 -- [-809.561] (-809.875) (-809.978) (-809.287) * (-811.158) (-810.077) [-809.166] (-812.434) -- 0:00:05
919000 -- [-812.664] (-810.815) (-810.315) (-812.223) * (-811.706) (-809.891) (-810.451) [-811.602] -- 0:00:05
919500 -- (-815.111) [-808.704] (-810.028) (-809.834) * (-808.486) (-816.335) [-811.417] (-810.510) -- 0:00:04
920000 -- (-811.741) (-808.828) (-810.826) [-810.601] * (-810.270) (-814.814) (-808.842) [-812.041] -- 0:00:04
Average standard deviation of split frequencies: 0.007476
920500 -- (-811.848) (-811.186) [-809.064] (-809.234) * (-810.005) [-813.352] (-809.054) (-811.073) -- 0:00:04
921000 -- (-809.330) (-812.551) [-809.149] (-810.966) * [-813.783] (-809.189) (-810.432) (-810.201) -- 0:00:04
921500 -- (-808.857) (-812.587) [-809.154] (-810.683) * (-808.371) (-809.425) [-810.310] (-814.294) -- 0:00:04
922000 -- [-810.919] (-813.257) (-809.569) (-810.944) * [-809.221] (-811.454) (-809.288) (-818.239) -- 0:00:04
922500 -- (-809.342) (-815.178) (-810.144) [-808.368] * (-811.855) [-809.629] (-808.961) (-811.544) -- 0:00:04
923000 -- (-809.236) (-813.102) [-812.604] (-810.186) * (-810.829) (-812.187) (-808.990) [-809.366] -- 0:00:04
923500 -- [-812.385] (-811.063) (-815.803) (-815.153) * [-809.729] (-810.931) (-809.537) (-814.305) -- 0:00:04
924000 -- (-811.704) (-811.396) (-813.445) [-811.985] * [-810.048] (-813.859) (-808.909) (-811.615) -- 0:00:04
924500 -- (-811.132) [-811.378] (-811.753) (-811.073) * (-812.013) (-813.353) (-808.458) [-809.307] -- 0:00:04
925000 -- [-811.590] (-810.810) (-809.775) (-808.943) * (-808.809) (-811.038) [-808.657] (-810.769) -- 0:00:04
Average standard deviation of split frequencies: 0.007976
925500 -- [-811.760] (-810.089) (-808.790) (-810.941) * (-809.687) [-809.543] (-810.539) (-811.536) -- 0:00:04
926000 -- (-812.024) (-813.911) [-809.721] (-811.601) * (-813.216) (-810.956) (-810.649) [-810.865] -- 0:00:04
926500 -- [-814.906] (-809.298) (-811.169) (-808.222) * (-811.593) (-808.657) [-810.739] (-816.274) -- 0:00:04
927000 -- (-813.252) (-809.445) (-809.992) [-809.703] * (-813.003) (-811.665) [-811.683] (-813.547) -- 0:00:04
927500 -- (-808.814) [-812.564] (-808.480) (-809.602) * (-812.710) (-813.732) (-810.018) [-810.748] -- 0:00:04
928000 -- (-808.780) [-810.176] (-811.425) (-810.712) * (-809.440) (-810.834) (-812.079) [-808.528] -- 0:00:04
928500 -- [-813.488] (-810.279) (-813.091) (-811.745) * (-808.883) [-808.613] (-810.997) (-808.731) -- 0:00:04
929000 -- [-810.063] (-810.194) (-812.148) (-811.982) * (-812.372) [-808.429] (-813.595) (-812.542) -- 0:00:04
929500 -- (-810.151) [-812.822] (-811.262) (-812.592) * (-814.469) [-812.640] (-811.950) (-813.074) -- 0:00:04
930000 -- (-811.283) [-811.003] (-808.973) (-809.840) * (-810.512) (-811.668) [-811.009] (-812.033) -- 0:00:04
Average standard deviation of split frequencies: 0.007530
930500 -- [-809.948] (-814.797) (-810.669) (-810.648) * (-811.370) (-812.901) [-811.143] (-810.724) -- 0:00:04
931000 -- (-809.548) (-810.908) (-808.999) [-809.869] * [-812.059] (-811.212) (-812.223) (-810.091) -- 0:00:04
931500 -- (-809.473) [-811.330] (-810.721) (-809.371) * (-810.004) (-811.784) [-812.077] (-810.319) -- 0:00:04
932000 -- (-809.928) (-809.803) (-810.753) [-809.166] * (-811.721) (-812.777) (-812.797) [-809.280] -- 0:00:04
932500 -- (-811.852) (-813.669) [-810.277] (-812.717) * (-812.245) (-813.703) [-809.222] (-813.252) -- 0:00:04
933000 -- [-812.201] (-810.237) (-810.599) (-810.151) * [-810.847] (-810.192) (-809.866) (-810.703) -- 0:00:04
933500 -- [-813.583] (-812.307) (-811.166) (-810.680) * (-811.637) [-809.529] (-811.070) (-810.125) -- 0:00:04
934000 -- (-810.970) (-811.953) (-810.890) [-811.004] * [-808.457] (-810.880) (-809.815) (-810.985) -- 0:00:04
934500 -- (-811.753) [-810.477] (-812.973) (-811.965) * (-810.239) [-810.195] (-809.219) (-808.475) -- 0:00:04
935000 -- (-812.148) (-809.902) (-809.068) [-812.865] * [-809.020] (-809.608) (-809.639) (-808.800) -- 0:00:04
Average standard deviation of split frequencies: 0.007387
935500 -- (-813.582) (-811.514) [-810.791] (-815.950) * (-808.490) (-809.020) [-810.972] (-810.544) -- 0:00:03
936000 -- (-815.262) [-809.103] (-810.599) (-814.138) * (-808.684) (-814.219) [-810.239] (-808.405) -- 0:00:03
936500 -- (-823.458) [-809.439] (-814.757) (-812.861) * (-808.533) (-810.974) (-808.547) [-809.345] -- 0:00:03
937000 -- (-808.601) (-810.335) (-810.037) [-808.801] * (-808.643) (-810.520) [-811.781] (-809.484) -- 0:00:03
937500 -- (-808.695) (-811.735) [-809.504] (-810.219) * (-811.563) (-809.793) (-814.023) [-813.623] -- 0:00:03
938000 -- (-809.535) (-809.364) [-809.588] (-810.357) * (-810.760) [-809.066] (-809.407) (-809.858) -- 0:00:03
938500 -- [-810.662] (-809.699) (-809.206) (-809.180) * [-809.299] (-812.844) (-811.980) (-809.987) -- 0:00:03
939000 -- [-809.652] (-810.769) (-809.050) (-811.711) * (-812.099) [-809.372] (-811.958) (-809.154) -- 0:00:03
939500 -- (-812.751) (-812.925) [-808.683] (-809.257) * (-810.885) [-809.506] (-810.726) (-810.874) -- 0:00:03
940000 -- (-809.399) (-810.916) (-813.665) [-812.952] * [-813.214] (-811.474) (-813.617) (-817.259) -- 0:00:03
Average standard deviation of split frequencies: 0.007450
940500 -- [-808.314] (-811.696) (-810.052) (-810.317) * (-809.968) (-813.067) (-809.169) [-812.293] -- 0:00:03
941000 -- (-808.512) (-809.766) [-808.263] (-813.043) * (-809.348) (-812.054) [-810.399] (-812.492) -- 0:00:03
941500 -- (-815.385) [-809.745] (-810.569) (-809.644) * (-809.149) [-810.257] (-811.367) (-812.608) -- 0:00:03
942000 -- (-815.803) (-809.484) (-813.073) [-810.098] * (-809.932) [-808.553] (-814.916) (-811.211) -- 0:00:03
942500 -- (-812.556) (-809.201) [-810.028] (-809.276) * [-811.219] (-809.184) (-812.216) (-812.725) -- 0:00:03
943000 -- (-813.181) [-808.990] (-809.860) (-809.338) * [-811.039] (-810.975) (-809.725) (-811.140) -- 0:00:03
943500 -- (-813.697) [-808.510] (-811.526) (-809.327) * (-810.854) [-811.964] (-810.595) (-810.050) -- 0:00:03
944000 -- (-810.978) (-811.446) [-812.603] (-813.161) * [-810.326] (-813.682) (-808.632) (-811.107) -- 0:00:03
944500 -- (-811.469) (-809.875) [-811.250] (-810.758) * (-813.628) (-810.498) (-808.633) [-808.761] -- 0:00:03
945000 -- (-809.677) [-814.204] (-809.762) (-810.514) * [-808.556] (-813.119) (-810.959) (-808.829) -- 0:00:03
Average standard deviation of split frequencies: 0.007807
945500 -- (-811.270) (-810.063) [-810.495] (-810.236) * [-811.648] (-812.303) (-812.791) (-808.675) -- 0:00:03
946000 -- (-813.492) (-810.256) [-810.482] (-808.691) * (-812.990) (-816.352) (-811.803) [-813.066] -- 0:00:03
946500 -- [-811.238] (-809.899) (-811.239) (-809.160) * (-809.922) [-811.186] (-809.707) (-810.080) -- 0:00:03
947000 -- [-808.837] (-809.996) (-808.728) (-809.631) * (-809.844) [-812.066] (-810.285) (-810.243) -- 0:00:03
947500 -- [-808.933] (-809.323) (-813.954) (-813.077) * [-811.117] (-812.873) (-810.808) (-813.089) -- 0:00:03
948000 -- [-810.147] (-809.228) (-808.909) (-812.042) * (-811.836) (-811.736) [-815.644] (-811.278) -- 0:00:03
948500 -- (-815.186) (-811.974) [-810.866] (-814.458) * [-809.503] (-811.049) (-816.194) (-810.784) -- 0:00:03
949000 -- (-812.811) (-809.601) [-808.944] (-814.060) * (-812.190) [-809.103] (-811.476) (-808.886) -- 0:00:03
949500 -- (-812.856) (-809.168) [-808.538] (-812.049) * (-810.929) (-812.975) [-809.769] (-812.556) -- 0:00:03
950000 -- (-810.172) (-815.065) (-810.469) [-812.030] * [-810.838] (-810.788) (-809.052) (-812.752) -- 0:00:03
Average standard deviation of split frequencies: 0.007405
950500 -- (-812.775) [-810.487] (-812.543) (-808.480) * (-809.146) [-810.798] (-809.955) (-810.346) -- 0:00:03
951000 -- (-809.045) [-808.979] (-816.328) (-812.391) * [-812.736] (-812.197) (-811.287) (-810.489) -- 0:00:03
951500 -- [-812.956] (-811.930) (-815.165) (-810.396) * (-811.731) (-810.408) (-809.716) [-810.466] -- 0:00:03
952000 -- (-810.201) (-812.243) (-811.053) [-809.442] * (-810.239) (-810.468) (-816.349) [-810.577] -- 0:00:02
952500 -- [-810.365] (-809.166) (-809.358) (-810.118) * (-809.925) (-809.705) (-813.905) [-810.255] -- 0:00:02
953000 -- (-810.388) [-808.310] (-810.561) (-810.101) * [-810.841] (-810.545) (-814.736) (-810.100) -- 0:00:02
953500 -- (-811.877) (-810.461) (-809.465) [-810.007] * (-813.414) [-811.296] (-809.239) (-811.229) -- 0:00:02
954000 -- (-811.558) (-810.123) [-812.088] (-812.490) * [-814.857] (-814.730) (-811.462) (-809.633) -- 0:00:02
954500 -- [-809.240] (-811.540) (-811.399) (-810.710) * [-809.846] (-810.681) (-810.648) (-812.716) -- 0:00:02
955000 -- (-809.974) (-811.856) [-810.875] (-809.840) * [-810.235] (-810.705) (-810.056) (-810.389) -- 0:00:02
Average standard deviation of split frequencies: 0.007627
955500 -- (-813.504) [-810.566] (-809.791) (-809.374) * (-811.404) [-810.473] (-808.900) (-810.675) -- 0:00:02
956000 -- (-810.780) (-810.450) [-811.376] (-810.399) * (-811.161) [-808.597] (-809.079) (-811.516) -- 0:00:02
956500 -- [-811.443] (-810.609) (-809.772) (-812.740) * (-810.411) [-810.634] (-809.288) (-810.873) -- 0:00:02
957000 -- (-811.919) (-809.645) [-812.360] (-817.498) * (-811.545) (-814.603) [-809.236] (-810.618) -- 0:00:02
957500 -- (-810.283) [-809.146] (-809.150) (-809.965) * (-812.349) (-812.153) [-808.729] (-815.883) -- 0:00:02
958000 -- (-812.080) [-811.071] (-809.594) (-812.677) * (-811.713) [-809.938] (-811.060) (-812.069) -- 0:00:02
958500 -- (-815.626) (-813.213) (-812.294) [-808.650] * (-809.989) (-811.449) [-810.581] (-811.557) -- 0:00:02
959000 -- (-809.206) (-813.041) [-808.776] (-810.869) * (-810.376) [-809.179] (-809.012) (-811.407) -- 0:00:02
959500 -- [-810.307] (-814.761) (-812.959) (-814.924) * (-811.175) (-809.590) [-810.599] (-811.348) -- 0:00:02
960000 -- (-811.907) (-814.396) (-810.906) [-808.869] * (-808.879) [-810.372] (-810.024) (-809.404) -- 0:00:02
Average standard deviation of split frequencies: 0.007524
960500 -- (-810.729) (-811.410) [-809.984] (-811.130) * [-809.869] (-809.371) (-811.344) (-809.137) -- 0:00:02
961000 -- (-809.217) (-812.611) [-811.995] (-812.782) * [-810.056] (-810.923) (-811.720) (-811.258) -- 0:00:02
961500 -- [-809.975] (-811.925) (-810.508) (-810.790) * (-810.003) (-809.855) [-813.956] (-813.369) -- 0:00:02
962000 -- [-809.029] (-812.124) (-809.667) (-809.950) * (-809.263) (-810.671) (-809.997) [-812.928] -- 0:00:02
962500 -- (-812.100) [-811.068] (-810.457) (-815.949) * (-809.641) (-814.964) [-809.563] (-810.743) -- 0:00:02
963000 -- [-811.235] (-813.345) (-819.348) (-813.766) * [-809.198] (-813.938) (-809.961) (-815.417) -- 0:00:02
963500 -- (-811.399) (-809.266) (-811.133) [-811.073] * [-809.461] (-814.660) (-810.907) (-809.844) -- 0:00:02
964000 -- [-810.736] (-808.874) (-810.393) (-813.736) * (-809.774) (-811.301) [-811.962] (-811.160) -- 0:00:02
964500 -- (-809.440) [-809.376] (-812.769) (-813.244) * (-809.605) (-811.614) [-810.717] (-811.458) -- 0:00:02
965000 -- (-810.833) (-811.311) (-808.442) [-809.767] * [-809.582] (-810.568) (-809.866) (-812.896) -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- (-808.352) (-812.330) [-809.860] (-809.340) * (-814.788) [-812.225] (-809.020) (-809.641) -- 0:00:02
966000 -- (-809.350) [-817.583] (-810.826) (-811.385) * (-809.211) [-810.745] (-809.109) (-811.561) -- 0:00:02
966500 -- (-809.455) (-808.817) (-810.742) [-810.372] * [-811.474] (-809.738) (-814.170) (-811.391) -- 0:00:02
967000 -- (-808.983) (-811.751) (-810.596) [-812.653] * (-812.711) [-812.002] (-809.061) (-811.456) -- 0:00:02
967500 -- (-811.282) (-810.193) [-811.196] (-810.080) * (-813.193) (-810.228) (-809.225) [-812.976] -- 0:00:02
968000 -- [-810.351] (-810.349) (-809.846) (-811.929) * (-811.624) (-809.164) (-811.146) [-810.079] -- 0:00:01
968500 -- [-815.823] (-810.262) (-811.462) (-812.694) * (-811.490) (-812.518) [-809.369] (-811.158) -- 0:00:01
969000 -- (-815.672) (-813.736) (-811.624) [-810.586] * [-811.798] (-813.585) (-809.270) (-810.979) -- 0:00:01
969500 -- (-813.756) (-812.246) [-812.452] (-809.571) * (-810.460) (-810.601) (-810.598) [-810.159] -- 0:00:01
970000 -- [-812.779] (-811.793) (-813.513) (-816.334) * (-813.318) [-809.944] (-810.037) (-813.558) -- 0:00:01
Average standard deviation of split frequencies: 0.007382
970500 -- [-809.293] (-811.385) (-810.757) (-812.437) * (-810.819) [-808.806] (-809.595) (-812.726) -- 0:00:01
971000 -- (-810.145) (-810.417) [-811.964] (-811.394) * (-809.773) (-810.643) [-811.150] (-812.766) -- 0:00:01
971500 -- (-810.505) (-810.838) [-809.865] (-809.713) * (-810.129) (-811.178) (-811.186) [-809.232] -- 0:00:01
972000 -- (-811.439) [-813.672] (-808.373) (-809.231) * [-809.206] (-810.360) (-809.034) (-812.602) -- 0:00:01
972500 -- (-809.517) [-816.393] (-811.291) (-809.146) * (-810.089) (-813.414) [-810.369] (-810.517) -- 0:00:01
973000 -- (-809.886) (-810.978) [-810.682] (-808.547) * [-809.572] (-812.692) (-810.940) (-810.445) -- 0:00:01
973500 -- (-811.629) (-811.314) [-811.042] (-808.660) * [-810.092] (-809.976) (-811.004) (-808.927) -- 0:00:01
974000 -- (-808.410) [-809.394] (-814.992) (-812.618) * (-810.078) [-809.220] (-811.966) (-809.996) -- 0:00:01
974500 -- (-810.073) [-809.636] (-820.203) (-809.064) * (-813.133) (-809.790) (-810.837) [-810.156] -- 0:00:01
975000 -- [-809.684] (-809.825) (-808.955) (-818.213) * (-810.796) (-809.861) [-810.368] (-809.596) -- 0:00:01
Average standard deviation of split frequencies: 0.007277
975500 -- (-809.692) (-812.163) (-808.489) [-809.947] * [-809.570] (-809.086) (-810.649) (-809.483) -- 0:00:01
976000 -- (-809.511) (-812.422) (-811.624) [-811.602] * (-810.731) [-811.841] (-810.074) (-810.412) -- 0:00:01
976500 -- (-808.327) (-811.055) (-809.575) [-817.154] * [-809.625] (-809.894) (-808.820) (-811.832) -- 0:00:01
977000 -- (-815.380) [-811.453] (-810.613) (-814.750) * [-811.086] (-809.221) (-808.468) (-809.465) -- 0:00:01
977500 -- (-811.422) (-810.291) [-810.005] (-813.373) * [-811.909] (-809.445) (-812.773) (-811.187) -- 0:00:01
978000 -- [-810.807] (-810.134) (-810.609) (-809.166) * (-811.656) [-808.275] (-813.934) (-808.595) -- 0:00:01
978500 -- (-812.580) [-810.823] (-813.191) (-809.168) * [-809.436] (-810.272) (-809.690) (-812.690) -- 0:00:01
979000 -- (-810.941) (-808.678) [-811.408] (-810.160) * (-809.100) [-812.435] (-811.530) (-813.037) -- 0:00:01
979500 -- [-810.145] (-810.296) (-815.068) (-815.295) * [-809.165] (-811.640) (-810.228) (-812.305) -- 0:00:01
980000 -- [-810.617] (-811.323) (-810.895) (-811.266) * [-810.196] (-808.487) (-808.999) (-810.790) -- 0:00:01
Average standard deviation of split frequencies: 0.007499
980500 -- (-813.934) (-809.420) [-809.604] (-813.876) * [-809.545] (-808.841) (-808.922) (-814.115) -- 0:00:01
981000 -- (-809.562) (-808.858) (-809.603) [-809.443] * (-809.914) [-812.153] (-810.161) (-814.424) -- 0:00:01
981500 -- (-811.734) (-811.861) (-808.732) [-809.232] * (-811.317) [-809.313] (-809.173) (-812.278) -- 0:00:01
982000 -- (-812.512) (-809.833) (-808.487) [-808.949] * (-808.796) (-808.841) (-811.863) [-811.336] -- 0:00:01
982500 -- (-811.135) (-808.540) [-808.844] (-811.299) * (-810.398) (-808.742) (-810.153) [-810.724] -- 0:00:01
983000 -- (-810.347) (-809.972) (-810.129) [-809.117] * (-812.745) (-809.888) [-810.791] (-810.113) -- 0:00:01
983500 -- (-814.138) (-812.726) [-809.097] (-812.948) * (-812.536) [-813.913] (-809.809) (-812.878) -- 0:00:01
984000 -- (-809.694) [-813.030] (-809.257) (-811.622) * [-812.529] (-811.682) (-809.450) (-810.122) -- 0:00:00
984500 -- (-809.240) [-811.717] (-809.862) (-814.496) * (-812.823) [-811.822] (-811.156) (-810.757) -- 0:00:00
985000 -- (-818.240) [-816.036] (-813.480) (-809.110) * (-808.568) (-809.782) (-809.086) [-810.093] -- 0:00:00
Average standard deviation of split frequencies: 0.007490
985500 -- (-810.477) (-816.412) (-810.317) [-810.829] * (-809.294) (-809.690) (-810.898) [-815.597] -- 0:00:00
986000 -- [-810.028] (-810.234) (-810.676) (-809.851) * (-810.110) (-810.808) [-813.132] (-809.970) -- 0:00:00
986500 -- (-812.148) (-810.289) [-811.018] (-810.070) * (-808.358) [-808.998] (-809.015) (-809.214) -- 0:00:00
987000 -- (-810.233) [-810.512] (-812.845) (-811.217) * (-808.507) (-812.974) [-815.279] (-809.504) -- 0:00:00
987500 -- [-808.404] (-809.962) (-812.571) (-809.425) * (-812.575) [-809.273] (-812.345) (-811.550) -- 0:00:00
988000 -- [-808.334] (-809.487) (-811.296) (-814.750) * (-814.253) [-809.594] (-813.439) (-811.914) -- 0:00:00
988500 -- (-810.497) (-809.771) [-810.544] (-812.764) * [-810.235] (-809.215) (-812.697) (-811.377) -- 0:00:00
989000 -- [-810.060] (-809.188) (-813.740) (-813.842) * (-809.544) [-812.241] (-809.474) (-812.410) -- 0:00:00
989500 -- (-811.297) [-809.541] (-816.176) (-812.570) * [-808.741] (-810.615) (-813.186) (-809.731) -- 0:00:00
990000 -- (-811.976) (-810.001) [-810.020] (-811.894) * (-812.451) (-811.219) [-811.001] (-809.701) -- 0:00:00
Average standard deviation of split frequencies: 0.007455
990500 -- (-812.632) [-811.150] (-809.311) (-810.593) * (-809.633) (-813.775) (-810.146) [-811.371] -- 0:00:00
991000 -- [-809.123] (-809.169) (-810.053) (-810.019) * [-810.565] (-811.690) (-811.006) (-816.611) -- 0:00:00
991500 -- (-810.250) (-812.583) [-809.227] (-811.506) * (-808.959) (-810.535) [-809.394] (-813.591) -- 0:00:00
992000 -- (-812.271) [-809.747] (-811.059) (-809.556) * (-813.895) (-809.829) [-808.693] (-813.516) -- 0:00:00
992500 -- (-813.127) (-810.101) [-810.138] (-811.172) * [-811.279] (-813.335) (-813.124) (-808.748) -- 0:00:00
993000 -- (-810.538) (-811.382) [-810.612] (-808.623) * (-812.606) [-811.873] (-811.585) (-813.161) -- 0:00:00
993500 -- (-810.545) [-814.566] (-811.894) (-809.023) * [-812.304] (-811.076) (-821.061) (-813.138) -- 0:00:00
994000 -- (-810.695) (-813.722) [-809.774] (-811.164) * (-812.168) [-808.855] (-810.377) (-809.711) -- 0:00:00
994500 -- (-812.133) (-810.721) (-812.075) [-810.364] * [-811.152] (-808.998) (-810.817) (-812.590) -- 0:00:00
995000 -- (-810.559) (-817.062) [-810.190] (-809.648) * [-810.514] (-810.570) (-810.132) (-813.044) -- 0:00:00
Average standard deviation of split frequencies: 0.007510
995500 -- (-809.696) (-821.311) [-809.573] (-810.865) * (-810.017) [-811.987] (-808.968) (-811.878) -- 0:00:00
996000 -- (-814.191) [-821.339] (-809.073) (-811.771) * (-810.287) (-809.737) (-808.992) [-809.449] -- 0:00:00
996500 -- [-811.003] (-809.305) (-811.079) (-809.009) * [-809.637] (-814.114) (-812.959) (-810.503) -- 0:00:00
997000 -- (-813.851) (-810.919) (-810.731) [-809.457] * [-808.578] (-810.369) (-813.219) (-813.130) -- 0:00:00
997500 -- [-812.534] (-813.149) (-810.629) (-812.312) * (-809.431) (-809.390) [-809.574] (-810.874) -- 0:00:00
998000 -- (-813.120) [-809.416] (-809.648) (-809.025) * (-810.308) (-810.049) (-809.265) [-811.945] -- 0:00:00
998500 -- (-808.633) (-810.165) (-809.397) [-812.373] * (-808.851) [-809.830] (-816.415) (-814.191) -- 0:00:00
999000 -- (-809.212) (-810.355) (-811.766) [-809.271] * (-809.824) (-812.071) [-813.195] (-811.784) -- 0:00:00
999500 -- (-809.180) [-812.852] (-810.629) (-812.499) * (-809.835) (-811.968) [-809.967] (-809.654) -- 0:00:00
1000000 -- (-813.615) (-811.283) [-816.604] (-811.672) * (-809.530) (-811.848) (-808.551) [-809.511] -- 0:00:00
Average standard deviation of split frequencies: 0.007569
Analysis completed in 1 mins 2 seconds
Analysis used 60.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -808.08
Likelihood of best state for "cold" chain of run 2 was -808.08
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.2 % ( 20 %) Dirichlet(Pi{all})
30.5 % ( 28 %) Slider(Pi{all})
78.8 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 48 %) Multiplier(Alpha{3})
22.2 % ( 35 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 33 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.9 % ( 30 %) Dirichlet(Pi{all})
30.5 % ( 30 %) Slider(Pi{all})
78.9 % ( 49 %) Multiplier(Alpha{1,2})
78.0 % ( 47 %) Multiplier(Alpha{3})
21.5 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 34 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.3 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166554 0.82 0.67
3 | 166630 167436 0.84
4 | 166414 166647 166319
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166055 0.82 0.67
3 | 166723 166820 0.84
4 | 167232 166702 166468
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -809.68
| 1 |
| 11 1 |
| 2 2 2 1 1 |
| 1 2 2 1 2 |
| 2 2 2 2 2 1 1 2 2 |
| 21 212 2 2 1*1 1 1 * *2 1 12 2|
| 1 1 11 11 * 2 21 2 22 1 1 2 |
|1 22 2*1 12 1 2 1 2 22 2 |
| 1 2 122 1 2 1 22 |
|2 1 1 1 2 1 2 1 1 |
| 21 22 2 1 1 1 1 1 1|
| 1 1 2 2 |
| 2 2 1 2 |
| 1 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -811.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -809.82 -814.56
2 -809.81 -812.48
--------------------------------------
TOTAL -809.81 -813.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900669 0.093693 0.358534 1.497060 0.862070 1342.88 1421.94 1.000
r(A<->C){all} 0.168107 0.020729 0.000013 0.456001 0.127158 170.25 182.37 1.001
r(A<->G){all} 0.175912 0.023381 0.000053 0.486864 0.136073 250.44 270.74 1.002
r(A<->T){all} 0.167529 0.021272 0.000012 0.470234 0.126502 111.34 199.94 1.002
r(C<->G){all} 0.169196 0.019773 0.000027 0.451880 0.132711 263.19 263.34 1.001
r(C<->T){all} 0.158923 0.019191 0.000029 0.431710 0.119310 120.91 222.99 1.002
r(G<->T){all} 0.160332 0.019592 0.000067 0.445592 0.122906 286.44 345.04 1.000
pi(A){all} 0.233151 0.000307 0.200973 0.270001 0.233225 1366.46 1407.24 1.000
pi(C){all} 0.277738 0.000338 0.242309 0.315051 0.277594 1294.68 1357.13 1.000
pi(G){all} 0.338132 0.000378 0.301010 0.375655 0.338012 1149.02 1275.95 1.000
pi(T){all} 0.150979 0.000219 0.121975 0.180428 0.150832 1346.99 1391.12 1.000
alpha{1,2} 0.425309 0.224585 0.000119 1.343620 0.272620 1153.49 1236.76 1.000
alpha{3} 0.460478 0.239876 0.000194 1.434071 0.293661 1265.09 1335.00 1.000
pinvar{all} 0.997507 0.000009 0.992071 0.999998 0.998447 1278.75 1314.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .*.*..
9 -- ..*.*.
10 -- .****.
11 -- .*.***
12 -- ..**..
13 -- ....**
14 -- ..****
15 -- ...*.*
16 -- .**.**
17 -- ...**.
18 -- .**...
19 -- .***.*
20 -- .*..*.
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.002355 0.151899 0.155230 2
8 460 0.153231 0.008480 0.147235 0.159227 2
9 457 0.152232 0.009893 0.145237 0.159227 2
10 455 0.151566 0.002355 0.149900 0.153231 2
11 446 0.148568 0.002827 0.146569 0.150566 2
12 429 0.142905 0.012719 0.133911 0.151899 2
13 427 0.142239 0.005182 0.138574 0.145903 2
14 424 0.141239 0.014133 0.131246 0.151233 2
15 421 0.140240 0.008951 0.133911 0.146569 2
16 421 0.140240 0.008009 0.134577 0.145903 2
17 420 0.139907 0.004711 0.136576 0.143238 2
18 419 0.139574 0.017430 0.127249 0.151899 2
19 417 0.138907 0.008951 0.132578 0.145237 2
20 412 0.137242 0.005653 0.133245 0.141239 2
21 398 0.132578 0.001884 0.131246 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103064 0.010068 0.000013 0.299362 0.072962 1.000 2
length{all}[2] 0.098726 0.010147 0.000007 0.294171 0.068672 1.000 2
length{all}[3] 0.098519 0.010171 0.000019 0.293837 0.067417 1.000 2
length{all}[4] 0.099032 0.009774 0.000011 0.302872 0.069264 1.000 2
length{all}[5] 0.099030 0.009545 0.000045 0.291672 0.069154 1.000 2
length{all}[6] 0.100529 0.010234 0.000002 0.304912 0.069515 1.000 2
length{all}[7] 0.100131 0.012288 0.000177 0.326025 0.064246 0.998 2
length{all}[8] 0.106725 0.012079 0.000169 0.303504 0.072941 0.999 2
length{all}[9] 0.101249 0.011376 0.000036 0.307514 0.068531 0.998 2
length{all}[10] 0.112195 0.010426 0.000648 0.303665 0.084890 0.998 2
length{all}[11] 0.099307 0.010366 0.000125 0.284136 0.067030 1.000 2
length{all}[12] 0.105140 0.010738 0.000628 0.291438 0.075509 0.998 2
length{all}[13] 0.102232 0.010293 0.000051 0.302575 0.064973 0.998 2
length{all}[14] 0.101307 0.010800 0.000704 0.292950 0.068519 1.002 2
length{all}[15] 0.107394 0.010934 0.000410 0.318167 0.072732 0.998 2
length{all}[16] 0.094087 0.008939 0.000110 0.299982 0.063827 0.999 2
length{all}[17] 0.095446 0.008786 0.000204 0.271825 0.063596 0.998 2
length{all}[18] 0.096068 0.009300 0.000314 0.256433 0.072100 0.998 2
length{all}[19] 0.103865 0.011947 0.000199 0.301549 0.067756 1.005 2
length{all}[20] 0.094195 0.008290 0.000040 0.275227 0.070142 0.998 2
length{all}[21] 0.097512 0.009571 0.000108 0.284159 0.067230 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007569
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 600
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 42 patterns at 200 / 200 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 42 patterns at 200 / 200 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40992 bytes for conP
3696 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050359 0.073443 0.084828 0.103298 0.031615 0.014482 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -821.999401
Iterating by ming2
Initial: fx= 821.999401
x= 0.05036 0.07344 0.08483 0.10330 0.03161 0.01448 0.30000 1.30000
1 h-m-p 0.0000 0.0001 477.9881 ++ 805.182216 m 0.0001 13 | 1/8
2 h-m-p 0.0003 0.0016 120.1272 ++ 790.598398 m 0.0016 24 | 2/8
3 h-m-p 0.0001 0.0003 78.7805 ++ 782.412352 m 0.0003 35 | 3/8
4 h-m-p 0.0001 0.0007 135.9481 ++ 768.286657 m 0.0007 46 | 4/8
5 h-m-p 0.0002 0.0009 86.3848 ++ 759.746621 m 0.0009 57 | 5/8
6 h-m-p 0.0000 0.0000 11667.3594 ++ 751.817203 m 0.0000 68 | 6/8
7 h-m-p 1.6000 8.0000 0.0001 ++ 751.817203 m 8.0000 79 | 6/8
8 h-m-p 0.0020 0.9824 0.5638 -----------C 751.817203 0 0.0000 103 | 6/8
9 h-m-p 0.0160 8.0000 0.0001 +++++ 751.817203 m 8.0000 119 | 6/8
10 h-m-p 0.0160 8.0000 0.8147 ++++Y 751.817170 0 4.0960 136 | 6/8
11 h-m-p 1.6000 8.0000 0.0303 ++ 751.817170 m 8.0000 149 | 6/8
12 h-m-p 1.6000 8.0000 0.0004 C 751.817170 0 0.4000 162 | 6/8
13 h-m-p 1.4911 8.0000 0.0001 -------------Y 751.817170 0 0.0000 188
Out..
lnL = -751.817170
189 lfun, 189 eigenQcodon, 1134 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095193 0.021230 0.079696 0.035150 0.064905 0.031149 1.282064 0.768339 0.483189
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.480618
np = 9
lnL0 = -816.863413
Iterating by ming2
Initial: fx= 816.863413
x= 0.09519 0.02123 0.07970 0.03515 0.06490 0.03115 1.28206 0.76834 0.48319
1 h-m-p 0.0000 0.0001 480.6345 ++ 791.906464 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 180.3266 ++ 782.047402 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 5066.4991 ++ 779.016971 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 7764.2768 ++ 761.085111 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 4059.7696 ++ 754.989149 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 2702.2673 ++ 752.284077 m 0.0001 74 | 5/9
7 h-m-p 0.0004 0.0022 483.2591 -----------.. | 5/9
8 h-m-p 0.0000 0.0000 201.1375 ++ 751.817320 m 0.0000 107 | 6/9
9 h-m-p 0.0882 8.0000 0.0000 ++++ 751.817320 m 8.0000 121 | 6/9
10 h-m-p 0.0009 0.0044 0.0043 -Y 751.817320 0 0.0000 137 | 6/9
11 h-m-p 0.0027 0.2844 0.0001 ---C 751.817320 0 0.0000 155 | 6/9
12 h-m-p 0.0160 8.0000 0.0010 +++++ 751.817320 m 8.0000 173 | 6/9
13 h-m-p 0.0496 0.2480 0.0319 --------------.. | 6/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 751.817320 m 8.0000 218 | 6/9
15 h-m-p 0.0040 0.9179 0.3797 ++++ 751.817275 m 0.9179 235 | 7/9
16 h-m-p 1.6000 8.0000 0.0027 ++ 751.817275 m 8.0000 250 | 7/9
17 h-m-p 0.0021 0.0140 10.0317 -------Y 751.817275 0 0.0000 271 | 7/9
18 h-m-p 0.0564 8.0000 0.0000 --Y 751.817275 0 0.0009 285 | 7/9
19 h-m-p 0.0160 8.0000 0.0000 ----------Y 751.817275 0 0.0000 309
Out..
lnL = -751.817275
310 lfun, 930 eigenQcodon, 3720 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105328 0.015991 0.022189 0.058930 0.049707 0.032892 1.261228 1.072193 0.147814 0.477423 5.733574
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.122815
np = 11
lnL0 = -799.806080
Iterating by ming2
Initial: fx= 799.806080
x= 0.10533 0.01599 0.02219 0.05893 0.04971 0.03289 1.26123 1.07219 0.14781 0.47742 5.73357
1 h-m-p 0.0000 0.0001 358.4108 ++ 785.301168 m 0.0001 16 | 1/11
2 h-m-p 0.0008 0.0114 44.0437 ++ 765.293779 m 0.0114 30 | 2/11
3 h-m-p 0.0001 0.0005 38.9147 ++ 764.688745 m 0.0005 44 | 3/11
4 h-m-p 0.0000 0.0002 295.6253 ++ 756.743271 m 0.0002 58 | 4/11
5 h-m-p 0.0013 0.0064 3.7071 ++ 756.663728 m 0.0064 72 | 5/11
6 h-m-p 0.0000 0.0001 241.2605 ++ 754.888203 m 0.0001 86 | 6/11
7 h-m-p 0.0037 0.2702 3.5671 ++++ 751.817280 m 0.2702 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0027 ++ 751.817279 m 8.0000 116 | 7/11
9 h-m-p 0.0081 2.5050 2.7079 +++Y 751.817254 0 1.0773 137 | 7/11
10 h-m-p 1.6000 8.0000 0.3846 Y 751.817253 0 1.2020 151 | 7/11
11 h-m-p 1.6000 8.0000 0.0290 ----C 751.817253 0 0.0016 173 | 7/11
12 h-m-p 0.0160 8.0000 0.0040 ++++Y 751.817253 0 2.8174 195 | 7/11
13 h-m-p 1.6000 8.0000 0.0001 ----------Y 751.817253 0 0.0000 223
Out..
lnL = -751.817253
224 lfun, 896 eigenQcodon, 4032 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -751.820845 S = -751.813741 -0.002716
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:03
did 20 / 42 patterns 0:03
did 30 / 42 patterns 0:03
did 40 / 42 patterns 0:03
did 42 / 42 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020117 0.056199 0.055609 0.098119 0.032701 0.021447 1.334533 0.222251 1.827474
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.508039
np = 9
lnL0 = -809.901149
Iterating by ming2
Initial: fx= 809.901149
x= 0.02012 0.05620 0.05561 0.09812 0.03270 0.02145 1.33453 0.22225 1.82747
1 h-m-p 0.0000 0.0001 488.5879 ++ 785.856535 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 148.0638 ++ 784.631844 m 0.0001 26 | 2/9
3 h-m-p 0.0001 0.0003 120.8740 ++ 773.555099 m 0.0003 38 | 3/9
4 h-m-p 0.0005 0.0024 24.5142 ++ 772.237699 m 0.0024 50 | 4/9
5 h-m-p 0.0000 0.0000 110.4079 ++ 771.834724 m 0.0000 62 | 5/9
6 h-m-p 0.0001 0.0324 25.8990 +++++ 751.817401 m 0.0324 77 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 751.817401 m 8.0000 89 | 6/9
8 h-m-p 0.0055 2.7313 0.7492 ------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 751.817401 m 8.0000 132 | 6/9
10 h-m-p 0.0071 3.5720 0.5725 ++++
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
+ 751.817276 m 3.5720 150
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35948, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35923, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
11 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.85, 2.35907, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35819, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
+ 751.817276 m 8.0000 165
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35802, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35777, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
12 h-m-p 0.0160 8.0000 1.3059
QuantileBeta(0.85, 2.37876, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36311, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35920, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35822, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35798, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35792, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
Y 751.817276 0 0.0000 185
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
13 h-m-p 0.0160 8.0000 0.0007
QuantileBeta(0.85, 2.35791, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35794, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35806, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35855, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36051, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
+ 751.817276 m 8.0000 200
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36313, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36288, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
14 h-m-p 0.0013 0.5963 4.5582
QuantileBeta(0.85, 2.35790, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36173, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36268, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36292, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36298, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
C 751.817276 0 0.0000 222
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
Y 751.817276 0 0.0160 234
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36313, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36288, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
16 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.85, 2.36300, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36299, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36297, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36285, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36241, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
+ 751.817276 m 8.0000 251
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36185, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
17 h-m-p 0.0012 0.5937 3.9823
QuantileBeta(0.85, 2.35713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.34299, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.28643, 0.00500) = 1.000000e+00 2000 rounds
+++Y 751.817275 0 0.3040 269 | 7/9
18 h-m-p 0.0271 0.1357 8.5020 +Y 751.817274 0 0.1086 282 | 7/9
19 h-m-p 0.2182 8.0000 4.2301 -----------Y 751.817274 0 0.0000 305 | 7/9
20 h-m-p 0.1747 8.0000 0.0000 Y 751.817274 0 0.1747 317 | 7/9
21 h-m-p 0.3763 8.0000 0.0000 -C 751.817274 0 0.0235 332
Out..
lnL = -751.817274
333 lfun, 3663 eigenQcodon, 19980 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092243 0.053357 0.037921 0.071399 0.108644 0.020052 1.235655 0.900000 1.137365 1.882042 5.136570
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.207034
np = 11
lnL0 = -812.968192
Iterating by ming2
Initial: fx= 812.968192
x= 0.09224 0.05336 0.03792 0.07140 0.10864 0.02005 1.23566 0.90000 1.13737 1.88204 5.13657
1 h-m-p 0.0000 0.0001 336.7676 ++ 796.037625 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0000 1562.2575 ++ 782.276841 m 0.0000 30 | 2/11
3 h-m-p 0.0000 0.0001 419.8183 ++ 771.583098 m 0.0001 44 | 3/11
4 h-m-p 0.0010 0.0050 49.3351 ++ 757.808105 m 0.0050 58 | 4/11
5 h-m-p 0.0009 0.0043 6.6698 -----------.. | 4/11
6 h-m-p 0.0000 0.0001 268.6830 ++ 753.521040 m 0.0001 95 | 5/11
7 h-m-p 0.0022 0.0834 4.9502 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 194.3849 ++ 751.817206 m 0.0000 133 | 6/11
9 h-m-p 0.0555 8.0000 0.0000 ++++ 751.817206 m 8.0000 149 | 6/11
10 h-m-p 0.0213 8.0000 0.0079 +++++ 751.817205 m 8.0000 171 | 6/11
11 h-m-p 0.1288 4.0703 0.4880 ++Y 751.817197 0 2.6907 192 | 6/11
12 h-m-p 1.6000 8.0000 0.0495 C 751.817197 0 2.4909 211 | 6/11
13 h-m-p 1.6000 8.0000 0.0055 Y 751.817197 0 0.9724 230 | 6/11
14 h-m-p 1.6000 8.0000 0.0003 +Y 751.817197 0 4.5000 250 | 6/11
15 h-m-p 1.6000 8.0000 0.0002 ++ 751.817197 m 8.0000 269 | 6/11
16 h-m-p 0.4144 8.0000 0.0042 ++Y 751.817197 0 4.5518 290 | 6/11
17 h-m-p 1.6000 8.0000 0.0009 ++ 751.817197 m 8.0000 309 | 6/11
18 h-m-p 0.0085 3.7214 0.8113 ++++C 751.817195 0 2.1768 332 | 6/11
19 h-m-p 0.0148 0.0738 17.7091 +C 751.817194 0 0.0591 352 | 6/11
20 h-m-p 0.0421 0.2105 1.4325 ++ 751.817193 m 0.2105 366 | 7/11
21 h-m-p 0.0875 1.3680 2.8642 +
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+ 751.817142 m 1.3680 380
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.984700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647888e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
| 7/11
22 h-m-p -0.0000 -0.0000 4.8411
h-m-p: -5.25914825e-18 -2.62957413e-17 4.84114493e+00 751.817142
..
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.984700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647888e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
| 7/11
23 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+ 751.817142 m 8.0000 408
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61464) = 9.647303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61438) = 9.648488e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
| 7/11
24 h-m-p -0.0000 -0.0000 2.8397
h-m-p: -4.09178496e-13 -2.04589248e-12 2.83972665e+00 751.817142
..
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.984700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647888e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
| 8/11
25 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647897e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
+ 751.817142 m 8.0000 440
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.984703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61464) = 9.647306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61438) = 9.648491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647898e-161 2000 rounds
| 8/11
26 h-m-p 0.0038 1.9080 0.1589
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647900e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61451) = 9.647907e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61450) = 9.647933e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61448) = 9.648038e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61438) = 9.648460e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
+ 751.817126 m 1.9080 460
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.985835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61440) = 9.648399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61413) = 9.649584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61426) = 9.648992e-161 2000 rounds
| 9/11
27 h-m-p 0.3768 8.0000 0.1083
QuantileBeta(0.15, 0.00500, 2.61402) = 9.650086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61329) = 9.653369e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.61036) = 9.666526e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
+ 751.817120 m 8.0000 478
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 1.000992e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60921) = 9.671675e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60895) = 9.672864e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60908) = 9.672269e-161 2000 rounds
| 9/11
28 h-m-p 0.3486 8.0000 2.4863
QuantileBeta(0.15, 0.00500, 2.60390) = 9.695659e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58834) = 9.766505e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.52613) = 1.006046e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
+ 751.817093 m 8.0000 495
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.059630e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023886e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49010) = 1.023887e-160 2000 rounds
| 9/11
29 h-m-p 1.6000 8.0000 1.2315
QuantileBeta(0.15, 0.00500, 2.47832) = 1.029860e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44296) = 1.048200e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
+ 751.817091 m 8.0000 509
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.091269e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054457e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43117) = 1.054458e-160 2000 rounds
| 9/11
30 h-m-p 0.3296 8.0000 29.8870
QuantileBeta(0.15, 0.00500, 2.37224) = 1.086893e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19545) = 1.197230e-160 2000 rounds
+++ 751.817085 m 8.0000 524 | 9/11
31 h-m-p 1.6000 8.0000 1.7786 ++ 751.817085 m 8.0000 538 | 9/11
32 h-m-p 1.1032 8.0000 12.8980 ++ 751.817085 m 8.0000 552 | 9/11
33 h-m-p 0.6554 3.2769 119.3686 -------------Y 751.817085 0 0.0000 579 | 9/11
34 h-m-p 1.6000 8.0000 0.0000 -------Y 751.817085 0 0.0000 600 | 9/11
35 h-m-p 1.6000 8.0000 0.0000 -Y 751.817085 0 0.1000 617
Out..
lnL = -751.817085
618 lfun, 7416 eigenQcodon, 40788 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -751.812530 S = -751.812493 -0.000016
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:19
did 20 / 42 patterns 0:19
did 30 / 42 patterns 0:19
did 40 / 42 patterns 0:19
did 42 / 42 patterns 0:19
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.02 sec, SCORE=100, Nseq=6, Len=200
NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
NC_002677_1_NP_302157_1_1029_ML1683 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
**************************************************
NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
NC_002677_1_NP_302157_1_1029_ML1683 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP
**************************************************
NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
NC_002677_1_NP_302157_1_1029_ML1683 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV
**************************************************
NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
NC_002677_1_NP_302157_1_1029_ML1683 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
**************************************************
>NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG >NC_002677_1_NP_302157_1_1029_ML1683 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG >NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG >NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG >NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG >NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 ATGAACAAAGCAGAGCTCATTGACGTGCTGACACAGAAATTGGGCTCGGA CCGTCGGCAGGCGACCGCTGCCGTCGAGAATGTCGTTGACACCATTGTGC GTGCTGTACACAAGGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTC GAGCAGCGTCGCCGGGCTGCGCGCGTGGCTCGTAACCCCCGTACCGGCGA AACGGTGAAGGTGAAGCCGACGTCCGTCCCGGCGTTTCGTCCGGGTGCGC AATTTAAAGCGGTTGTGGCTGGCGCACAGCGTCTCCCGTTGGAAGGTCCC GCTGTCAAGCGTGGTGTAGCGACCAGCGCTGCCAAGAAGGCAGCGATTAA GAAGGCTCCGGTTAAGAAGGCGCTGGCCAAGAAGGCGGCGACCAAGGCTC CGGCCAAGAAGGCCGTGAAGGCGCCCGCCAAGAAAATCACCACGGCCGTG AAAGTTCCGGCTAAAAAGGCGACAAAAGTGGTCAAGAAGGTCGCCGCCAA GGCTCCGGTACGCAAGGCCACGACCAGGGCGCTGGCCAAGAAGGCAGCGG TGAAGAAGGCTCCTGCCAAGAAGGTTACCGCAGCTAAGCGGGGTCGCAAG
>NC_011896_1_WP_010908478_1_1788_MLBR_RS08475 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK >NC_002677_1_NP_302157_1_1029_ML1683 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK >NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK >NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK >NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK >NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475 MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVAGAQRLPLEGP AVKRGVATSAAKKAAIKKAPVKKALAKKAATKAPAKKAVKAPAKKITTAV KVPAKKATKVVKKVAAKAPVRKATTRALAKKAAVKKAPAKKVTAAKRGRK
#NEXUS
[ID: 5959238239]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908478_1_1788_MLBR_RS08475
NC_002677_1_NP_302157_1_1029_ML1683
NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055
NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385
NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240
NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908478_1_1788_MLBR_RS08475,
2 NC_002677_1_NP_302157_1_1029_ML1683,
3 NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055,
4 NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385,
5 NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240,
6 NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07296229,2:0.06867236,3:0.06741666,4:0.06926372,5:0.06915417,6:0.06951509);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07296229,2:0.06867236,3:0.06741666,4:0.06926372,5:0.06915417,6:0.06951509);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -809.82 -814.56
2 -809.81 -812.48
--------------------------------------
TOTAL -809.81 -813.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1683/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900669 0.093693 0.358534 1.497060 0.862070 1342.88 1421.94 1.000
r(A<->C){all} 0.168107 0.020729 0.000013 0.456001 0.127158 170.25 182.37 1.001
r(A<->G){all} 0.175912 0.023381 0.000053 0.486864 0.136073 250.44 270.74 1.002
r(A<->T){all} 0.167529 0.021272 0.000012 0.470234 0.126502 111.34 199.94 1.002
r(C<->G){all} 0.169196 0.019773 0.000027 0.451880 0.132711 263.19 263.34 1.001
r(C<->T){all} 0.158923 0.019191 0.000029 0.431710 0.119310 120.91 222.99 1.002
r(G<->T){all} 0.160332 0.019592 0.000067 0.445592 0.122906 286.44 345.04 1.000
pi(A){all} 0.233151 0.000307 0.200973 0.270001 0.233225 1366.46 1407.24 1.000
pi(C){all} 0.277738 0.000338 0.242309 0.315051 0.277594 1294.68 1357.13 1.000
pi(G){all} 0.338132 0.000378 0.301010 0.375655 0.338012 1149.02 1275.95 1.000
pi(T){all} 0.150979 0.000219 0.121975 0.180428 0.150832 1346.99 1391.12 1.000
alpha{1,2} 0.425309 0.224585 0.000119 1.343620 0.272620 1153.49 1236.76 1.000
alpha{3} 0.460478 0.239876 0.000194 1.434071 0.293661 1265.09 1335.00 1.000
pinvar{all} 0.997507 0.000009 0.992071 0.999998 0.998447 1278.75 1314.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1683/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 200
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 8 8 8 8 8 8
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 4 4
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 8 8 8 8 8 8 | CAG 4 4 4 4 4 4 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 10 10 10 10 10 10 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 7 7 7 7 7 7 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 4 4 4 4 4 4 | AAG 30 30 30 30 30 30 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 13 13 13 13 13 13 | Asp GAT 0 0 0 0 0 0 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 12 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 0 0 0 0 0 0
GTG 11 11 11 11 11 11 | GCG 14 14 14 14 14 14 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908478_1_1788_MLBR_RS08475
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
#2: NC_002677_1_NP_302157_1_1029_ML1683
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
#3: NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
#4: NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
#5: NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
#6: NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 48
CTC 12 | CCC 18 | CAC 6 | CGC 24
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 18 | CCG 48 | CAG 24 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 6 | ACC 60 | AAC 12 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 42 | Arg R AGA 0
Met M ATG 6 | ACG 24 | AAG 180 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 78 | Asp D GAT 0 | Gly G GGT 30
GTC 42 | GCC 72 | GAC 24 | GGC 24
GTA 18 | GCA 30 | Glu E GAA 12 | GGA 0
GTG 66 | GCG 84 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.04000 C:0.19000 A:0.32500 G:0.44500
position 2: T:0.21500 C:0.37000 A:0.27500 G:0.14000
position 3: T:0.19500 C:0.27500 A:0.10000 G:0.43000
Average T:0.15000 C:0.27833 A:0.23333 G:0.33833
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -751.817170 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.282064 5.136570
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908478_1_1788_MLBR_RS08475: 0.000004, NC_002677_1_NP_302157_1_1029_ML1683: 0.000004, NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055: 0.000004, NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385: 0.000004, NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240: 0.000004, NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.28206
omega (dN/dS) = 5.13657
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
7..2 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
7..3 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
7..4 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
7..5 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
7..6 0.000 447.4 152.6 5.1366 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -751.817275 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.261228 0.000010 0.139629
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908478_1_1788_MLBR_RS08475: 0.000004, NC_002677_1_NP_302157_1_1029_ML1683: 0.000004, NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055: 0.000004, NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385: 0.000004, NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240: 0.000004, NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.26123
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.13963 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 447.4 152.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -751.817253 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.334533 0.398230 0.411213 0.000001 4.449971
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908478_1_1788_MLBR_RS08475: 0.000004, NC_002677_1_NP_302157_1_1029_ML1683: 0.000004, NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055: 0.000004, NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385: 0.000004, NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240: 0.000004, NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.33453
MLEs of dN/dS (w) for site classes (K=3)
p: 0.39823 0.41121 0.19056
w: 0.00000 1.00000 4.44997
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
7..2 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
7..3 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
7..4 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
7..5 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
7..6 0.000 447.3 152.7 1.2592 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908478_1_1788_MLBR_RS08475)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908478_1_1788_MLBR_RS08475)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -751.817274 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.235655 0.235028 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908478_1_1788_MLBR_RS08475: 0.000004, NC_002677_1_NP_302157_1_1029_ML1683: 0.000004, NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055: 0.000004, NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385: 0.000004, NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240: 0.000004, NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.23566
Parameters in M7 (beta):
p = 0.23503 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99831 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
7..2 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
7..3 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
7..4 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
7..5 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
7..6 0.000 447.4 152.6 0.9998 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -751.817085 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.298677 392.152923
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908478_1_1788_MLBR_RS08475: 0.000004, NC_002677_1_NP_302157_1_1029_ML1683: 0.000004, NZ_LVXE01000025_1_WP_010908478_1_1040_A3216_RS08055: 0.000004, NZ_LYPH01000028_1_WP_010908478_1_1122_A8144_RS05385: 0.000004, NZ_CP029543_1_WP_010908478_1_1816_DIJ64_RS09240: 0.000004, NZ_AP014567_1_WP_010908478_1_1863_JK2ML_RS09475: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.29868
(p1 = 0.99999) w = 392.15292
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00065 392.15292
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
7..2 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
7..3 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
7..4 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
7..5 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
7..6 0.000 450.3 149.7 392.1490 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908478_1_1788_MLBR_RS08475)
Pr(w>1) post mean +- SE for w
1 M 1.000** 392.149
2 N 1.000** 392.149
3 K 1.000** 392.149
4 A 1.000** 392.149
5 E 1.000** 392.149
6 L 1.000** 392.149
7 I 1.000** 392.149
8 D 1.000** 392.149
9 V 1.000** 392.149
10 L 1.000** 392.149
11 T 1.000** 392.149
12 Q 1.000** 392.149
13 K 1.000** 392.149
14 L 1.000** 392.149
15 G 1.000** 392.149
16 S 1.000** 392.149
17 D 1.000** 392.149
18 R 1.000** 392.149
19 R 1.000** 392.149
20 Q 1.000** 392.149
21 A 1.000** 392.149
22 T 1.000** 392.149
23 A 1.000** 392.149
24 A 1.000** 392.149
25 V 1.000** 392.149
26 E 1.000** 392.149
27 N 1.000** 392.149
28 V 1.000** 392.149
29 V 1.000** 392.149
30 D 1.000** 392.149
31 T 1.000** 392.149
32 I 1.000** 392.149
33 V 1.000** 392.149
34 R 1.000** 392.149
35 A 1.000** 392.149
36 V 1.000** 392.149
37 H 1.000** 392.149
38 K 1.000** 392.149
39 G 1.000** 392.149
40 D 1.000** 392.149
41 S 1.000** 392.149
42 V 1.000** 392.149
43 T 1.000** 392.149
44 I 1.000** 392.149
45 T 1.000** 392.149
46 G 1.000** 392.149
47 F 1.000** 392.149
48 G 1.000** 392.149
49 V 1.000** 392.149
50 F 1.000** 392.149
51 E 1.000** 392.149
52 Q 1.000** 392.149
53 R 1.000** 392.149
54 R 1.000** 392.149
55 R 1.000** 392.149
56 A 1.000** 392.149
57 A 1.000** 392.149
58 R 1.000** 392.149
59 V 1.000** 392.149
60 A 1.000** 392.149
61 R 1.000** 392.149
62 N 1.000** 392.149
63 P 1.000** 392.149
64 R 1.000** 392.149
65 T 1.000** 392.149
66 G 1.000** 392.149
67 E 1.000** 392.149
68 T 1.000** 392.149
69 V 1.000** 392.149
70 K 1.000** 392.149
71 V 1.000** 392.149
72 K 1.000** 392.149
73 P 1.000** 392.149
74 T 1.000** 392.149
75 S 1.000** 392.149
76 V 1.000** 392.149
77 P 1.000** 392.149
78 A 1.000** 392.149
79 F 1.000** 392.149
80 R 1.000** 392.149
81 P 1.000** 392.149
82 G 1.000** 392.149
83 A 1.000** 392.149
84 Q 1.000** 392.149
85 F 1.000** 392.149
86 K 1.000** 392.149
87 A 1.000** 392.149
88 V 1.000** 392.149
89 V 1.000** 392.149
90 A 1.000** 392.149
91 G 1.000** 392.149
92 A 1.000** 392.149
93 Q 1.000** 392.149
94 R 1.000** 392.149
95 L 1.000** 392.149
96 P 1.000** 392.149
97 L 1.000** 392.149
98 E 1.000** 392.149
99 G 1.000** 392.149
100 P 1.000** 392.149
101 A 1.000** 392.149
102 V 1.000** 392.149
103 K 1.000** 392.149
104 R 1.000** 392.149
105 G 1.000** 392.149
106 V 1.000** 392.149
107 A 1.000** 392.149
108 T 1.000** 392.149
109 S 1.000** 392.149
110 A 1.000** 392.149
111 A 1.000** 392.149
112 K 1.000** 392.149
113 K 1.000** 392.149
114 A 1.000** 392.149
115 A 1.000** 392.149
116 I 1.000** 392.149
117 K 1.000** 392.149
118 K 1.000** 392.149
119 A 1.000** 392.149
120 P 1.000** 392.149
121 V 1.000** 392.149
122 K 1.000** 392.149
123 K 1.000** 392.149
124 A 1.000** 392.149
125 L 1.000** 392.149
126 A 1.000** 392.149
127 K 1.000** 392.149
128 K 1.000** 392.149
129 A 1.000** 392.149
130 A 1.000** 392.149
131 T 1.000** 392.149
132 K 1.000** 392.149
133 A 1.000** 392.149
134 P 1.000** 392.149
135 A 1.000** 392.149
136 K 1.000** 392.149
137 K 1.000** 392.149
138 A 1.000** 392.149
139 V 1.000** 392.149
140 K 1.000** 392.149
141 A 1.000** 392.149
142 P 1.000** 392.149
143 A 1.000** 392.149
144 K 1.000** 392.149
145 K 1.000** 392.149
146 I 1.000** 392.149
147 T 1.000** 392.149
148 T 1.000** 392.149
149 A 1.000** 392.149
150 V 1.000** 392.149
151 K 1.000** 392.149
152 V 1.000** 392.149
153 P 1.000** 392.149
154 A 1.000** 392.149
155 K 1.000** 392.149
156 K 1.000** 392.149
157 A 1.000** 392.149
158 T 1.000** 392.149
159 K 1.000** 392.149
160 V 1.000** 392.149
161 V 1.000** 392.149
162 K 1.000** 392.149
163 K 1.000** 392.149
164 V 1.000** 392.149
165 A 1.000** 392.149
166 A 1.000** 392.149
167 K 1.000** 392.149
168 A 1.000** 392.149
169 P 1.000** 392.149
170 V 1.000** 392.149
171 R 1.000** 392.149
172 K 1.000** 392.149
173 A 1.000** 392.149
174 T 1.000** 392.149
175 T 1.000** 392.149
176 R 1.000** 392.149
177 A 1.000** 392.149
178 L 1.000** 392.149
179 A 1.000** 392.149
180 K 1.000** 392.149
181 K 1.000** 392.149
182 A 1.000** 392.149
183 A 1.000** 392.149
184 V 1.000** 392.149
185 K 1.000** 392.149
186 K 1.000** 392.149
187 A 1.000** 392.149
188 P 1.000** 392.149
189 A 1.000** 392.149
190 K 1.000** 392.149
191 K 1.000** 392.149
192 V 1.000** 392.149
193 T 1.000** 392.149
194 A 1.000** 392.149
195 A 1.000** 392.149
196 K 1.000** 392.149
197 R 1.000** 392.149
198 G 1.000** 392.149
199 R 1.000** 392.149
200 K 1.000** 392.149
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908478_1_1788_MLBR_RS08475)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:20
Model 1: NearlyNeutral -751.817275 Model 2: PositiveSelection -751.817253 Model 0: one-ratio -751.81717 Model 7: beta -751.817274 Model 8: beta&w>1 -751.817085 Model 0 vs 1 2.0999999992454832E-4 Model 2 vs 1 4.399999988891068E-5 Model 8 vs 7 3.7799999995513645E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
