--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:23:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1689/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1106.60 -1109.71
2 -1106.62 -1110.25
--------------------------------------
TOTAL -1106.61 -1110.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902344 0.091309 0.366325 1.506009 0.867860 1501.00 1501.00 1.000
r(A<->C){all} 0.156995 0.021234 0.000137 0.449806 0.115081 155.26 177.79 1.000
r(A<->G){all} 0.163070 0.020509 0.000001 0.454809 0.121956 134.81 155.01 1.008
r(A<->T){all} 0.176163 0.021032 0.000077 0.473190 0.138721 172.04 209.19 1.000
r(C<->G){all} 0.179897 0.023169 0.000019 0.493524 0.136077 117.66 145.14 1.013
r(C<->T){all} 0.166473 0.020390 0.000065 0.457806 0.127109 243.42 243.47 1.000
r(G<->T){all} 0.157404 0.019185 0.000016 0.433750 0.120092 199.10 233.78 1.000
pi(A){all} 0.210563 0.000196 0.182713 0.237316 0.210304 1147.97 1324.49 1.000
pi(C){all} 0.293083 0.000243 0.261543 0.323617 0.292994 1298.20 1331.63 1.000
pi(G){all} 0.283488 0.000232 0.253127 0.311714 0.283530 1149.31 1325.15 1.000
pi(T){all} 0.212866 0.000213 0.183851 0.240751 0.212429 1481.91 1484.28 1.000
alpha{1,2} 0.432584 0.242686 0.000191 1.407645 0.260065 1268.24 1367.71 1.000
alpha{3} 0.477940 0.252583 0.000206 1.478824 0.322442 868.70 1053.03 1.001
pinvar{all} 0.998156 0.000005 0.994038 1.000000 0.998873 1084.59 1093.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -967.253298
Model 2: PositiveSelection -967.253298
Model 0: one-ratio -967.253643
Model 7: beta -967.253298
Model 8: beta&w>1 -967.253405
Model 0 vs 1 6.900000000769069E-4
Model 2 vs 1 0.0
Model 8 vs 7 2.1400000014182297E-4
>C1
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C2
MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKSoooooooo
oooooooooooooooooo
>C3
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C4
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C5
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C6
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=294
C1 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
C2 --------------------------MFARELAEYPFGELTFTGRSWPLA
C3 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
C4 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
C5 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
C6 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
************************
C1 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
C2 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
C3 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
C4 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
C5 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
C6 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
**************************************************
C1 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
C2 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
C3 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
C4 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
C5 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
C6 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
**************************************************
C1 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
C2 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
C3 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
C4 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
C5 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
C6 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
**************************************************
C1 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
C2 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
C3 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
C4 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
C5 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
C6 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
**************************************************
C1 TVEGIGTLTNPVVRKGKS--------------------------
C2 TVEGIGTLTNPVVRKGKSoooooooooooooooooooooooooo
C3 TVEGIGTLTNPVVRKGKS--------------------------
C4 TVEGIGTLTNPVVRKGKS--------------------------
C5 TVEGIGTLTNPVVRKGKS--------------------------
C6 TVEGIGTLTNPVVRKGKS--------------------------
******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8310]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8310]--->[8190]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.831 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
C2 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
C3 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
C4 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
C5 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
C6 MFARELAEYPFGELTFTGRSWPLADVRLLAPMLASKVVCIGKNYADHIVE
**************************************************
C1 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
C2 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
C3 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
C4 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
C5 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
C6 MGGQTGLASADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELALVVGR
**************************************************
C1 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
C2 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
C3 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
C4 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
C5 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
C6 SCKDVPAVQAVDCILGYTIGNDMSARDQQRADGQWTRAKGHDTFCPVGPW
**************************************************
C1 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
C2 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
C3 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
C4 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
C5 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
C6 IVTDLGPLDPADLELRTAVNGEVKQHSRTSLMIHGIGAIMEWISAVMTLL
**************************************************
C1 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
C2 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
C3 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
C4 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
C5 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
C6 PGDLILTGTPAGVGPVEDGDIVSITVEGIGTLTNPVVRKGKS
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
C2 --------------------------------------------------
C3 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
C4 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
C5 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
C6 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
C1 CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
C2 ----------------------------ATGTTTGCCCGTGAGCTCGCTG
C3 CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
C4 CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
C5 CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
C6 CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
**********************
C1 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
C2 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
C3 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
C4 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
C5 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
C6 AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
**************************************************
C1 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
C2 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
C3 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
C4 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
C5 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
C6 GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
**************************************************
C1 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
C2 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
C3 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
C4 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
C5 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
C6 TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
**************************************************
C1 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
C2 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
C3 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
C4 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
C5 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
C6 CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
**************************************************
C1 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
C2 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
C3 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
C4 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
C5 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
C6 CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
**************************************************
C1 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
C2 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
C3 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
C4 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
C5 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
C6 GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
**************************************************
C1 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
C2 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
C3 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
C4 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
C5 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
C6 TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
**************************************************
C1 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
C2 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
C3 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
C4 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
C5 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
C6 GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
**************************************************
C1 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
C2 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
C3 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
C4 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
C5 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
C6 TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
**************************************************
C1 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
C2 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
C3 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
C4 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
C5 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
C6 TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
**************************************************
C1 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
C2 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
C3 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
C4 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
C5 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
C6 CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
**************************************************
C1 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
C2 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
C3 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
C4 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
C5 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
C6 GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
**************************************************
C1 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
C2 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
C3 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
C4 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
C5 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
C6 GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
**************************************************
C1 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
C2 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
C3 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
C4 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
C5 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
C6 ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
**************************************************
C1 GTCG----------------------------------------------
C2 GTCG----------------------------------------------
C3 GTCG----------------------------------------------
C4 GTCG----------------------------------------------
C5 GTCG----------------------------------------------
C6 GTCG----------------------------------------------
****
C1 --------------------------------
C2 --------------------------------
C3 --------------------------------
C4 --------------------------------
C5 --------------------------------
C6 --------------------------------
>C1
ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C2
--------------------------------------------------
----------------------------ATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C3
ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C4
ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C5
ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C6
ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT
CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG
AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC
GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG
TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG
CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG
CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA
GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG
TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG
GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA
TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC
TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA
CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA
GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG
GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC
ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA
GTCG----------------------------------------------
--------------------------------
>C1
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C2
ooooooooooooooooooooooooooMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C3
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C4
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C5
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
>C6
MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
TVEGIGTLTNPVVRKGKS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 882 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857670
Setting output file names to "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1382259086
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5477397897
Seed = 898758188
Swapseed = 1579857670
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 9 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1791.967438 -- -24.965149
Chain 2 -- -1791.957191 -- -24.965149
Chain 3 -- -1791.957191 -- -24.965149
Chain 4 -- -1791.967438 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1791.968169 -- -24.965149
Chain 2 -- -1791.968063 -- -24.965149
Chain 3 -- -1791.968063 -- -24.965149
Chain 4 -- -1791.967438 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1791.967] (-1791.957) (-1791.957) (-1791.967) * [-1791.968] (-1791.968) (-1791.968) (-1791.967)
500 -- (-1123.499) (-1120.788) [-1113.403] (-1120.398) * (-1113.832) (-1123.454) [-1114.786] (-1118.498) -- 0:00:00
1000 -- (-1124.154) (-1114.999) [-1113.196] (-1115.787) * [-1112.568] (-1123.184) (-1122.020) (-1117.060) -- 0:00:00
1500 -- (-1117.017) [-1116.660] (-1119.216) (-1116.817) * (-1118.379) [-1114.693] (-1113.499) (-1121.771) -- 0:00:00
2000 -- (-1111.656) [-1117.955] (-1114.852) (-1125.398) * (-1118.072) (-1121.580) [-1117.842] (-1114.792) -- 0:00:00
2500 -- (-1112.849) [-1116.714] (-1112.804) (-1118.123) * (-1111.956) (-1111.701) (-1115.854) [-1117.323] -- 0:00:00
3000 -- (-1115.549) [-1115.679] (-1118.279) (-1116.190) * [-1113.131] (-1122.065) (-1126.698) (-1113.843) -- 0:00:00
3500 -- (-1115.614) (-1119.787) [-1116.524] (-1116.354) * (-1112.948) [-1113.409] (-1118.334) (-1116.080) -- 0:00:00
4000 -- [-1111.168] (-1120.190) (-1116.384) (-1125.518) * (-1113.060) (-1116.281) [-1111.372] (-1115.137) -- 0:00:00
4500 -- (-1113.888) [-1115.090] (-1120.721) (-1120.895) * (-1118.548) (-1113.188) [-1118.831] (-1122.634) -- 0:00:00
5000 -- (-1112.736) (-1114.611) (-1121.613) [-1118.851] * [-1113.093] (-1125.170) (-1119.090) (-1114.974) -- 0:00:00
Average standard deviation of split frequencies: 0.094281
5500 -- [-1114.841] (-1121.779) (-1121.425) (-1122.142) * [-1116.559] (-1128.421) (-1118.871) (-1124.303) -- 0:00:00
6000 -- (-1125.045) (-1124.927) (-1119.137) [-1117.382] * [-1114.236] (-1112.164) (-1120.327) (-1121.263) -- 0:00:00
6500 -- (-1113.968) [-1113.300] (-1114.533) (-1116.398) * [-1112.743] (-1116.038) (-1120.511) (-1115.503) -- 0:00:00
7000 -- (-1118.659) (-1116.840) (-1116.651) [-1118.830] * (-1122.831) (-1112.279) [-1117.552] (-1114.437) -- 0:00:00
7500 -- (-1112.299) (-1116.987) [-1114.877] (-1114.401) * [-1120.961] (-1123.084) (-1113.691) (-1114.905) -- 0:00:00
8000 -- [-1114.364] (-1112.599) (-1117.288) (-1121.424) * [-1111.287] (-1117.073) (-1120.333) (-1116.388) -- 0:00:00
8500 -- (-1119.418) (-1119.583) [-1112.749] (-1125.013) * (-1118.418) (-1115.412) [-1112.218] (-1116.087) -- 0:00:00
9000 -- (-1115.743) (-1125.304) (-1127.519) [-1117.390] * (-1119.293) (-1114.500) [-1112.334] (-1114.385) -- 0:00:00
9500 -- (-1114.779) (-1112.331) (-1116.168) [-1116.104] * (-1113.175) (-1118.571) [-1110.849] (-1119.965) -- 0:00:00
10000 -- (-1115.263) (-1114.415) (-1115.307) [-1112.315] * (-1115.644) (-1117.510) (-1116.572) [-1111.930] -- 0:01:39
Average standard deviation of split frequencies: 0.102344
10500 -- (-1123.309) (-1117.739) [-1111.299] (-1123.236) * (-1112.049) [-1118.986] (-1112.931) (-1116.252) -- 0:01:34
11000 -- (-1116.691) (-1118.149) (-1124.715) [-1111.277] * (-1119.865) (-1121.726) (-1125.753) [-1115.658] -- 0:01:29
11500 -- (-1119.976) [-1114.021] (-1111.971) (-1113.295) * [-1109.758] (-1111.322) (-1114.071) (-1111.730) -- 0:01:25
12000 -- (-1120.327) [-1112.624] (-1114.725) (-1120.480) * (-1114.372) [-1110.436] (-1118.108) (-1113.316) -- 0:01:22
12500 -- (-1120.278) (-1118.665) (-1120.630) [-1112.361] * [-1119.808] (-1114.167) (-1111.039) (-1112.669) -- 0:01:19
13000 -- [-1115.160] (-1113.202) (-1115.216) (-1109.601) * (-1115.635) (-1116.526) [-1112.782] (-1119.510) -- 0:01:15
13500 -- [-1113.495] (-1115.106) (-1121.565) (-1121.502) * [-1116.680] (-1120.467) (-1117.610) (-1116.793) -- 0:01:13
14000 -- (-1117.227) (-1116.323) (-1113.148) [-1115.698] * (-1125.834) (-1113.024) (-1116.800) [-1111.640] -- 0:01:10
14500 -- (-1112.174) [-1116.258] (-1115.313) (-1111.165) * (-1115.151) [-1111.997] (-1121.514) (-1114.183) -- 0:01:07
15000 -- (-1119.683) (-1112.996) (-1114.733) [-1112.464] * (-1119.621) (-1119.858) [-1113.658] (-1121.381) -- 0:01:05
Average standard deviation of split frequencies: 0.057375
15500 -- (-1122.486) (-1115.687) (-1118.296) [-1115.478] * (-1113.614) (-1113.953) [-1111.923] (-1120.522) -- 0:01:03
16000 -- (-1110.743) [-1114.638] (-1116.536) (-1118.365) * (-1122.531) (-1110.183) [-1109.482] (-1124.479) -- 0:01:01
16500 -- (-1122.781) (-1122.318) [-1122.360] (-1118.413) * (-1117.945) (-1116.912) (-1120.618) [-1115.237] -- 0:00:59
17000 -- (-1118.133) (-1116.484) (-1117.418) [-1112.157] * (-1122.227) (-1117.040) [-1120.612] (-1111.319) -- 0:00:57
17500 -- (-1119.145) (-1115.579) [-1116.151] (-1118.088) * [-1111.552] (-1112.374) (-1122.924) (-1115.891) -- 0:00:56
18000 -- [-1115.659] (-1118.241) (-1109.671) (-1113.514) * (-1112.688) [-1114.230] (-1112.012) (-1123.165) -- 0:00:54
18500 -- (-1117.685) (-1123.119) (-1111.051) [-1110.845] * (-1116.458) (-1117.215) [-1117.359] (-1117.906) -- 0:00:53
19000 -- (-1111.784) [-1112.126] (-1112.552) (-1126.133) * (-1122.512) [-1114.184] (-1113.171) (-1116.650) -- 0:00:51
19500 -- (-1119.253) (-1121.375) (-1112.200) [-1115.560] * (-1116.431) [-1114.607] (-1124.655) (-1113.466) -- 0:00:50
20000 -- (-1120.140) [-1116.356] (-1107.216) (-1114.762) * (-1121.586) (-1114.822) [-1117.857] (-1117.012) -- 0:00:49
Average standard deviation of split frequencies: 0.067162
20500 -- [-1113.660] (-1117.485) (-1105.817) (-1119.653) * [-1112.938] (-1116.566) (-1116.102) (-1113.178) -- 0:00:47
21000 -- (-1120.577) (-1133.081) (-1106.893) [-1112.553] * (-1117.034) (-1123.831) [-1116.052] (-1109.190) -- 0:01:33
21500 -- (-1124.795) [-1118.440] (-1105.574) (-1119.732) * (-1126.742) (-1121.892) [-1115.463] (-1112.651) -- 0:01:31
22000 -- (-1118.425) (-1114.052) [-1106.489] (-1119.326) * (-1113.445) [-1111.767] (-1116.397) (-1114.384) -- 0:01:28
22500 -- [-1112.350] (-1118.523) (-1106.838) (-1120.683) * (-1118.941) [-1120.466] (-1119.797) (-1120.340) -- 0:01:26
23000 -- [-1114.386] (-1120.373) (-1106.459) (-1121.259) * [-1110.206] (-1116.604) (-1120.093) (-1118.367) -- 0:01:24
23500 -- (-1112.128) (-1128.113) (-1107.149) [-1116.391] * (-1123.050) [-1122.254] (-1121.589) (-1115.683) -- 0:01:23
24000 -- (-1114.027) (-1133.800) (-1107.953) [-1112.657] * [-1119.299] (-1117.645) (-1114.733) (-1122.957) -- 0:01:21
24500 -- [-1115.607] (-1117.999) (-1110.233) (-1123.072) * [-1113.579] (-1115.220) (-1119.904) (-1143.592) -- 0:01:19
25000 -- (-1116.027) [-1111.339] (-1106.970) (-1116.506) * [-1113.172] (-1112.751) (-1116.702) (-1116.951) -- 0:01:18
Average standard deviation of split frequencies: 0.042608
25500 -- [-1119.106] (-1105.706) (-1111.347) (-1113.623) * [-1115.097] (-1114.899) (-1117.984) (-1119.968) -- 0:01:16
26000 -- [-1113.816] (-1107.780) (-1107.612) (-1121.581) * (-1121.462) (-1126.185) [-1113.568] (-1105.698) -- 0:01:14
26500 -- (-1120.314) (-1110.105) (-1108.147) [-1121.957] * [-1115.493] (-1118.849) (-1116.646) (-1106.193) -- 0:01:13
27000 -- (-1118.382) (-1106.902) [-1107.543] (-1123.604) * (-1118.816) (-1124.247) [-1117.948] (-1107.260) -- 0:01:12
27500 -- (-1116.508) [-1106.248] (-1109.809) (-1119.680) * (-1115.948) (-1125.882) [-1114.370] (-1106.215) -- 0:01:10
28000 -- (-1112.079) (-1107.211) [-1107.552] (-1113.651) * [-1120.038] (-1117.519) (-1112.132) (-1108.245) -- 0:01:09
28500 -- (-1122.392) (-1107.720) [-1108.646] (-1120.038) * (-1117.084) (-1124.290) (-1113.940) [-1108.395] -- 0:01:08
29000 -- [-1117.518] (-1107.203) (-1105.965) (-1113.994) * (-1118.079) (-1119.682) (-1113.551) [-1106.511] -- 0:01:06
29500 -- (-1138.416) (-1106.944) [-1105.541] (-1111.482) * (-1127.914) [-1114.146] (-1120.714) (-1106.707) -- 0:01:05
30000 -- (-1106.843) (-1107.974) (-1107.078) [-1111.430] * (-1122.290) [-1112.345] (-1120.181) (-1105.287) -- 0:01:04
Average standard deviation of split frequencies: 0.044408
30500 -- (-1114.185) (-1106.232) (-1107.048) [-1111.886] * [-1119.459] (-1115.340) (-1121.636) (-1105.916) -- 0:01:03
31000 -- (-1113.131) (-1111.019) (-1106.334) [-1119.611] * (-1120.295) [-1115.217] (-1125.374) (-1107.748) -- 0:01:02
31500 -- [-1108.491] (-1111.029) (-1108.090) (-1122.899) * (-1118.214) (-1114.507) [-1118.238] (-1105.794) -- 0:01:01
32000 -- (-1108.571) (-1108.884) [-1107.196] (-1112.380) * [-1118.791] (-1114.484) (-1119.672) (-1107.843) -- 0:01:30
32500 -- (-1107.894) [-1106.686] (-1106.621) (-1115.678) * (-1115.802) (-1112.727) [-1116.198] (-1107.194) -- 0:01:29
33000 -- [-1107.296] (-1107.461) (-1108.943) (-1113.173) * (-1117.823) (-1115.556) [-1114.958] (-1107.919) -- 0:01:27
33500 -- [-1106.919] (-1106.560) (-1107.156) (-1119.595) * [-1115.705] (-1129.756) (-1106.056) (-1106.809) -- 0:01:26
34000 -- (-1107.954) (-1107.129) [-1105.743] (-1124.167) * (-1115.436) (-1116.284) [-1106.106] (-1107.070) -- 0:01:25
34500 -- [-1107.104] (-1106.952) (-1106.540) (-1123.236) * (-1117.022) (-1118.068) (-1108.327) [-1110.051] -- 0:01:23
35000 -- [-1106.951] (-1107.377) (-1106.548) (-1116.200) * (-1123.191) [-1122.469] (-1106.405) (-1110.063) -- 0:01:22
Average standard deviation of split frequencies: 0.046558
35500 -- (-1106.932) [-1105.239] (-1108.292) (-1119.561) * (-1122.776) (-1116.386) (-1106.007) [-1111.002] -- 0:01:21
36000 -- (-1105.298) [-1105.649] (-1107.426) (-1118.891) * (-1115.471) (-1108.619) (-1109.280) [-1105.425] -- 0:01:20
36500 -- (-1106.485) [-1107.476] (-1107.181) (-1113.173) * [-1111.433] (-1113.074) (-1106.887) (-1106.580) -- 0:01:19
37000 -- (-1108.089) (-1105.884) (-1106.875) [-1118.425] * (-1120.520) [-1115.052] (-1107.054) (-1110.680) -- 0:01:18
37500 -- (-1106.225) [-1105.661] (-1108.103) (-1113.101) * (-1124.438) [-1120.144] (-1108.798) (-1109.103) -- 0:01:17
38000 -- (-1108.111) (-1106.451) [-1108.829] (-1116.014) * (-1118.649) (-1119.104) [-1108.790] (-1107.967) -- 0:01:15
38500 -- (-1108.539) (-1107.490) (-1106.402) [-1116.939] * (-1113.183) (-1116.369) (-1108.902) [-1108.411] -- 0:01:14
39000 -- (-1108.537) (-1110.196) [-1105.448] (-1131.071) * (-1114.630) [-1109.841] (-1108.675) (-1109.791) -- 0:01:13
39500 -- (-1106.653) [-1110.449] (-1116.208) (-1113.259) * (-1122.187) [-1116.161] (-1111.016) (-1106.165) -- 0:01:12
40000 -- (-1106.971) (-1110.212) (-1116.208) [-1120.167] * (-1112.986) (-1120.322) (-1112.176) [-1105.880] -- 0:01:12
Average standard deviation of split frequencies: 0.043148
40500 -- (-1107.667) (-1109.029) [-1116.056] (-1120.420) * (-1114.596) (-1112.891) (-1112.299) [-1105.249] -- 0:01:11
41000 -- [-1108.670] (-1108.546) (-1110.754) (-1115.841) * [-1113.026] (-1119.356) (-1107.409) (-1117.590) -- 0:01:10
41500 -- (-1106.602) (-1108.847) (-1109.630) [-1117.055] * (-1115.286) [-1110.797] (-1106.671) (-1109.276) -- 0:01:32
42000 -- (-1105.608) (-1108.166) [-1105.883] (-1115.871) * (-1112.398) (-1115.267) [-1106.192] (-1106.439) -- 0:01:31
42500 -- (-1107.677) (-1110.650) [-1105.881] (-1123.883) * (-1121.972) (-1119.708) [-1109.219] (-1106.675) -- 0:01:30
43000 -- (-1107.460) [-1106.971] (-1109.305) (-1120.097) * (-1119.786) [-1118.127] (-1111.415) (-1107.945) -- 0:01:29
43500 -- (-1107.288) [-1109.362] (-1109.604) (-1113.714) * (-1113.024) (-1116.409) [-1108.543] (-1106.031) -- 0:01:27
44000 -- (-1111.291) [-1115.154] (-1106.480) (-1120.897) * (-1113.737) (-1120.894) (-1106.804) [-1107.581] -- 0:01:26
44500 -- (-1107.046) (-1109.223) [-1106.747] (-1121.686) * (-1114.876) [-1121.203] (-1106.581) (-1107.917) -- 0:01:25
45000 -- (-1109.137) (-1109.574) (-1105.617) [-1114.421] * (-1116.093) (-1112.958) (-1110.807) [-1106.973] -- 0:01:24
Average standard deviation of split frequencies: 0.034843
45500 -- (-1107.246) (-1108.844) (-1106.222) [-1118.344] * [-1114.155] (-1115.073) (-1108.681) (-1107.268) -- 0:01:23
46000 -- (-1109.236) [-1106.967] (-1108.977) (-1113.088) * (-1113.663) (-1112.459) [-1112.156] (-1107.285) -- 0:01:22
46500 -- (-1107.055) (-1106.192) [-1108.565] (-1115.369) * (-1118.747) [-1118.244] (-1112.058) (-1107.369) -- 0:01:22
47000 -- (-1108.077) [-1107.804] (-1107.422) (-1113.659) * (-1123.167) [-1115.555] (-1108.131) (-1106.474) -- 0:01:21
47500 -- [-1107.807] (-1106.581) (-1106.343) (-1114.174) * [-1115.862] (-1118.172) (-1111.312) (-1106.436) -- 0:01:20
48000 -- (-1105.857) (-1109.117) [-1106.430] (-1113.491) * [-1116.785] (-1121.688) (-1109.336) (-1110.632) -- 0:01:19
48500 -- [-1106.521] (-1110.937) (-1109.878) (-1112.409) * (-1124.090) [-1115.359] (-1108.153) (-1107.236) -- 0:01:18
49000 -- (-1110.308) (-1107.448) (-1108.855) [-1122.933] * [-1115.625] (-1120.818) (-1106.580) (-1105.657) -- 0:01:17
49500 -- (-1108.663) [-1112.274] (-1106.821) (-1118.602) * (-1121.824) [-1116.704] (-1107.215) (-1109.733) -- 0:01:16
50000 -- (-1108.851) [-1107.083] (-1106.321) (-1123.173) * [-1117.355] (-1118.303) (-1109.446) (-1113.047) -- 0:01:16
Average standard deviation of split frequencies: 0.034890
50500 -- [-1107.757] (-1106.599) (-1108.072) (-1121.131) * (-1117.361) [-1117.893] (-1107.929) (-1111.039) -- 0:01:15
51000 -- (-1109.150) (-1105.955) (-1107.728) [-1113.462] * [-1111.642] (-1119.283) (-1105.546) (-1111.050) -- 0:01:14
51500 -- (-1111.393) (-1106.445) [-1106.967] (-1122.306) * (-1115.345) [-1115.417] (-1111.092) (-1109.011) -- 0:01:13
52000 -- (-1105.561) (-1111.520) (-1107.258) [-1114.566] * (-1116.522) (-1118.789) (-1105.510) [-1105.833] -- 0:01:12
52500 -- (-1106.290) (-1106.754) (-1107.920) [-1112.295] * (-1113.748) (-1120.020) (-1106.428) [-1105.952] -- 0:01:30
53000 -- (-1105.903) [-1106.822] (-1109.232) (-1127.293) * [-1113.231] (-1120.294) (-1105.993) (-1107.191) -- 0:01:29
53500 -- (-1105.820) (-1106.822) (-1107.924) [-1112.345] * [-1120.905] (-1111.563) (-1107.760) (-1110.356) -- 0:01:28
54000 -- [-1108.221] (-1107.899) (-1108.439) (-1116.604) * (-1119.732) (-1115.152) (-1107.392) [-1106.042] -- 0:01:27
54500 -- (-1112.250) (-1105.795) (-1107.173) [-1113.421] * [-1117.053] (-1123.142) (-1105.889) (-1105.233) -- 0:01:26
55000 -- (-1110.176) (-1105.698) [-1105.956] (-1114.303) * (-1111.825) (-1123.495) (-1106.907) [-1109.398] -- 0:01:25
Average standard deviation of split frequencies: 0.035355
55500 -- [-1106.464] (-1108.351) (-1107.552) (-1120.021) * (-1114.735) (-1115.955) [-1106.598] (-1110.070) -- 0:01:25
56000 -- (-1106.439) (-1107.956) (-1105.982) [-1114.302] * (-1114.826) (-1111.166) [-1105.625] (-1111.013) -- 0:01:24
56500 -- (-1109.415) (-1112.597) (-1105.241) [-1117.410] * (-1118.492) (-1113.982) (-1106.065) [-1110.289] -- 0:01:23
57000 -- (-1105.988) (-1107.523) (-1107.244) [-1114.454] * (-1114.781) (-1114.321) (-1105.992) [-1108.654] -- 0:01:22
57500 -- (-1107.241) [-1107.847] (-1106.962) (-1113.074) * (-1114.816) (-1113.685) (-1109.275) [-1108.376] -- 0:01:21
58000 -- (-1109.004) [-1106.358] (-1108.366) (-1117.484) * (-1117.555) (-1117.053) (-1107.088) [-1107.669] -- 0:01:21
58500 -- (-1105.648) (-1108.942) (-1107.904) [-1117.983] * (-1119.853) [-1119.360] (-1111.063) (-1107.340) -- 0:01:20
59000 -- (-1107.094) (-1107.330) (-1107.403) [-1113.677] * (-1122.908) [-1113.377] (-1108.576) (-1106.908) -- 0:01:19
59500 -- (-1108.758) (-1110.367) [-1111.387] (-1114.691) * (-1123.605) (-1117.252) (-1108.556) [-1106.718] -- 0:01:19
60000 -- [-1106.433] (-1111.426) (-1107.698) (-1111.250) * (-1116.645) (-1118.032) [-1108.092] (-1109.469) -- 0:01:18
Average standard deviation of split frequencies: 0.035744
60500 -- [-1111.567] (-1110.702) (-1108.152) (-1125.117) * (-1123.350) (-1118.530) (-1107.599) [-1108.418] -- 0:01:17
61000 -- (-1106.511) (-1108.302) [-1107.288] (-1115.735) * (-1111.476) [-1114.648] (-1111.734) (-1107.319) -- 0:01:16
61500 -- [-1107.202] (-1108.179) (-1106.969) (-1119.679) * [-1112.793] (-1117.303) (-1112.698) (-1107.424) -- 0:01:16
62000 -- (-1106.466) (-1106.386) [-1106.475] (-1120.365) * [-1115.606] (-1120.344) (-1108.198) (-1106.857) -- 0:01:15
62500 -- (-1107.528) (-1106.624) (-1108.075) [-1112.078] * (-1119.125) (-1118.242) (-1106.681) [-1105.379] -- 0:01:15
63000 -- [-1106.575] (-1106.429) (-1108.925) (-1117.110) * (-1113.256) (-1113.225) (-1107.226) [-1105.680] -- 0:01:14
63500 -- (-1106.562) [-1106.989] (-1106.624) (-1115.300) * (-1117.048) (-1108.861) [-1106.413] (-1106.265) -- 0:01:28
64000 -- [-1108.916] (-1106.846) (-1108.658) (-1112.164) * (-1126.292) [-1108.985] (-1106.846) (-1105.119) -- 0:01:27
64500 -- (-1109.344) [-1106.726] (-1107.950) (-1111.805) * [-1126.054] (-1109.621) (-1105.961) (-1106.943) -- 0:01:27
65000 -- (-1109.413) (-1106.526) (-1106.282) [-1112.748] * (-1119.966) [-1105.162] (-1107.157) (-1106.665) -- 0:01:26
Average standard deviation of split frequencies: 0.034585
65500 -- (-1106.610) [-1106.932] (-1108.465) (-1114.504) * (-1128.876) [-1107.507] (-1107.027) (-1105.137) -- 0:01:25
66000 -- (-1106.163) (-1107.533) [-1107.627] (-1115.842) * (-1119.537) (-1105.689) [-1106.973] (-1107.094) -- 0:01:24
66500 -- (-1111.323) (-1107.456) (-1106.245) [-1116.835] * (-1107.463) [-1106.011] (-1107.884) (-1105.731) -- 0:01:24
67000 -- (-1107.415) [-1106.039] (-1109.565) (-1118.592) * (-1109.784) (-1105.946) [-1106.986] (-1107.000) -- 0:01:23
67500 -- (-1108.551) [-1106.208] (-1105.793) (-1122.072) * (-1106.048) (-1107.430) [-1106.952] (-1106.358) -- 0:01:22
68000 -- (-1108.861) [-1106.878] (-1106.583) (-1117.794) * [-1106.220] (-1106.812) (-1108.810) (-1106.369) -- 0:01:22
68500 -- (-1110.099) (-1106.414) [-1108.071] (-1114.260) * (-1105.937) [-1106.623] (-1111.214) (-1106.040) -- 0:01:21
69000 -- [-1106.272] (-1105.756) (-1108.011) (-1115.267) * (-1105.824) [-1105.067] (-1108.421) (-1109.982) -- 0:01:20
69500 -- (-1106.090) [-1106.139] (-1110.088) (-1116.041) * (-1105.608) (-1105.055) [-1107.728] (-1110.974) -- 0:01:20
70000 -- (-1106.105) [-1105.727] (-1109.357) (-1122.986) * (-1104.945) [-1107.122] (-1106.089) (-1109.070) -- 0:01:19
Average standard deviation of split frequencies: 0.029843
70500 -- (-1108.501) (-1105.606) [-1109.359] (-1119.844) * (-1105.793) (-1107.235) [-1107.108] (-1107.549) -- 0:01:19
71000 -- (-1115.359) (-1106.652) (-1111.012) [-1115.131] * [-1105.495] (-1106.304) (-1111.291) (-1106.476) -- 0:01:18
71500 -- (-1107.854) (-1107.403) [-1105.394] (-1130.592) * (-1108.524) (-1106.079) [-1108.426] (-1106.339) -- 0:01:17
72000 -- (-1105.333) (-1107.090) [-1108.842] (-1108.160) * (-1106.321) (-1106.871) [-1106.396] (-1109.923) -- 0:01:17
72500 -- (-1105.533) (-1105.951) (-1106.188) [-1109.438] * (-1107.943) (-1106.103) [-1105.965] (-1106.386) -- 0:01:16
73000 -- (-1105.605) [-1109.583] (-1106.010) (-1107.112) * (-1106.091) [-1108.728] (-1105.946) (-1106.290) -- 0:01:16
73500 -- (-1108.173) [-1106.383] (-1107.808) (-1106.427) * (-1106.046) [-1108.458] (-1106.390) (-1107.187) -- 0:01:15
74000 -- [-1109.109] (-1106.504) (-1108.252) (-1106.691) * (-1106.333) (-1107.690) [-1105.598] (-1108.051) -- 0:01:15
74500 -- [-1106.389] (-1105.368) (-1107.260) (-1106.855) * [-1106.233] (-1105.331) (-1105.876) (-1107.369) -- 0:01:26
75000 -- (-1113.461) [-1108.287] (-1107.502) (-1107.915) * [-1109.165] (-1105.181) (-1106.490) (-1107.299) -- 0:01:26
Average standard deviation of split frequencies: 0.029773
75500 -- (-1109.208) (-1106.918) (-1107.076) [-1108.418] * (-1108.669) (-1105.419) (-1106.068) [-1108.371] -- 0:01:25
76000 -- (-1109.048) [-1105.542] (-1109.593) (-1108.781) * [-1108.783] (-1105.547) (-1113.774) (-1106.911) -- 0:01:25
76500 -- (-1109.579) [-1106.658] (-1107.040) (-1106.398) * [-1106.432] (-1105.413) (-1109.027) (-1108.745) -- 0:01:24
77000 -- (-1108.714) (-1105.489) [-1108.395] (-1106.748) * [-1106.488] (-1106.342) (-1108.432) (-1109.946) -- 0:01:23
77500 -- (-1110.047) [-1106.358] (-1108.087) (-1105.946) * (-1106.627) [-1107.189] (-1107.122) (-1108.597) -- 0:01:23
78000 -- [-1108.402] (-1106.293) (-1107.334) (-1105.957) * [-1108.459] (-1107.564) (-1108.560) (-1107.212) -- 0:01:22
78500 -- (-1106.384) (-1109.812) [-1106.591] (-1108.325) * [-1107.262] (-1107.774) (-1109.192) (-1110.026) -- 0:01:22
79000 -- [-1108.093] (-1108.908) (-1108.257) (-1110.331) * (-1107.459) (-1108.104) (-1110.404) [-1105.503] -- 0:01:21
79500 -- [-1106.783] (-1106.121) (-1108.640) (-1109.782) * (-1106.934) (-1108.462) (-1108.413) [-1105.278] -- 0:01:21
80000 -- (-1108.170) [-1106.549] (-1106.620) (-1109.708) * [-1106.961] (-1105.643) (-1108.558) (-1105.278) -- 0:01:20
Average standard deviation of split frequencies: 0.030938
80500 -- [-1108.620] (-1108.412) (-1106.709) (-1114.881) * (-1106.844) [-1105.743] (-1107.399) (-1105.337) -- 0:01:19
81000 -- (-1109.388) (-1107.782) [-1107.341] (-1113.020) * (-1110.609) [-1108.345] (-1107.403) (-1107.410) -- 0:01:19
81500 -- (-1110.406) (-1106.758) (-1108.811) [-1117.819] * (-1110.233) [-1108.658] (-1106.351) (-1106.479) -- 0:01:18
82000 -- (-1108.987) (-1106.438) (-1105.215) [-1109.031] * (-1108.605) (-1107.780) (-1108.497) [-1106.381] -- 0:01:18
82500 -- (-1108.161) [-1107.377] (-1106.696) (-1107.188) * (-1106.569) (-1108.562) (-1105.735) [-1106.592] -- 0:01:17
83000 -- (-1108.518) (-1111.069) [-1106.288] (-1106.168) * (-1107.027) [-1106.615] (-1111.043) (-1106.569) -- 0:01:17
83500 -- (-1110.766) (-1111.182) (-1106.105) [-1107.818] * (-1106.398) [-1107.557] (-1108.190) (-1108.547) -- 0:01:16
84000 -- (-1108.881) (-1112.365) [-1107.430] (-1111.184) * (-1106.003) [-1107.194] (-1110.585) (-1106.860) -- 0:01:16
84500 -- [-1111.899] (-1109.578) (-1108.600) (-1108.699) * [-1106.305] (-1107.801) (-1107.314) (-1107.962) -- 0:01:15
85000 -- (-1106.396) [-1106.943] (-1105.812) (-1107.098) * (-1106.535) (-1108.681) [-1107.884] (-1112.711) -- 0:01:15
Average standard deviation of split frequencies: 0.025676
85500 -- (-1106.206) (-1107.968) (-1105.763) [-1106.103] * (-1106.173) [-1105.314] (-1109.460) (-1108.238) -- 0:01:25
86000 -- (-1109.480) (-1106.635) (-1106.696) [-1105.827] * (-1107.973) (-1107.783) (-1117.057) [-1107.020] -- 0:01:25
86500 -- (-1106.240) (-1108.673) [-1110.625] (-1105.830) * (-1107.370) [-1106.855] (-1106.653) (-1108.852) -- 0:01:24
87000 -- (-1108.166) [-1109.189] (-1110.950) (-1107.595) * (-1106.726) (-1108.602) (-1107.585) [-1111.063] -- 0:01:23
87500 -- [-1110.976] (-1106.805) (-1105.900) (-1106.509) * (-1106.487) (-1108.414) (-1106.587) [-1107.166] -- 0:01:23
88000 -- [-1106.858] (-1106.619) (-1109.234) (-1106.375) * (-1108.566) (-1108.593) (-1107.930) [-1108.100] -- 0:01:22
88500 -- (-1107.482) (-1105.489) (-1107.716) [-1106.243] * [-1109.479] (-1107.700) (-1107.150) (-1109.312) -- 0:01:22
89000 -- (-1107.643) [-1105.818] (-1106.424) (-1106.986) * (-1105.560) (-1108.245) (-1113.101) [-1110.746] -- 0:01:21
89500 -- (-1109.808) (-1105.977) [-1109.306] (-1106.046) * (-1107.170) (-1105.406) [-1105.936] (-1110.850) -- 0:01:21
90000 -- [-1105.929] (-1107.448) (-1107.068) (-1106.430) * (-1109.148) (-1106.900) [-1107.289] (-1111.951) -- 0:01:20
Average standard deviation of split frequencies: 0.026517
90500 -- (-1107.227) (-1106.215) [-1107.191] (-1106.945) * (-1107.541) [-1105.735] (-1110.043) (-1113.587) -- 0:01:20
91000 -- [-1109.240] (-1109.862) (-1111.794) (-1108.344) * (-1105.230) [-1105.582] (-1109.856) (-1109.743) -- 0:01:19
91500 -- (-1109.027) [-1105.683] (-1110.020) (-1107.531) * (-1105.103) (-1108.439) (-1111.802) [-1106.188] -- 0:01:19
92000 -- (-1107.355) (-1112.180) [-1105.419] (-1105.908) * (-1107.664) [-1109.135] (-1111.268) (-1105.165) -- 0:01:18
92500 -- (-1110.621) [-1106.583] (-1106.239) (-1106.946) * (-1107.643) (-1108.485) [-1111.106] (-1105.164) -- 0:01:18
93000 -- [-1113.167] (-1106.534) (-1106.738) (-1107.218) * (-1112.351) (-1108.274) (-1109.204) [-1106.553] -- 0:01:18
93500 -- [-1107.030] (-1107.088) (-1108.224) (-1108.435) * (-1107.376) [-1106.577] (-1110.073) (-1106.349) -- 0:01:17
94000 -- (-1106.365) (-1109.087) [-1106.766] (-1109.818) * (-1107.184) [-1107.043] (-1110.658) (-1107.557) -- 0:01:17
94500 -- (-1107.236) (-1110.654) (-1107.054) [-1107.271] * (-1109.004) (-1109.611) [-1107.957] (-1106.403) -- 0:01:16
95000 -- (-1107.233) (-1111.814) (-1108.908) [-1105.982] * (-1107.822) [-1107.707] (-1106.239) (-1107.435) -- 0:01:16
Average standard deviation of split frequencies: 0.025328
95500 -- (-1106.596) (-1107.136) (-1106.861) [-1107.512] * (-1106.694) (-1108.230) (-1109.088) [-1106.241] -- 0:01:15
96000 -- (-1113.102) (-1107.841) (-1106.150) [-1108.058] * (-1106.432) [-1107.130] (-1109.540) (-1106.578) -- 0:01:15
96500 -- (-1108.381) (-1107.325) (-1105.621) [-1105.729] * (-1105.588) [-1105.993] (-1106.630) (-1106.346) -- 0:01:24
97000 -- (-1106.207) (-1106.574) [-1105.683] (-1109.203) * (-1107.074) (-1106.258) [-1106.610] (-1106.346) -- 0:01:23
97500 -- (-1105.818) (-1106.781) [-1105.254] (-1110.093) * (-1108.422) (-1107.663) (-1108.311) [-1105.696] -- 0:01:23
98000 -- (-1105.818) [-1106.545] (-1105.969) (-1109.867) * (-1109.789) (-1105.954) [-1110.160] (-1109.385) -- 0:01:22
98500 -- (-1108.337) (-1106.650) [-1106.255] (-1106.234) * (-1107.879) (-1107.304) (-1108.039) [-1106.921] -- 0:01:22
99000 -- (-1106.483) [-1108.005] (-1105.400) (-1108.747) * [-1106.533] (-1108.197) (-1107.943) (-1108.661) -- 0:01:21
99500 -- (-1107.988) (-1108.542) [-1106.390] (-1105.809) * (-1108.972) [-1108.916] (-1108.275) (-1107.345) -- 0:01:21
100000 -- (-1107.484) (-1106.702) (-1105.924) [-1106.801] * (-1107.064) (-1106.926) (-1110.311) [-1109.501] -- 0:01:21
Average standard deviation of split frequencies: 0.024975
100500 -- (-1107.943) (-1106.026) (-1106.439) [-1105.625] * (-1107.041) (-1106.578) (-1110.029) [-1106.802] -- 0:01:20
101000 -- (-1107.879) [-1107.016] (-1108.438) (-1107.027) * (-1108.674) [-1107.316] (-1107.446) (-1109.499) -- 0:01:20
101500 -- (-1105.654) (-1109.366) (-1106.464) [-1106.796] * (-1106.933) (-1106.698) (-1107.833) [-1109.060] -- 0:01:19
102000 -- (-1107.216) (-1110.444) (-1110.141) [-1108.269] * (-1106.621) (-1107.122) (-1107.885) [-1107.500] -- 0:01:19
102500 -- (-1107.933) (-1107.386) [-1111.129] (-1108.832) * (-1107.117) (-1107.607) (-1106.394) [-1107.750] -- 0:01:18
103000 -- (-1106.510) (-1107.654) (-1110.917) [-1108.128] * (-1108.636) (-1107.666) (-1106.599) [-1105.612] -- 0:01:18
103500 -- [-1106.492] (-1108.905) (-1108.875) (-1108.030) * (-1105.448) (-1106.418) (-1107.347) [-1108.492] -- 0:01:17
104000 -- (-1106.493) (-1113.517) (-1108.215) [-1108.113] * (-1106.465) (-1106.990) (-1107.790) [-1107.592] -- 0:01:17
104500 -- (-1106.562) (-1111.215) [-1107.276] (-1106.008) * [-1109.207] (-1106.036) (-1109.268) (-1112.954) -- 0:01:17
105000 -- (-1107.309) [-1110.861] (-1110.394) (-1107.861) * (-1106.450) [-1106.305] (-1107.041) (-1112.095) -- 0:01:16
Average standard deviation of split frequencies: 0.022938
105500 -- [-1107.358] (-1112.432) (-1108.283) (-1105.679) * [-1106.546] (-1108.140) (-1108.964) (-1107.368) -- 0:01:16
106000 -- (-1106.888) (-1108.530) (-1106.383) [-1110.461] * (-1106.218) [-1105.313] (-1107.018) (-1107.846) -- 0:01:15
106500 -- (-1109.012) (-1106.716) [-1108.707] (-1110.059) * (-1106.890) (-1104.980) [-1107.674] (-1107.796) -- 0:01:15
107000 -- (-1107.245) (-1107.754) [-1109.684] (-1107.819) * (-1106.067) (-1104.980) (-1105.800) [-1105.441] -- 0:01:15
107500 -- (-1108.611) (-1111.933) [-1106.384] (-1106.194) * (-1105.936) [-1106.848] (-1108.821) (-1108.454) -- 0:01:23
108000 -- (-1106.725) (-1111.952) [-1106.109] (-1105.465) * [-1106.037] (-1107.730) (-1111.047) (-1107.233) -- 0:01:22
108500 -- [-1107.171] (-1105.592) (-1106.321) (-1105.935) * (-1106.947) (-1107.640) [-1107.462] (-1108.556) -- 0:01:22
109000 -- (-1108.626) (-1105.958) (-1106.539) [-1105.926] * [-1108.861] (-1112.702) (-1106.326) (-1110.176) -- 0:01:21
109500 -- (-1108.575) (-1107.474) (-1106.906) [-1106.220] * [-1107.237] (-1107.607) (-1108.640) (-1107.317) -- 0:01:21
110000 -- (-1109.561) [-1105.903] (-1109.404) (-1105.674) * (-1107.281) [-1105.152] (-1107.677) (-1110.085) -- 0:01:20
Average standard deviation of split frequencies: 0.025110
110500 -- [-1106.960] (-1105.868) (-1108.746) (-1105.664) * (-1109.113) (-1105.549) (-1109.436) [-1105.876] -- 0:01:20
111000 -- (-1106.568) (-1106.883) [-1110.294] (-1109.395) * (-1106.679) [-1107.868] (-1106.209) (-1106.811) -- 0:01:20
111500 -- (-1107.453) [-1105.397] (-1107.635) (-1105.391) * (-1107.031) (-1106.904) [-1108.762] (-1107.916) -- 0:01:19
112000 -- [-1107.166] (-1105.395) (-1109.062) (-1105.742) * [-1106.160] (-1111.231) (-1110.999) (-1114.239) -- 0:01:19
112500 -- (-1108.466) (-1105.395) [-1107.733] (-1107.348) * (-1110.779) (-1107.197) [-1106.430] (-1106.928) -- 0:01:18
113000 -- (-1107.626) (-1105.005) [-1107.890] (-1108.243) * (-1106.104) (-1106.668) (-1106.120) [-1107.095] -- 0:01:18
113500 -- (-1107.982) [-1106.783] (-1107.029) (-1106.339) * (-1106.919) (-1105.915) [-1106.078] (-1105.979) -- 0:01:18
114000 -- (-1110.522) (-1110.072) [-1105.754] (-1108.714) * (-1106.362) [-1105.572] (-1106.282) (-1105.985) -- 0:01:17
114500 -- (-1107.922) (-1108.920) (-1105.568) [-1109.366] * (-1108.259) [-1105.619] (-1106.004) (-1105.710) -- 0:01:17
115000 -- (-1107.850) (-1108.328) [-1105.441] (-1106.058) * (-1108.219) (-1105.619) (-1108.669) [-1105.645] -- 0:01:16
Average standard deviation of split frequencies: 0.023028
115500 -- (-1106.951) (-1107.567) [-1107.563] (-1105.807) * (-1107.491) (-1105.118) (-1106.664) [-1108.569] -- 0:01:16
116000 -- (-1106.966) [-1106.418] (-1107.592) (-1105.411) * (-1108.338) (-1107.388) [-1107.728] (-1111.378) -- 0:01:16
116500 -- (-1106.890) (-1106.633) [-1106.495] (-1108.053) * (-1108.095) (-1107.744) [-1106.780] (-1114.660) -- 0:01:15
117000 -- (-1106.651) (-1108.293) (-1106.928) [-1106.968] * (-1108.073) (-1107.055) (-1107.057) [-1112.139] -- 0:01:15
117500 -- (-1106.236) (-1108.056) (-1105.933) [-1107.259] * (-1105.823) (-1105.938) (-1107.378) [-1109.971] -- 0:01:22
118000 -- (-1107.055) [-1108.758] (-1106.434) (-1106.811) * (-1107.652) (-1111.519) [-1107.230] (-1107.572) -- 0:01:22
118500 -- (-1105.499) (-1107.239) [-1106.770] (-1106.895) * [-1107.123] (-1106.884) (-1108.052) (-1107.743) -- 0:01:21
119000 -- (-1108.031) (-1107.467) (-1106.316) [-1108.094] * (-1108.050) [-1106.452] (-1108.345) (-1106.939) -- 0:01:21
119500 -- (-1112.067) [-1110.218] (-1105.911) (-1109.805) * [-1106.981] (-1106.973) (-1113.913) (-1105.712) -- 0:01:21
120000 -- (-1111.741) (-1109.375) [-1105.474] (-1106.789) * (-1109.356) [-1105.901] (-1106.707) (-1106.889) -- 0:01:20
Average standard deviation of split frequencies: 0.022789
120500 -- (-1112.128) (-1107.175) [-1106.220] (-1109.150) * (-1108.626) (-1108.037) [-1107.510] (-1105.447) -- 0:01:20
121000 -- (-1106.195) (-1106.550) [-1105.626] (-1105.943) * [-1106.953] (-1105.349) (-1107.593) (-1108.835) -- 0:01:19
121500 -- (-1107.645) (-1107.315) [-1105.827] (-1106.798) * (-1105.913) (-1110.645) [-1107.416] (-1107.455) -- 0:01:19
122000 -- (-1106.382) (-1105.509) (-1108.405) [-1106.261] * (-1106.543) (-1107.440) [-1106.341] (-1109.162) -- 0:01:19
122500 -- (-1106.844) (-1106.442) [-1108.213] (-1106.453) * [-1110.036] (-1110.028) (-1106.415) (-1109.474) -- 0:01:18
123000 -- (-1107.258) [-1106.753] (-1109.665) (-1106.731) * [-1105.445] (-1106.902) (-1110.745) (-1105.408) -- 0:01:18
123500 -- (-1105.512) (-1105.827) (-1106.534) [-1108.461] * (-1107.438) [-1106.651] (-1108.750) (-1106.562) -- 0:01:18
124000 -- (-1106.769) [-1107.404] (-1106.497) (-1106.651) * [-1108.642] (-1106.848) (-1107.802) (-1109.034) -- 0:01:17
124500 -- (-1108.683) (-1111.998) [-1106.507] (-1109.835) * [-1109.288] (-1107.227) (-1107.738) (-1107.283) -- 0:01:17
125000 -- (-1105.517) [-1105.568] (-1107.371) (-1108.704) * (-1108.029) [-1109.415] (-1106.579) (-1106.851) -- 0:01:17
Average standard deviation of split frequencies: 0.025150
125500 -- (-1107.025) (-1106.024) [-1107.549] (-1108.932) * (-1108.393) (-1110.940) (-1107.898) [-1106.189] -- 0:01:16
126000 -- (-1108.910) [-1108.014] (-1108.384) (-1107.392) * (-1114.864) [-1111.633] (-1107.545) (-1107.216) -- 0:01:16
126500 -- (-1105.476) (-1110.665) (-1108.009) [-1106.553] * (-1110.058) (-1109.019) (-1110.046) [-1106.483] -- 0:01:15
127000 -- [-1106.499] (-1111.256) (-1106.465) (-1107.159) * (-1107.471) (-1108.495) (-1107.709) [-1107.295] -- 0:01:15
127500 -- (-1106.574) (-1107.944) (-1107.136) [-1107.113] * (-1105.373) (-1114.254) (-1109.302) [-1105.897] -- 0:01:15
128000 -- (-1106.609) [-1107.261] (-1106.111) (-1106.781) * (-1105.711) [-1107.596] (-1108.297) (-1105.992) -- 0:01:21
128500 -- (-1108.031) (-1107.689) (-1108.100) [-1105.681] * (-1105.973) [-1106.552] (-1106.369) (-1106.248) -- 0:01:21
129000 -- [-1106.653] (-1111.778) (-1111.560) (-1106.011) * (-1109.582) (-1109.281) [-1107.244] (-1108.671) -- 0:01:21
129500 -- (-1109.491) (-1112.619) [-1106.371] (-1106.011) * [-1108.125] (-1108.535) (-1109.134) (-1105.796) -- 0:01:20
130000 -- (-1109.208) [-1106.618] (-1105.549) (-1106.826) * (-1107.687) (-1111.500) (-1107.520) [-1107.504] -- 0:01:20
Average standard deviation of split frequencies: 0.023250
130500 -- (-1105.822) (-1107.911) [-1105.415] (-1107.168) * (-1105.943) [-1107.432] (-1114.964) (-1107.248) -- 0:01:19
131000 -- (-1110.861) [-1108.294] (-1109.040) (-1107.148) * (-1106.015) (-1105.695) (-1108.645) [-1108.838] -- 0:01:19
131500 -- (-1107.439) [-1110.180] (-1107.449) (-1108.081) * (-1105.637) (-1105.837) [-1105.833] (-1107.672) -- 0:01:19
132000 -- (-1109.867) [-1109.667] (-1107.176) (-1107.035) * (-1106.163) [-1106.548] (-1108.603) (-1108.546) -- 0:01:18
132500 -- (-1106.318) (-1110.808) (-1108.586) [-1107.685] * (-1107.085) (-1109.554) [-1107.239] (-1108.158) -- 0:01:18
133000 -- [-1107.417] (-1110.634) (-1112.230) (-1111.674) * (-1107.495) [-1112.237] (-1106.372) (-1109.205) -- 0:01:18
133500 -- (-1110.629) (-1109.576) [-1106.680] (-1108.340) * (-1107.118) (-1111.853) [-1108.565] (-1109.180) -- 0:01:17
134000 -- [-1106.362] (-1107.408) (-1106.361) (-1109.290) * (-1106.262) (-1109.447) (-1108.952) [-1107.792] -- 0:01:17
134500 -- (-1108.868) (-1107.974) (-1107.158) [-1105.673] * [-1106.432] (-1107.940) (-1107.470) (-1109.520) -- 0:01:17
135000 -- (-1109.623) (-1111.696) [-1110.414] (-1106.167) * [-1107.485] (-1110.503) (-1105.716) (-1109.308) -- 0:01:16
Average standard deviation of split frequencies: 0.025905
135500 -- (-1107.889) (-1116.958) [-1111.339] (-1105.888) * [-1107.886] (-1109.412) (-1107.497) (-1109.784) -- 0:01:16
136000 -- [-1106.869] (-1111.222) (-1110.296) (-1106.075) * (-1108.010) (-1106.487) [-1107.990] (-1111.438) -- 0:01:16
136500 -- (-1105.868) (-1111.095) [-1106.885] (-1106.121) * (-1107.236) (-1105.440) [-1106.857] (-1112.915) -- 0:01:15
137000 -- (-1106.280) [-1106.602] (-1108.506) (-1105.667) * [-1108.919] (-1105.451) (-1106.571) (-1110.221) -- 0:01:15
137500 -- (-1106.470) [-1105.933] (-1107.811) (-1106.349) * [-1111.453] (-1108.199) (-1109.465) (-1116.627) -- 0:01:15
138000 -- [-1106.827] (-1106.173) (-1106.256) (-1107.214) * [-1105.755] (-1107.280) (-1107.352) (-1112.296) -- 0:01:14
138500 -- (-1108.183) [-1106.589] (-1107.404) (-1108.536) * (-1108.895) [-1108.375] (-1107.197) (-1106.645) -- 0:01:14
139000 -- (-1106.722) [-1111.385] (-1105.676) (-1105.226) * (-1108.351) (-1110.237) (-1105.782) [-1106.645] -- 0:01:20
139500 -- (-1106.821) (-1106.805) [-1105.611] (-1107.364) * (-1110.915) (-1105.646) [-1108.001] (-1108.453) -- 0:01:20
140000 -- (-1106.866) (-1110.360) [-1108.070] (-1107.364) * (-1109.831) (-1105.261) (-1107.995) [-1107.283] -- 0:01:19
Average standard deviation of split frequencies: 0.028574
140500 -- (-1107.032) [-1107.267] (-1108.771) (-1107.430) * (-1109.065) (-1106.595) [-1110.293] (-1110.376) -- 0:01:19
141000 -- (-1107.058) [-1107.304] (-1111.228) (-1107.697) * (-1107.388) (-1107.218) (-1114.091) [-1112.344] -- 0:01:19
141500 -- [-1106.404] (-1106.284) (-1109.508) (-1107.040) * [-1107.047] (-1106.170) (-1110.806) (-1109.338) -- 0:01:18
142000 -- (-1105.656) [-1107.590] (-1109.982) (-1108.221) * (-1106.823) (-1106.458) (-1108.681) [-1108.537] -- 0:01:18
142500 -- [-1107.099] (-1108.884) (-1109.769) (-1107.937) * (-1107.575) (-1105.978) [-1105.967] (-1105.893) -- 0:01:18
143000 -- (-1106.322) (-1108.431) [-1108.864] (-1110.582) * (-1106.586) (-1107.328) [-1107.118] (-1108.888) -- 0:01:17
143500 -- (-1105.659) (-1106.103) [-1110.261] (-1109.328) * (-1106.118) [-1107.442] (-1106.141) (-1105.638) -- 0:01:17
144000 -- (-1106.308) (-1105.408) (-1109.718) [-1108.876] * (-1108.003) (-1110.974) (-1109.204) [-1105.785] -- 0:01:17
144500 -- [-1105.342] (-1106.727) (-1107.970) (-1106.974) * (-1106.547) (-1109.176) (-1107.999) [-1105.992] -- 0:01:16
145000 -- [-1108.643] (-1108.570) (-1107.075) (-1107.687) * (-1106.074) [-1111.673] (-1110.250) (-1109.685) -- 0:01:16
Average standard deviation of split frequencies: 0.027700
145500 -- [-1105.561] (-1109.776) (-1107.197) (-1106.611) * [-1108.865] (-1108.377) (-1110.123) (-1105.874) -- 0:01:16
146000 -- [-1106.468] (-1107.865) (-1107.867) (-1106.904) * (-1105.555) [-1107.083] (-1107.146) (-1106.594) -- 0:01:16
146500 -- (-1107.817) [-1107.677] (-1112.419) (-1107.886) * (-1107.494) [-1105.868] (-1107.052) (-1108.460) -- 0:01:15
147000 -- (-1106.518) (-1107.157) [-1110.815] (-1108.402) * (-1106.821) (-1105.355) [-1106.491] (-1107.485) -- 0:01:15
147500 -- (-1107.311) [-1107.667] (-1109.061) (-1108.098) * (-1109.786) (-1109.006) [-1108.701] (-1108.698) -- 0:01:15
148000 -- (-1107.766) (-1111.123) [-1107.195] (-1106.746) * (-1105.541) (-1107.255) [-1107.113] (-1109.761) -- 0:01:14
148500 -- (-1105.487) [-1108.636] (-1107.192) (-1107.719) * (-1105.674) (-1109.325) [-1106.226] (-1107.303) -- 0:01:14
149000 -- [-1105.757] (-1111.367) (-1107.480) (-1110.225) * (-1106.941) (-1106.762) [-1106.284] (-1107.925) -- 0:01:14
149500 -- (-1108.899) (-1109.193) [-1106.041] (-1105.797) * (-1106.789) (-1105.463) (-1107.458) [-1107.351] -- 0:01:13
150000 -- (-1106.880) (-1107.603) [-1105.786] (-1106.829) * (-1106.460) [-1105.858] (-1107.418) (-1106.400) -- 0:01:13
Average standard deviation of split frequencies: 0.026769
150500 -- (-1105.872) (-1107.658) [-1109.455] (-1106.580) * [-1106.271] (-1105.469) (-1106.809) (-1106.937) -- 0:01:19
151000 -- (-1106.542) (-1107.941) (-1106.675) [-1107.650] * (-1107.563) (-1106.552) (-1106.893) [-1106.140] -- 0:01:18
151500 -- [-1107.481] (-1109.185) (-1106.504) (-1108.334) * (-1107.419) [-1107.453] (-1105.715) (-1107.083) -- 0:01:18
152000 -- (-1110.881) (-1108.417) [-1106.568] (-1108.106) * [-1108.712] (-1107.122) (-1106.531) (-1107.007) -- 0:01:18
152500 -- (-1111.944) (-1110.026) (-1109.706) [-1106.475] * (-1108.366) (-1106.493) [-1105.171] (-1109.215) -- 0:01:17
153000 -- (-1111.805) (-1105.729) [-1107.391] (-1105.653) * (-1106.222) (-1106.417) [-1106.862] (-1105.705) -- 0:01:17
153500 -- (-1106.972) (-1105.245) (-1106.124) [-1106.389] * (-1106.373) (-1107.676) (-1109.283) [-1105.947] -- 0:01:17
154000 -- [-1110.162] (-1107.226) (-1106.633) (-1105.779) * (-1105.602) [-1106.600] (-1107.699) (-1106.612) -- 0:01:16
154500 -- [-1108.588] (-1107.943) (-1106.044) (-1113.468) * (-1108.606) (-1107.305) [-1110.669] (-1105.446) -- 0:01:16
155000 -- (-1107.327) (-1111.616) [-1109.022] (-1113.563) * (-1105.637) (-1107.916) (-1106.475) [-1107.002] -- 0:01:16
Average standard deviation of split frequencies: 0.025129
155500 -- (-1106.540) [-1107.085] (-1106.180) (-1112.005) * [-1106.374] (-1112.165) (-1106.002) (-1108.670) -- 0:01:16
156000 -- (-1110.224) (-1106.171) (-1105.675) [-1109.879] * (-1106.253) (-1118.788) [-1106.398] (-1106.126) -- 0:01:15
156500 -- (-1108.755) (-1106.493) [-1107.758] (-1107.801) * [-1107.276] (-1116.669) (-1107.903) (-1107.208) -- 0:01:15
157000 -- (-1108.372) (-1105.762) [-1106.075] (-1105.498) * [-1107.809] (-1112.012) (-1111.631) (-1108.162) -- 0:01:15
157500 -- (-1109.907) (-1110.570) [-1105.559] (-1105.478) * [-1105.695] (-1106.992) (-1111.257) (-1106.231) -- 0:01:14
158000 -- (-1108.202) (-1107.143) (-1106.179) [-1106.424] * [-1106.471] (-1107.707) (-1108.565) (-1110.512) -- 0:01:14
158500 -- (-1108.156) [-1106.157] (-1106.944) (-1105.788) * [-1106.522] (-1108.114) (-1106.204) (-1107.953) -- 0:01:14
159000 -- [-1108.513] (-1107.038) (-1106.435) (-1105.450) * (-1107.885) (-1110.897) [-1106.213] (-1110.374) -- 0:01:14
159500 -- (-1110.690) (-1107.738) [-1106.415] (-1107.987) * (-1107.285) (-1108.705) [-1108.923] (-1107.922) -- 0:01:13
160000 -- [-1108.476] (-1108.135) (-1107.337) (-1109.927) * (-1108.220) [-1108.958] (-1107.678) (-1108.356) -- 0:01:13
Average standard deviation of split frequencies: 0.024862
160500 -- (-1105.648) [-1109.926] (-1107.942) (-1108.682) * (-1109.525) (-1109.477) (-1107.484) [-1107.524] -- 0:01:13
161000 -- (-1107.315) (-1106.293) [-1108.803] (-1111.690) * (-1107.033) (-1108.353) [-1106.461] (-1110.509) -- 0:01:12
161500 -- (-1107.338) (-1107.640) (-1107.959) [-1110.136] * (-1108.644) [-1107.896] (-1106.157) (-1109.848) -- 0:01:17
162000 -- (-1108.178) (-1108.997) [-1107.986] (-1106.778) * [-1105.560] (-1107.541) (-1109.459) (-1107.031) -- 0:01:17
162500 -- [-1109.284] (-1108.178) (-1107.042) (-1106.682) * (-1106.317) [-1108.967] (-1108.516) (-1108.810) -- 0:01:17
163000 -- (-1106.402) (-1109.827) [-1106.846] (-1106.989) * (-1108.009) (-1108.100) (-1111.005) [-1110.245] -- 0:01:17
163500 -- (-1107.126) (-1106.150) [-1106.852] (-1105.573) * (-1109.847) (-1109.165) (-1107.290) [-1109.113] -- 0:01:16
164000 -- [-1106.574] (-1106.229) (-1106.704) (-1107.016) * [-1106.044] (-1108.806) (-1109.837) (-1109.559) -- 0:01:16
164500 -- [-1106.124] (-1107.799) (-1109.540) (-1106.461) * [-1106.669] (-1107.782) (-1108.226) (-1109.380) -- 0:01:16
165000 -- [-1107.048] (-1108.078) (-1107.754) (-1105.845) * [-1107.421] (-1110.958) (-1105.629) (-1106.453) -- 0:01:15
Average standard deviation of split frequencies: 0.024063
165500 -- (-1109.342) (-1107.996) (-1109.406) [-1106.064] * (-1109.225) (-1108.886) [-1106.903] (-1108.946) -- 0:01:15
166000 -- [-1105.598] (-1106.719) (-1113.039) (-1107.225) * (-1109.094) (-1107.103) [-1109.407] (-1109.387) -- 0:01:15
166500 -- (-1105.427) (-1106.260) [-1109.965] (-1107.345) * (-1109.116) (-1106.384) (-1107.503) [-1108.536] -- 0:01:15
167000 -- [-1107.517] (-1105.689) (-1106.889) (-1106.236) * [-1107.806] (-1105.905) (-1108.348) (-1109.685) -- 0:01:14
167500 -- [-1107.555] (-1108.978) (-1105.307) (-1106.792) * (-1109.530) [-1106.639] (-1108.701) (-1109.379) -- 0:01:14
168000 -- [-1108.552] (-1107.334) (-1108.306) (-1105.964) * (-1118.473) [-1107.460] (-1106.993) (-1110.083) -- 0:01:14
168500 -- (-1106.545) [-1107.102] (-1106.497) (-1107.159) * (-1110.060) [-1106.127] (-1108.833) (-1109.489) -- 0:01:14
169000 -- (-1106.092) (-1111.616) [-1105.402] (-1105.845) * (-1109.277) (-1106.701) [-1109.446] (-1107.186) -- 0:01:13
169500 -- (-1107.411) (-1106.779) (-1105.769) [-1106.943] * (-1109.557) [-1106.459] (-1107.275) (-1106.215) -- 0:01:13
170000 -- (-1108.056) (-1106.779) (-1106.836) [-1106.446] * (-1111.502) (-1105.890) (-1107.412) [-1106.349] -- 0:01:13
Average standard deviation of split frequencies: 0.023171
170500 -- (-1106.070) (-1106.118) [-1110.268] (-1106.324) * (-1109.860) (-1109.785) (-1107.364) [-1106.233] -- 0:01:12
171000 -- (-1105.895) [-1107.495] (-1107.604) (-1105.721) * (-1109.159) [-1108.816] (-1106.777) (-1110.115) -- 0:01:12
171500 -- (-1106.316) (-1108.359) [-1109.281] (-1106.977) * (-1109.859) (-1106.778) [-1107.265] (-1116.709) -- 0:01:12
172000 -- (-1107.762) (-1105.683) (-1108.721) [-1107.380] * (-1105.729) (-1107.780) (-1106.298) [-1108.546] -- 0:01:12
172500 -- [-1106.458] (-1109.191) (-1108.059) (-1105.609) * (-1108.148) (-1107.649) (-1108.292) [-1107.320] -- 0:01:11
173000 -- (-1109.051) (-1106.857) (-1110.167) [-1108.554] * (-1108.579) (-1107.402) [-1105.755] (-1106.702) -- 0:01:16
173500 -- (-1110.702) (-1109.877) (-1107.294) [-1107.510] * (-1108.133) (-1109.600) (-1105.830) [-1105.997] -- 0:01:16
174000 -- (-1114.616) (-1109.086) (-1107.567) [-1106.996] * [-1105.421] (-1106.316) (-1107.383) (-1105.585) -- 0:01:15
174500 -- (-1107.652) (-1108.950) (-1107.190) [-1106.560] * (-1106.977) (-1107.807) [-1108.306] (-1113.227) -- 0:01:15
175000 -- (-1108.552) (-1109.619) (-1107.686) [-1107.277] * (-1109.353) (-1105.473) (-1106.654) [-1106.848] -- 0:01:15
Average standard deviation of split frequencies: 0.023362
175500 -- (-1109.220) (-1109.354) (-1107.792) [-1105.342] * (-1111.229) (-1106.056) [-1108.903] (-1106.540) -- 0:01:15
176000 -- [-1110.804] (-1108.773) (-1105.848) (-1105.452) * [-1108.303] (-1109.478) (-1108.918) (-1107.247) -- 0:01:14
176500 -- (-1107.231) (-1107.601) (-1105.650) [-1106.445] * (-1107.602) [-1106.644] (-1108.584) (-1106.832) -- 0:01:14
177000 -- [-1106.094] (-1107.947) (-1105.918) (-1106.453) * [-1106.779] (-1105.551) (-1108.116) (-1107.064) -- 0:01:14
177500 -- (-1105.080) (-1107.133) [-1107.334] (-1112.324) * (-1107.056) [-1106.888] (-1109.379) (-1111.270) -- 0:01:14
178000 -- (-1105.298) [-1105.920] (-1109.592) (-1113.805) * [-1106.989] (-1108.791) (-1107.881) (-1109.341) -- 0:01:13
178500 -- [-1106.527] (-1106.518) (-1109.223) (-1108.654) * (-1107.586) (-1108.786) (-1113.447) [-1112.523] -- 0:01:13
179000 -- [-1111.722] (-1107.021) (-1108.052) (-1107.630) * (-1109.545) [-1106.069] (-1109.334) (-1106.363) -- 0:01:13
179500 -- (-1106.564) [-1107.004] (-1109.572) (-1107.306) * (-1107.169) (-1106.499) (-1108.896) [-1107.068] -- 0:01:13
180000 -- (-1105.634) [-1107.836] (-1107.681) (-1107.204) * (-1107.632) [-1106.345] (-1108.320) (-1112.531) -- 0:01:12
Average standard deviation of split frequencies: 0.023628
180500 -- [-1105.552] (-1106.957) (-1106.886) (-1109.460) * (-1106.152) (-1107.855) (-1109.471) [-1108.613] -- 0:01:12
181000 -- [-1109.557] (-1107.763) (-1111.136) (-1107.171) * [-1105.738] (-1109.111) (-1108.496) (-1111.109) -- 0:01:12
181500 -- (-1109.148) [-1107.132] (-1109.674) (-1107.208) * (-1106.230) [-1106.677] (-1107.525) (-1107.347) -- 0:01:12
182000 -- [-1107.040] (-1108.860) (-1107.551) (-1106.691) * (-1105.571) [-1106.207] (-1105.906) (-1107.156) -- 0:01:11
182500 -- (-1107.594) (-1109.572) [-1106.611] (-1106.402) * (-1106.808) (-1106.251) [-1109.595] (-1106.588) -- 0:01:11
183000 -- (-1107.063) (-1108.890) [-1105.907] (-1106.726) * (-1106.156) (-1106.565) (-1106.910) [-1105.771] -- 0:01:11
183500 -- (-1109.762) [-1108.797] (-1106.115) (-1106.544) * (-1107.314) (-1106.539) (-1109.827) [-1105.880] -- 0:01:15
184000 -- (-1107.505) (-1108.956) [-1105.332] (-1106.875) * [-1107.386] (-1105.806) (-1109.078) (-1106.725) -- 0:01:15
184500 -- (-1108.158) (-1107.976) (-1105.171) [-1106.960] * (-1107.605) (-1106.773) (-1106.766) [-1107.980] -- 0:01:15
185000 -- (-1107.296) (-1108.100) [-1107.458] (-1109.511) * (-1109.860) (-1105.462) (-1106.105) [-1106.543] -- 0:01:14
Average standard deviation of split frequencies: 0.024010
185500 -- (-1106.065) (-1106.333) [-1108.542] (-1107.896) * [-1109.484] (-1106.354) (-1107.849) (-1109.102) -- 0:01:14
186000 -- [-1106.953] (-1110.207) (-1105.698) (-1111.451) * (-1109.554) (-1106.772) (-1107.609) [-1108.835] -- 0:01:14
186500 -- (-1108.853) (-1108.872) [-1107.666] (-1111.676) * (-1107.999) (-1108.782) (-1108.428) [-1107.396] -- 0:01:14
187000 -- (-1108.067) [-1109.502] (-1107.899) (-1109.323) * (-1106.208) (-1111.961) [-1108.985] (-1108.801) -- 0:01:13
187500 -- (-1107.061) (-1109.205) (-1111.421) [-1105.727] * (-1106.217) (-1108.390) [-1109.009] (-1108.629) -- 0:01:13
188000 -- (-1106.486) [-1109.279] (-1108.372) (-1105.585) * (-1106.357) [-1106.172] (-1107.656) (-1108.919) -- 0:01:13
188500 -- [-1106.007] (-1109.958) (-1105.177) (-1106.815) * (-1106.879) (-1106.836) [-1110.635] (-1107.552) -- 0:01:13
189000 -- (-1105.845) (-1108.115) [-1105.129] (-1108.284) * [-1105.857] (-1107.751) (-1114.327) (-1107.708) -- 0:01:12
189500 -- [-1109.241] (-1108.818) (-1105.131) (-1106.704) * [-1107.250] (-1107.520) (-1107.812) (-1106.760) -- 0:01:12
190000 -- [-1109.460] (-1105.891) (-1109.912) (-1110.923) * (-1108.198) (-1110.024) (-1107.303) [-1105.873] -- 0:01:12
Average standard deviation of split frequencies: 0.023488
190500 -- (-1106.659) [-1107.235] (-1107.132) (-1107.221) * (-1106.954) (-1108.308) [-1106.982] (-1105.365) -- 0:01:12
191000 -- (-1105.940) (-1107.677) (-1109.375) [-1108.083] * (-1107.613) (-1108.856) (-1106.043) [-1105.931] -- 0:01:12
191500 -- (-1105.597) (-1109.349) (-1110.374) [-1107.055] * (-1106.803) (-1111.751) [-1106.175] (-1106.626) -- 0:01:11
192000 -- (-1110.459) [-1108.305] (-1113.461) (-1108.028) * (-1107.584) (-1110.429) [-1107.723] (-1105.688) -- 0:01:11
192500 -- [-1106.918] (-1106.315) (-1110.739) (-1110.155) * [-1105.518] (-1108.039) (-1109.465) (-1110.182) -- 0:01:11
193000 -- (-1106.756) (-1106.374) (-1108.645) [-1106.480] * (-1106.047) [-1107.760] (-1107.920) (-1106.060) -- 0:01:11
193500 -- (-1106.968) [-1106.059] (-1112.413) (-1107.435) * (-1106.162) (-1107.943) (-1107.019) [-1111.520] -- 0:01:10
194000 -- (-1105.439) (-1109.753) (-1113.282) [-1106.619] * [-1106.368] (-1106.443) (-1107.076) (-1112.766) -- 0:01:14
194500 -- (-1107.332) [-1106.954] (-1108.509) (-1105.832) * [-1106.716] (-1106.441) (-1106.086) (-1111.488) -- 0:01:14
195000 -- (-1105.594) (-1113.348) [-1105.893] (-1106.649) * (-1106.317) (-1106.326) (-1109.684) [-1105.865] -- 0:01:14
Average standard deviation of split frequencies: 0.024051
195500 -- (-1105.662) [-1110.744] (-1106.416) (-1108.124) * (-1110.275) (-1105.836) (-1110.272) [-1106.642] -- 0:01:14
196000 -- (-1105.708) [-1109.001] (-1108.163) (-1110.156) * (-1111.105) (-1106.101) (-1107.362) [-1109.947] -- 0:01:13
196500 -- [-1106.875] (-1109.762) (-1110.845) (-1116.378) * [-1108.915] (-1107.345) (-1107.986) (-1108.436) -- 0:01:13
197000 -- (-1106.879) (-1111.721) [-1111.901] (-1109.773) * (-1106.842) (-1106.637) [-1108.202] (-1107.601) -- 0:01:13
197500 -- (-1105.824) (-1107.980) (-1111.889) [-1107.125] * (-1110.773) [-1105.636] (-1109.436) (-1111.380) -- 0:01:13
198000 -- (-1105.454) [-1106.244] (-1111.824) (-1106.982) * (-1106.631) [-1109.989] (-1106.919) (-1107.681) -- 0:01:12
198500 -- (-1106.064) [-1108.242] (-1108.869) (-1106.248) * (-1106.727) (-1109.717) [-1107.109] (-1111.102) -- 0:01:12
199000 -- (-1105.553) [-1105.651] (-1107.124) (-1107.625) * (-1107.526) (-1107.726) [-1109.419] (-1108.762) -- 0:01:12
199500 -- (-1105.535) [-1107.050] (-1106.301) (-1109.532) * (-1107.088) [-1110.357] (-1108.771) (-1107.128) -- 0:01:12
200000 -- (-1106.419) [-1106.336] (-1106.214) (-1105.486) * [-1106.267] (-1106.277) (-1107.780) (-1106.898) -- 0:01:12
Average standard deviation of split frequencies: 0.024275
200500 -- (-1106.335) [-1106.313] (-1110.405) (-1108.843) * (-1107.851) (-1105.946) (-1106.951) [-1107.855] -- 0:01:11
201000 -- (-1107.314) [-1107.202] (-1106.560) (-1107.037) * (-1106.776) (-1107.001) (-1106.984) [-1108.156] -- 0:01:11
201500 -- [-1105.867] (-1111.480) (-1106.654) (-1112.180) * (-1106.818) (-1109.127) [-1106.494] (-1107.647) -- 0:01:11
202000 -- (-1105.980) (-1108.413) (-1109.751) [-1107.733] * (-1108.175) (-1107.693) [-1106.727] (-1106.969) -- 0:01:11
202500 -- (-1107.674) (-1106.584) [-1106.885] (-1106.106) * (-1107.504) [-1111.278] (-1107.746) (-1105.520) -- 0:01:10
203000 -- (-1107.592) (-1106.437) [-1106.129] (-1108.626) * (-1105.606) (-1110.984) [-1107.789] (-1105.541) -- 0:01:10
203500 -- (-1110.364) (-1106.552) [-1105.884] (-1111.948) * [-1108.625] (-1110.315) (-1105.864) (-1106.087) -- 0:01:10
204000 -- (-1107.599) [-1105.546] (-1110.843) (-1110.430) * (-1111.062) (-1110.572) [-1107.455] (-1106.447) -- 0:01:14
204500 -- [-1106.834] (-1106.664) (-1106.960) (-1107.068) * (-1107.952) [-1105.600] (-1110.143) (-1105.633) -- 0:01:13
205000 -- (-1109.206) (-1108.093) [-1107.243] (-1107.018) * (-1105.563) [-1107.582] (-1107.575) (-1105.815) -- 0:01:13
Average standard deviation of split frequencies: 0.023341
205500 -- (-1110.567) [-1109.353] (-1107.912) (-1106.181) * [-1106.961] (-1108.468) (-1105.891) (-1105.125) -- 0:01:13
206000 -- (-1110.516) [-1109.590] (-1107.760) (-1108.966) * (-1105.867) (-1110.121) [-1106.112] (-1106.969) -- 0:01:13
206500 -- (-1107.349) (-1110.564) (-1106.660) [-1105.897] * [-1109.123] (-1108.532) (-1106.294) (-1105.642) -- 0:01:13
207000 -- [-1105.345] (-1107.860) (-1105.847) (-1112.699) * [-1108.780] (-1106.507) (-1110.993) (-1109.147) -- 0:01:12
207500 -- (-1105.343) [-1110.175] (-1106.475) (-1105.842) * [-1106.214] (-1107.372) (-1107.476) (-1105.683) -- 0:01:12
208000 -- (-1107.093) (-1107.950) [-1107.067] (-1105.660) * [-1106.456] (-1108.830) (-1109.762) (-1105.840) -- 0:01:12
208500 -- (-1105.585) (-1106.887) [-1111.794] (-1107.728) * (-1112.917) (-1108.710) (-1107.376) [-1106.453] -- 0:01:12
209000 -- (-1105.554) (-1107.660) (-1108.859) [-1105.646] * (-1108.123) [-1105.626] (-1107.732) (-1106.211) -- 0:01:11
209500 -- [-1106.342] (-1107.695) (-1107.695) (-1106.544) * (-1110.314) (-1106.299) [-1109.079] (-1105.159) -- 0:01:11
210000 -- [-1106.611] (-1106.634) (-1105.274) (-1108.632) * (-1111.264) [-1107.214] (-1108.166) (-1105.311) -- 0:01:11
Average standard deviation of split frequencies: 0.025236
210500 -- (-1108.452) (-1107.753) [-1106.400] (-1105.989) * (-1110.506) [-1106.559] (-1109.518) (-1106.243) -- 0:01:11
211000 -- [-1107.160] (-1107.692) (-1107.766) (-1106.038) * (-1107.101) (-1107.407) [-1110.295] (-1107.241) -- 0:01:11
211500 -- (-1106.935) [-1107.745] (-1106.362) (-1108.652) * (-1108.039) [-1107.796] (-1108.914) (-1108.128) -- 0:01:10
212000 -- (-1106.389) [-1107.980] (-1106.262) (-1110.311) * (-1111.126) (-1108.235) (-1106.343) [-1108.185] -- 0:01:10
212500 -- (-1108.752) [-1107.412] (-1106.186) (-1106.349) * [-1106.824] (-1107.392) (-1107.097) (-1108.476) -- 0:01:10
213000 -- [-1109.377] (-1107.377) (-1105.785) (-1106.605) * (-1106.545) (-1106.666) (-1107.513) [-1106.590] -- 0:01:10
213500 -- (-1107.830) (-1110.744) [-1106.508] (-1106.289) * [-1105.461] (-1105.858) (-1107.102) (-1107.354) -- 0:01:09
214000 -- (-1112.071) (-1111.220) [-1106.453] (-1107.459) * (-1108.067) [-1106.691] (-1108.928) (-1107.477) -- 0:01:09
214500 -- (-1107.008) (-1107.791) [-1110.597] (-1107.626) * (-1110.038) (-1105.911) [-1107.007] (-1111.817) -- 0:01:09
215000 -- (-1107.533) [-1107.011] (-1113.337) (-1105.636) * (-1108.807) (-1106.815) (-1107.918) [-1108.002] -- 0:01:09
Average standard deviation of split frequencies: 0.023279
215500 -- [-1107.369] (-1107.438) (-1107.081) (-1106.173) * [-1110.369] (-1106.628) (-1106.089) (-1108.151) -- 0:01:12
216000 -- (-1111.080) [-1111.100] (-1106.200) (-1106.935) * (-1112.176) (-1106.137) [-1112.493] (-1108.008) -- 0:01:12
216500 -- (-1105.848) [-1107.779] (-1106.828) (-1107.262) * [-1109.338] (-1105.935) (-1110.121) (-1107.217) -- 0:01:12
217000 -- (-1107.433) (-1107.294) (-1107.685) [-1106.415] * [-1107.613] (-1109.795) (-1109.860) (-1107.725) -- 0:01:12
217500 -- (-1108.163) (-1106.706) (-1107.233) [-1106.352] * (-1105.926) [-1108.095] (-1110.139) (-1110.315) -- 0:01:11
218000 -- [-1106.397] (-1108.735) (-1108.527) (-1110.730) * (-1105.196) [-1105.763] (-1108.624) (-1109.994) -- 0:01:11
218500 -- (-1107.522) [-1109.985] (-1110.008) (-1109.937) * [-1106.061] (-1109.208) (-1108.794) (-1108.485) -- 0:01:11
219000 -- (-1107.549) [-1110.000] (-1107.282) (-1106.092) * [-1105.415] (-1106.788) (-1109.044) (-1107.388) -- 0:01:11
219500 -- (-1107.754) [-1109.112] (-1110.886) (-1105.528) * [-1112.006] (-1112.219) (-1112.269) (-1105.940) -- 0:01:11
220000 -- (-1108.026) [-1111.282] (-1106.377) (-1107.165) * [-1108.603] (-1106.737) (-1107.458) (-1106.425) -- 0:01:10
Average standard deviation of split frequencies: 0.022937
220500 -- (-1105.538) (-1110.620) (-1105.670) [-1108.571] * (-1108.518) (-1108.596) [-1106.950] (-1106.682) -- 0:01:10
221000 -- (-1106.443) (-1107.936) [-1108.857] (-1108.599) * [-1107.887] (-1107.056) (-1107.603) (-1109.499) -- 0:01:10
221500 -- (-1107.041) (-1108.277) (-1108.009) [-1107.676] * [-1106.280] (-1106.435) (-1106.538) (-1106.853) -- 0:01:10
222000 -- (-1107.296) (-1111.637) (-1107.735) [-1106.128] * (-1106.988) (-1108.272) [-1107.714] (-1106.386) -- 0:01:10
222500 -- (-1113.697) (-1106.538) [-1106.316] (-1109.341) * (-1107.391) [-1107.943] (-1106.572) (-1107.226) -- 0:01:09
223000 -- (-1110.716) [-1105.516] (-1105.999) (-1106.625) * [-1106.816] (-1109.022) (-1109.736) (-1108.005) -- 0:01:09
223500 -- (-1109.295) (-1105.516) [-1106.459] (-1105.152) * (-1107.306) [-1107.681] (-1106.419) (-1108.155) -- 0:01:09
224000 -- (-1108.051) [-1111.753] (-1107.914) (-1106.370) * (-1106.909) (-1106.715) [-1108.753] (-1108.351) -- 0:01:09
224500 -- [-1106.933] (-1110.434) (-1106.865) (-1107.424) * [-1108.946] (-1108.045) (-1108.369) (-1106.975) -- 0:01:09
225000 -- [-1107.484] (-1110.071) (-1106.928) (-1107.860) * (-1106.823) [-1109.777] (-1107.926) (-1105.149) -- 0:01:08
Average standard deviation of split frequencies: 0.023153
225500 -- [-1106.726] (-1108.981) (-1107.373) (-1109.251) * (-1107.060) (-1110.119) (-1107.570) [-1105.490] -- 0:01:08
226000 -- [-1108.688] (-1110.444) (-1105.819) (-1110.132) * (-1106.105) [-1110.592] (-1109.902) (-1105.594) -- 0:01:11
226500 -- (-1105.883) [-1107.529] (-1109.211) (-1106.611) * (-1105.416) [-1107.598] (-1109.964) (-1107.127) -- 0:01:11
227000 -- (-1105.950) (-1107.186) (-1109.790) [-1105.502] * (-1107.468) [-1107.455] (-1108.728) (-1108.604) -- 0:01:11
227500 -- (-1106.916) [-1107.787] (-1107.240) (-1111.872) * (-1105.734) (-1111.841) (-1110.403) [-1106.938] -- 0:01:11
228000 -- [-1107.400] (-1106.045) (-1111.070) (-1108.089) * (-1108.136) [-1106.171] (-1108.723) (-1106.577) -- 0:01:11
228500 -- (-1106.907) (-1107.529) [-1108.928] (-1110.125) * [-1107.609] (-1105.802) (-1109.697) (-1107.913) -- 0:01:10
229000 -- [-1106.844] (-1111.531) (-1108.919) (-1110.411) * (-1105.583) [-1106.712] (-1110.131) (-1106.923) -- 0:01:10
229500 -- (-1108.273) (-1111.340) [-1106.133] (-1107.085) * (-1105.487) (-1105.677) [-1107.443] (-1107.093) -- 0:01:10
230000 -- (-1107.592) (-1107.887) [-1106.426] (-1105.679) * (-1105.658) (-1106.541) [-1107.667] (-1108.156) -- 0:01:10
Average standard deviation of split frequencies: 0.021969
230500 -- (-1105.712) (-1107.066) (-1108.399) [-1107.324] * (-1106.674) (-1107.369) [-1109.310] (-1105.611) -- 0:01:10
231000 -- (-1108.350) (-1105.992) [-1106.663] (-1106.670) * (-1107.024) (-1109.074) [-1106.894] (-1106.955) -- 0:01:09
231500 -- (-1106.350) (-1105.832) (-1108.260) [-1106.665] * (-1107.371) (-1109.146) (-1107.171) [-1105.959] -- 0:01:09
232000 -- (-1106.006) (-1105.591) (-1107.238) [-1106.456] * (-1107.932) (-1108.332) [-1108.089] (-1106.276) -- 0:01:09
232500 -- (-1106.381) (-1108.192) [-1106.411] (-1106.452) * (-1110.724) (-1107.696) [-1107.372] (-1107.635) -- 0:01:09
233000 -- (-1106.444) [-1106.340] (-1107.407) (-1106.056) * [-1106.394] (-1107.881) (-1106.636) (-1108.203) -- 0:01:09
233500 -- (-1106.821) (-1105.935) (-1108.373) [-1105.288] * [-1106.845] (-1108.265) (-1110.905) (-1106.296) -- 0:01:08
234000 -- (-1106.374) [-1105.571] (-1106.007) (-1105.940) * (-1106.896) [-1107.840] (-1108.755) (-1108.150) -- 0:01:08
234500 -- [-1106.326] (-1105.655) (-1105.894) (-1105.361) * (-1106.033) (-1106.067) [-1109.823] (-1111.710) -- 0:01:08
235000 -- (-1106.324) (-1106.872) [-1106.107] (-1106.551) * (-1106.571) (-1108.085) [-1108.211] (-1110.125) -- 0:01:08
Average standard deviation of split frequencies: 0.021772
235500 -- (-1106.879) (-1107.418) (-1116.391) [-1109.401] * (-1108.187) [-1106.244] (-1107.976) (-1109.732) -- 0:01:11
236000 -- (-1107.136) [-1107.063] (-1108.908) (-1107.146) * (-1105.305) (-1105.977) [-1108.608] (-1107.463) -- 0:01:11
236500 -- (-1107.033) (-1107.464) [-1111.182] (-1110.621) * (-1107.300) (-1105.831) (-1110.378) [-1107.554] -- 0:01:11
237000 -- [-1107.118] (-1108.437) (-1110.653) (-1108.848) * [-1106.333] (-1106.464) (-1108.906) (-1108.956) -- 0:01:10
237500 -- (-1109.087) (-1106.076) (-1106.381) [-1105.807] * (-1106.434) [-1105.361] (-1110.413) (-1105.876) -- 0:01:10
238000 -- [-1106.120] (-1108.362) (-1108.987) (-1106.498) * (-1106.252) [-1107.274] (-1109.953) (-1113.709) -- 0:01:10
238500 -- [-1106.372] (-1108.744) (-1109.091) (-1108.607) * [-1105.348] (-1106.065) (-1114.419) (-1108.436) -- 0:01:10
239000 -- [-1105.800] (-1107.038) (-1110.160) (-1107.995) * (-1106.989) [-1106.918] (-1108.049) (-1110.838) -- 0:01:10
239500 -- [-1106.773] (-1106.977) (-1110.660) (-1106.869) * [-1106.562] (-1106.242) (-1108.901) (-1106.172) -- 0:01:09
240000 -- (-1108.275) [-1106.382] (-1111.071) (-1107.957) * (-1108.661) [-1105.642] (-1108.043) (-1106.837) -- 0:01:09
Average standard deviation of split frequencies: 0.022036
240500 -- (-1109.148) (-1106.033) (-1112.157) [-1106.230] * (-1109.553) [-1107.512] (-1105.714) (-1106.984) -- 0:01:09
241000 -- [-1108.397] (-1107.133) (-1110.338) (-1109.768) * (-1108.361) [-1105.361] (-1106.052) (-1107.673) -- 0:01:09
241500 -- (-1108.356) (-1108.625) [-1109.155] (-1106.932) * (-1107.718) [-1105.922] (-1109.607) (-1109.282) -- 0:01:09
242000 -- (-1108.517) [-1107.684] (-1110.401) (-1107.806) * (-1109.262) (-1107.000) [-1111.038] (-1107.703) -- 0:01:08
242500 -- (-1108.136) [-1105.234] (-1108.652) (-1107.544) * [-1110.277] (-1110.184) (-1107.139) (-1106.217) -- 0:01:08
243000 -- (-1107.100) [-1106.366] (-1107.926) (-1107.489) * (-1111.375) (-1107.310) (-1106.699) [-1108.122] -- 0:01:08
243500 -- [-1107.951] (-1107.817) (-1106.468) (-1108.112) * (-1107.427) (-1107.891) [-1108.673] (-1106.296) -- 0:01:08
244000 -- [-1106.855] (-1110.876) (-1105.715) (-1107.686) * (-1105.753) (-1109.033) [-1106.308] (-1107.855) -- 0:01:08
244500 -- (-1106.179) (-1107.796) [-1107.012] (-1108.896) * [-1106.218] (-1107.248) (-1106.838) (-1106.213) -- 0:01:07
245000 -- (-1107.154) (-1107.844) [-1106.194] (-1105.642) * [-1106.126] (-1107.056) (-1107.540) (-1106.702) -- 0:01:07
Average standard deviation of split frequencies: 0.020792
245500 -- (-1108.538) (-1108.530) (-1105.804) [-1106.377] * [-1106.986] (-1106.366) (-1105.337) (-1105.692) -- 0:01:07
246000 -- (-1110.252) (-1108.905) [-1107.681] (-1106.872) * (-1110.160) (-1107.831) [-1106.601] (-1105.468) -- 0:01:07
246500 -- (-1107.591) (-1111.107) (-1107.231) [-1106.611] * (-1108.683) [-1105.543] (-1106.840) (-1107.182) -- 0:01:07
247000 -- [-1107.531] (-1107.379) (-1107.513) (-1108.408) * (-1105.436) [-1105.485] (-1106.078) (-1107.962) -- 0:01:10
247500 -- (-1106.297) (-1108.124) [-1106.837] (-1108.303) * [-1110.067] (-1106.948) (-1108.021) (-1109.239) -- 0:01:09
248000 -- [-1106.020] (-1107.300) (-1107.569) (-1115.409) * [-1109.037] (-1111.401) (-1106.815) (-1108.442) -- 0:01:09
248500 -- (-1113.910) (-1109.942) (-1111.992) [-1105.392] * (-1107.816) (-1108.522) [-1107.153] (-1114.130) -- 0:01:09
249000 -- (-1107.844) (-1108.720) (-1107.565) [-1106.752] * (-1108.231) [-1105.352] (-1105.745) (-1111.506) -- 0:01:09
249500 -- (-1107.864) (-1106.421) (-1110.807) [-1106.467] * (-1112.482) [-1107.347] (-1106.583) (-1112.841) -- 0:01:09
250000 -- (-1110.803) [-1106.050] (-1106.592) (-1106.470) * (-1110.797) (-1107.823) (-1110.243) [-1105.487] -- 0:01:09
Average standard deviation of split frequencies: 0.019796
250500 -- (-1107.036) [-1106.063] (-1107.163) (-1109.019) * (-1109.073) [-1106.271] (-1105.270) (-1105.977) -- 0:01:08
251000 -- (-1109.268) (-1109.261) [-1106.307] (-1111.088) * [-1106.249] (-1105.906) (-1107.404) (-1105.947) -- 0:01:08
251500 -- (-1106.249) (-1109.419) (-1107.599) [-1106.562] * [-1107.894] (-1106.442) (-1106.922) (-1105.842) -- 0:01:08
252000 -- [-1107.216] (-1106.445) (-1109.832) (-1108.651) * [-1108.365] (-1107.996) (-1106.077) (-1105.317) -- 0:01:08
252500 -- (-1106.515) (-1109.208) (-1112.617) [-1112.115] * (-1109.454) [-1107.305] (-1107.915) (-1105.379) -- 0:01:08
253000 -- (-1106.394) (-1109.193) [-1111.965] (-1107.280) * (-1106.878) (-1107.233) (-1108.324) [-1106.353] -- 0:01:07
253500 -- [-1107.769] (-1112.818) (-1106.071) (-1107.280) * (-1109.578) (-1111.360) [-1107.964] (-1107.563) -- 0:01:07
254000 -- (-1108.401) [-1105.975] (-1106.688) (-1109.210) * (-1110.207) (-1109.341) [-1106.900] (-1107.731) -- 0:01:07
254500 -- (-1106.669) [-1107.934] (-1107.923) (-1109.321) * (-1110.680) (-1108.424) (-1107.874) [-1106.398] -- 0:01:07
255000 -- (-1107.319) [-1106.785] (-1107.094) (-1108.671) * (-1106.078) [-1107.487] (-1109.219) (-1108.962) -- 0:01:07
Average standard deviation of split frequencies: 0.018198
255500 -- [-1108.025] (-1108.366) (-1106.287) (-1107.503) * [-1108.590] (-1107.459) (-1109.127) (-1109.957) -- 0:01:07
256000 -- [-1105.774] (-1106.657) (-1109.536) (-1108.280) * (-1106.123) (-1107.176) (-1107.114) [-1108.087] -- 0:01:06
256500 -- (-1109.051) (-1105.465) (-1109.868) [-1108.005] * (-1105.655) (-1112.493) [-1106.682] (-1107.771) -- 0:01:06
257000 -- [-1110.464] (-1106.239) (-1108.744) (-1107.967) * [-1105.681] (-1107.771) (-1107.369) (-1110.691) -- 0:01:06
257500 -- (-1110.821) (-1107.136) [-1107.372] (-1108.502) * [-1106.532] (-1108.774) (-1109.203) (-1108.023) -- 0:01:06
258000 -- [-1110.841] (-1106.370) (-1108.008) (-1113.465) * (-1106.519) (-1111.633) [-1107.320] (-1111.040) -- 0:01:06
258500 -- [-1110.049] (-1108.003) (-1109.413) (-1109.526) * (-1106.180) (-1108.250) (-1105.045) [-1109.680] -- 0:01:08
259000 -- (-1108.180) (-1107.331) (-1107.668) [-1107.226] * (-1110.273) (-1107.042) [-1105.437] (-1107.964) -- 0:01:08
259500 -- (-1111.203) [-1106.961] (-1109.527) (-1109.107) * (-1105.576) (-1109.720) (-1108.259) [-1110.607] -- 0:01:08
260000 -- [-1109.157] (-1107.217) (-1108.796) (-1107.097) * (-1107.349) [-1111.077] (-1109.623) (-1107.046) -- 0:01:08
Average standard deviation of split frequencies: 0.019993
260500 -- [-1110.517] (-1109.573) (-1106.040) (-1109.741) * (-1115.466) (-1107.025) (-1108.582) [-1106.730] -- 0:01:08
261000 -- (-1107.708) (-1106.096) [-1107.613] (-1109.482) * [-1105.616] (-1107.374) (-1106.913) (-1108.654) -- 0:01:07
261500 -- [-1110.199] (-1108.561) (-1108.496) (-1107.318) * (-1107.347) (-1105.142) [-1107.346] (-1111.764) -- 0:01:07
262000 -- (-1108.562) (-1106.841) [-1107.543] (-1108.144) * [-1106.426] (-1107.772) (-1105.953) (-1113.937) -- 0:01:07
262500 -- [-1107.796] (-1109.882) (-1105.754) (-1105.955) * [-1106.003] (-1107.066) (-1108.458) (-1114.826) -- 0:01:07
263000 -- (-1105.844) (-1106.753) [-1106.102] (-1107.679) * (-1106.275) [-1107.359] (-1107.275) (-1109.886) -- 0:01:07
263500 -- (-1106.402) [-1111.052] (-1105.536) (-1107.333) * (-1107.484) [-1106.962] (-1110.327) (-1106.248) -- 0:01:07
264000 -- [-1107.264] (-1110.253) (-1109.385) (-1107.845) * (-1105.530) (-1106.040) (-1108.745) [-1106.206] -- 0:01:06
264500 -- (-1106.418) (-1113.164) (-1110.267) [-1107.397] * (-1106.790) (-1107.083) (-1109.810) [-1106.079] -- 0:01:06
265000 -- (-1106.547) [-1106.070] (-1106.548) (-1107.434) * (-1108.261) [-1110.480] (-1110.421) (-1106.169) -- 0:01:06
Average standard deviation of split frequencies: 0.019140
265500 -- (-1106.518) (-1112.511) [-1108.264] (-1109.581) * (-1109.408) (-1108.924) [-1106.265] (-1108.469) -- 0:01:06
266000 -- (-1108.640) [-1111.236] (-1106.076) (-1106.641) * (-1106.941) (-1109.188) [-1106.713] (-1108.090) -- 0:01:06
266500 -- (-1109.277) (-1108.154) (-1106.032) [-1106.406] * (-1107.619) [-1111.324] (-1107.351) (-1107.078) -- 0:01:06
267000 -- (-1107.823) (-1106.078) [-1106.776] (-1107.804) * (-1108.034) [-1108.545] (-1107.836) (-1106.911) -- 0:01:05
267500 -- (-1111.216) (-1106.488) (-1109.052) [-1107.818] * (-1110.702) (-1110.299) [-1106.356] (-1110.377) -- 0:01:05
268000 -- (-1105.918) [-1105.950] (-1106.376) (-1107.513) * (-1108.047) (-1108.849) [-1107.901] (-1109.121) -- 0:01:05
268500 -- [-1105.508] (-1109.470) (-1106.899) (-1106.787) * (-1113.117) [-1105.834] (-1105.904) (-1107.784) -- 0:01:05
269000 -- (-1107.459) [-1108.844] (-1108.364) (-1106.019) * (-1107.154) (-1105.764) [-1105.819] (-1108.255) -- 0:01:05
269500 -- (-1105.838) (-1106.726) (-1106.694) [-1105.538] * (-1105.670) [-1105.838] (-1106.040) (-1112.626) -- 0:01:05
270000 -- (-1107.859) (-1107.307) [-1106.857] (-1105.636) * (-1105.633) [-1105.551] (-1106.131) (-1115.604) -- 0:01:04
Average standard deviation of split frequencies: 0.018791
270500 -- (-1106.499) (-1105.609) [-1108.244] (-1106.427) * (-1106.786) [-1105.884] (-1109.519) (-1109.110) -- 0:01:07
271000 -- (-1108.479) [-1108.011] (-1108.829) (-1106.840) * (-1107.676) [-1105.611] (-1107.668) (-1110.455) -- 0:01:07
271500 -- (-1105.691) (-1105.893) [-1108.912] (-1107.215) * (-1107.462) (-1105.929) [-1105.840] (-1112.868) -- 0:01:07
272000 -- (-1107.170) [-1108.524] (-1106.967) (-1108.448) * (-1107.102) (-1106.734) [-1105.615] (-1106.180) -- 0:01:06
272500 -- (-1108.971) (-1106.507) [-1110.650] (-1108.803) * [-1107.144] (-1106.358) (-1105.564) (-1109.177) -- 0:01:06
273000 -- [-1106.560] (-1107.005) (-1112.856) (-1108.153) * (-1106.793) [-1106.374] (-1105.687) (-1108.911) -- 0:01:06
273500 -- (-1108.845) [-1107.812] (-1112.477) (-1106.824) * (-1106.177) (-1110.420) (-1107.352) [-1109.385] -- 0:01:06
274000 -- (-1110.906) [-1107.475] (-1107.965) (-1106.953) * (-1108.549) [-1109.831] (-1107.654) (-1107.018) -- 0:01:06
274500 -- (-1110.574) (-1107.687) (-1106.614) [-1105.383] * (-1108.593) (-1105.504) (-1107.585) [-1106.069] -- 0:01:06
275000 -- [-1108.625] (-1105.368) (-1105.604) (-1105.369) * (-1110.888) (-1107.237) (-1106.097) [-1106.907] -- 0:01:05
Average standard deviation of split frequencies: 0.018286
275500 -- (-1108.353) (-1108.652) (-1107.399) [-1106.642] * (-1107.716) (-1107.147) [-1107.599] (-1106.415) -- 0:01:05
276000 -- (-1108.256) (-1108.100) [-1105.836] (-1106.748) * (-1111.048) (-1106.398) (-1107.608) [-1107.101] -- 0:01:05
276500 -- (-1107.401) (-1107.380) (-1105.837) [-1107.045] * (-1106.328) (-1106.244) [-1107.389] (-1106.501) -- 0:01:05
277000 -- [-1105.731] (-1107.814) (-1109.596) (-1105.430) * [-1109.002] (-1108.903) (-1106.199) (-1114.373) -- 0:01:05
277500 -- (-1106.691) (-1110.651) [-1108.432] (-1107.358) * [-1106.989] (-1106.114) (-1107.486) (-1113.044) -- 0:01:05
278000 -- (-1112.052) (-1110.396) [-1105.478] (-1106.637) * [-1106.683] (-1117.057) (-1107.603) (-1109.396) -- 0:01:04
278500 -- (-1115.960) (-1108.764) [-1105.666] (-1105.571) * (-1106.002) (-1108.152) (-1109.757) [-1107.365] -- 0:01:04
279000 -- (-1108.503) (-1108.033) (-1111.598) [-1105.493] * (-1105.649) (-1111.763) (-1107.597) [-1107.034] -- 0:01:04
279500 -- [-1105.681] (-1110.742) (-1108.026) (-1106.203) * (-1106.257) (-1109.130) [-1106.887] (-1107.038) -- 0:01:04
280000 -- [-1109.744] (-1107.707) (-1108.765) (-1107.398) * (-1107.730) [-1109.510] (-1106.366) (-1108.792) -- 0:01:04
Average standard deviation of split frequencies: 0.016993
280500 -- [-1108.737] (-1107.399) (-1109.393) (-1108.026) * (-1108.947) [-1107.237] (-1106.300) (-1110.644) -- 0:01:04
281000 -- (-1109.237) (-1108.474) [-1107.239] (-1108.623) * (-1114.358) (-1108.302) [-1107.291] (-1108.985) -- 0:01:06
281500 -- (-1108.509) (-1106.489) (-1105.324) [-1105.412] * [-1107.432] (-1105.836) (-1107.873) (-1105.750) -- 0:01:06
282000 -- (-1108.794) (-1105.759) (-1108.782) [-1105.409] * (-1109.604) (-1107.151) (-1113.794) [-1106.334] -- 0:01:06
282500 -- (-1107.804) (-1107.326) (-1106.793) [-1105.435] * (-1107.550) (-1106.707) [-1109.435] (-1105.908) -- 0:01:06
283000 -- (-1109.327) (-1106.598) (-1106.868) [-1107.003] * (-1107.974) [-1106.301] (-1107.915) (-1110.655) -- 0:01:05
283500 -- (-1107.982) (-1110.342) (-1108.230) [-1111.618] * (-1106.599) [-1107.040] (-1108.752) (-1108.097) -- 0:01:05
284000 -- (-1109.749) [-1115.996] (-1109.324) (-1109.245) * (-1108.393) [-1107.369] (-1106.549) (-1107.204) -- 0:01:05
284500 -- (-1108.607) (-1113.026) [-1107.030] (-1107.466) * [-1107.065] (-1108.307) (-1107.685) (-1108.434) -- 0:01:05
285000 -- (-1107.597) (-1113.446) (-1106.360) [-1106.220] * (-1109.548) (-1107.445) (-1108.899) [-1106.941] -- 0:01:05
Average standard deviation of split frequencies: 0.016757
285500 -- (-1111.982) (-1109.650) (-1106.663) [-1107.255] * (-1109.833) (-1109.360) [-1107.190] (-1105.975) -- 0:01:05
286000 -- [-1111.291] (-1109.943) (-1107.924) (-1107.372) * (-1117.087) (-1107.827) (-1108.332) [-1108.670] -- 0:01:04
286500 -- (-1107.141) (-1108.631) (-1109.317) [-1106.869] * [-1109.240] (-1106.758) (-1106.515) (-1108.937) -- 0:01:04
287000 -- [-1106.088] (-1109.191) (-1108.060) (-1108.133) * (-1109.003) (-1107.525) (-1106.952) [-1105.799] -- 0:01:04
287500 -- [-1106.085] (-1108.401) (-1107.738) (-1105.973) * (-1106.577) [-1105.928] (-1106.931) (-1108.245) -- 0:01:04
288000 -- (-1106.759) [-1112.574] (-1106.586) (-1107.278) * [-1107.042] (-1108.457) (-1106.717) (-1107.131) -- 0:01:04
288500 -- (-1108.763) (-1108.371) [-1107.466] (-1108.146) * (-1107.612) [-1106.067] (-1111.257) (-1106.658) -- 0:01:04
289000 -- (-1105.887) (-1108.992) (-1108.323) [-1108.573] * (-1107.715) (-1105.612) [-1106.339] (-1109.304) -- 0:01:03
289500 -- (-1105.816) (-1108.956) (-1110.455) [-1106.700] * (-1113.133) (-1107.111) [-1106.370] (-1113.732) -- 0:01:03
290000 -- [-1105.813] (-1105.919) (-1106.524) (-1107.640) * (-1108.099) [-1106.036] (-1106.530) (-1111.425) -- 0:01:03
Average standard deviation of split frequencies: 0.016488
290500 -- (-1112.386) (-1105.430) [-1106.250] (-1109.746) * (-1107.614) (-1105.363) (-1106.926) [-1112.668] -- 0:01:05
291000 -- [-1107.013] (-1106.180) (-1107.005) (-1113.104) * (-1105.787) [-1107.223] (-1107.506) (-1112.643) -- 0:01:05
291500 -- [-1105.915] (-1107.407) (-1105.789) (-1109.724) * [-1105.706] (-1106.758) (-1112.434) (-1105.858) -- 0:01:05
292000 -- (-1106.814) [-1106.819] (-1105.959) (-1110.382) * (-1105.734) [-1105.639] (-1106.973) (-1107.343) -- 0:01:05
292500 -- (-1106.207) (-1110.536) [-1105.942] (-1105.670) * (-1105.784) (-1112.352) (-1105.893) [-1112.193] -- 0:01:05
293000 -- (-1107.761) (-1109.007) (-1106.883) [-1107.100] * (-1105.758) (-1108.582) [-1105.779] (-1112.137) -- 0:01:05
293500 -- (-1111.279) (-1107.966) (-1105.746) [-1105.623] * (-1108.195) (-1109.946) (-1110.784) [-1109.685] -- 0:01:04
294000 -- [-1105.875] (-1111.324) (-1107.465) (-1106.698) * (-1109.550) (-1109.573) (-1106.813) [-1110.772] -- 0:01:04
294500 -- [-1107.414] (-1107.877) (-1106.986) (-1107.098) * (-1108.464) (-1107.377) [-1107.681] (-1110.798) -- 0:01:04
295000 -- (-1107.442) (-1107.551) [-1106.919] (-1105.367) * [-1107.048] (-1107.674) (-1107.688) (-1110.660) -- 0:01:04
Average standard deviation of split frequencies: 0.016207
295500 -- (-1107.888) (-1107.181) (-1112.505) [-1105.422] * (-1105.617) [-1107.797] (-1105.967) (-1105.958) -- 0:01:04
296000 -- (-1109.066) (-1106.921) [-1107.519] (-1105.387) * (-1109.398) (-1105.395) [-1105.967] (-1106.515) -- 0:01:04
296500 -- (-1110.897) (-1109.442) [-1107.084] (-1105.048) * (-1107.928) (-1105.858) (-1107.536) [-1107.348] -- 0:01:04
297000 -- (-1106.465) (-1105.772) (-1107.352) [-1106.617] * (-1108.423) (-1108.567) (-1107.886) [-1107.218] -- 0:01:03
297500 -- (-1106.664) [-1106.972] (-1105.850) (-1107.325) * (-1107.819) (-1107.994) (-1108.195) [-1107.757] -- 0:01:03
298000 -- (-1109.825) [-1109.021] (-1106.360) (-1108.258) * (-1106.638) (-1110.419) [-1106.614] (-1107.405) -- 0:01:03
298500 -- (-1109.154) (-1114.191) [-1106.972] (-1107.648) * (-1112.328) (-1106.418) (-1105.492) [-1107.505] -- 0:01:03
299000 -- [-1107.245] (-1110.988) (-1108.399) (-1109.855) * (-1110.787) (-1106.294) (-1106.651) [-1106.780] -- 0:01:03
299500 -- (-1111.591) (-1108.243) (-1107.372) [-1108.281] * [-1108.340] (-1107.146) (-1107.020) (-1106.648) -- 0:01:03
300000 -- (-1107.373) [-1113.768] (-1106.764) (-1111.538) * (-1109.546) [-1106.005] (-1107.166) (-1107.346) -- 0:01:05
Average standard deviation of split frequencies: 0.015417
300500 -- (-1106.326) (-1113.431) (-1106.309) [-1108.694] * (-1109.944) [-1106.845] (-1108.441) (-1109.202) -- 0:01:05
301000 -- (-1106.250) (-1110.051) (-1105.924) [-1106.513] * (-1110.005) (-1107.869) [-1107.595] (-1106.942) -- 0:01:05
301500 -- [-1107.726] (-1106.076) (-1110.836) (-1107.978) * (-1106.761) (-1107.330) [-1107.050] (-1107.446) -- 0:01:04
302000 -- (-1109.298) (-1108.370) (-1107.714) [-1106.653] * [-1106.888] (-1108.632) (-1110.974) (-1107.109) -- 0:01:04
302500 -- (-1110.983) (-1110.010) (-1113.545) [-1106.604] * (-1108.919) (-1108.427) [-1106.445] (-1105.091) -- 0:01:04
303000 -- (-1109.943) [-1108.368] (-1110.796) (-1106.802) * [-1106.737] (-1108.538) (-1107.560) (-1106.313) -- 0:01:04
303500 -- [-1107.546] (-1109.456) (-1108.640) (-1109.321) * (-1107.558) (-1106.529) (-1106.042) [-1106.335] -- 0:01:04
304000 -- (-1106.509) (-1110.870) (-1107.049) [-1107.501] * [-1108.748] (-1107.762) (-1110.313) (-1106.009) -- 0:01:04
304500 -- (-1105.325) [-1108.363] (-1108.778) (-1107.116) * (-1105.854) (-1105.446) (-1109.413) [-1105.961] -- 0:01:03
305000 -- (-1107.087) (-1109.931) (-1107.799) [-1107.437] * (-1107.539) (-1108.633) [-1108.206] (-1106.054) -- 0:01:03
Average standard deviation of split frequencies: 0.016689
305500 -- (-1108.386) (-1107.963) [-1106.630] (-1114.337) * [-1106.533] (-1107.050) (-1106.207) (-1107.691) -- 0:01:03
306000 -- [-1107.355] (-1109.556) (-1106.854) (-1115.247) * (-1107.988) (-1106.969) [-1106.991] (-1108.432) -- 0:01:03
306500 -- (-1107.576) (-1105.619) [-1105.055] (-1106.162) * (-1107.983) (-1107.223) [-1107.801] (-1110.099) -- 0:01:03
307000 -- (-1113.290) (-1108.879) (-1108.365) [-1105.396] * (-1108.790) [-1107.299] (-1110.417) (-1110.908) -- 0:01:03
307500 -- (-1113.195) (-1106.411) (-1111.535) [-1106.889] * (-1105.715) (-1110.558) [-1106.483] (-1111.638) -- 0:01:03
308000 -- (-1106.630) [-1106.392] (-1112.811) (-1110.231) * [-1106.288] (-1118.432) (-1106.521) (-1108.526) -- 0:01:02
308500 -- (-1106.399) (-1106.531) (-1107.986) [-1107.334] * (-1105.331) (-1112.674) (-1105.705) [-1105.753] -- 0:01:02
309000 -- (-1107.229) (-1107.110) (-1107.638) [-1107.841] * [-1106.204] (-1109.708) (-1106.573) (-1106.813) -- 0:01:04
309500 -- (-1106.326) (-1107.860) [-1107.644] (-1107.285) * [-1107.103] (-1110.525) (-1106.726) (-1109.933) -- 0:01:04
310000 -- (-1105.641) [-1107.880] (-1111.347) (-1106.472) * (-1107.282) (-1105.372) (-1109.572) [-1107.559] -- 0:01:04
Average standard deviation of split frequencies: 0.016776
310500 -- (-1105.865) (-1107.826) (-1105.949) [-1106.116] * [-1106.195] (-1107.739) (-1108.700) (-1106.761) -- 0:01:04
311000 -- (-1108.987) (-1108.539) [-1105.693] (-1105.926) * [-1106.139] (-1107.345) (-1108.679) (-1106.217) -- 0:01:04
311500 -- (-1112.664) (-1109.614) [-1106.746] (-1105.870) * (-1106.839) [-1107.384] (-1109.570) (-1106.863) -- 0:01:04
312000 -- (-1112.777) (-1108.665) (-1105.901) [-1108.780] * (-1106.764) [-1107.940] (-1107.639) (-1106.965) -- 0:01:03
312500 -- (-1115.232) [-1107.189] (-1106.120) (-1108.484) * (-1106.228) (-1106.385) (-1109.678) [-1109.778] -- 0:01:03
313000 -- (-1108.275) (-1111.349) [-1106.137] (-1109.766) * (-1107.113) [-1106.717] (-1107.629) (-1106.184) -- 0:01:03
313500 -- [-1105.756] (-1110.233) (-1106.531) (-1109.173) * (-1109.010) (-1108.893) (-1109.057) [-1105.778] -- 0:01:03
314000 -- [-1105.579] (-1109.126) (-1106.246) (-1106.947) * [-1105.425] (-1107.088) (-1111.533) (-1105.753) -- 0:01:03
314500 -- [-1109.228] (-1112.120) (-1106.714) (-1105.956) * (-1106.663) [-1106.388] (-1107.529) (-1106.140) -- 0:01:03
315000 -- [-1107.688] (-1108.691) (-1109.959) (-1108.580) * (-1107.636) (-1109.918) (-1106.771) [-1107.658] -- 0:01:03
Average standard deviation of split frequencies: 0.019310
315500 -- (-1106.024) (-1109.726) (-1107.607) [-1105.490] * (-1106.113) (-1108.318) (-1109.053) [-1106.933] -- 0:01:02
316000 -- (-1108.458) (-1108.581) (-1106.400) [-1106.156] * (-1106.708) (-1109.968) (-1106.008) [-1106.872] -- 0:01:02
316500 -- (-1109.496) (-1109.099) (-1108.525) [-1106.069] * (-1107.898) (-1108.939) [-1105.921] (-1106.972) -- 0:01:02
317000 -- [-1107.514] (-1106.390) (-1108.008) (-1107.466) * (-1107.175) (-1107.550) (-1106.996) [-1106.960] -- 0:01:02
317500 -- (-1107.145) (-1106.992) (-1108.935) [-1105.371] * (-1107.110) (-1105.573) [-1105.829] (-1105.350) -- 0:01:02
318000 -- (-1110.084) (-1106.326) (-1110.297) [-1105.780] * [-1109.538] (-1107.280) (-1108.180) (-1106.471) -- 0:01:02
318500 -- (-1107.823) (-1110.136) [-1108.602] (-1107.488) * (-1109.142) [-1109.211] (-1106.437) (-1107.001) -- 0:01:02
319000 -- (-1109.885) (-1107.314) (-1107.165) [-1107.386] * (-1105.832) (-1105.832) (-1108.014) [-1106.403] -- 0:01:04
319500 -- (-1110.903) [-1107.627] (-1111.197) (-1109.989) * (-1106.274) (-1107.038) (-1106.446) [-1105.739] -- 0:01:03
320000 -- (-1109.931) (-1107.154) (-1106.254) [-1109.486] * [-1106.627] (-1108.209) (-1108.030) (-1107.861) -- 0:01:03
Average standard deviation of split frequencies: 0.018948
320500 -- (-1108.449) (-1107.384) (-1106.113) [-1106.921] * [-1105.398] (-1108.952) (-1106.335) (-1108.229) -- 0:01:03
321000 -- (-1108.966) (-1107.384) [-1105.828] (-1107.280) * (-1108.244) (-1107.966) (-1105.988) [-1106.901] -- 0:01:03
321500 -- (-1111.578) (-1108.074) [-1106.923] (-1105.365) * (-1105.710) [-1107.897] (-1108.175) (-1109.815) -- 0:01:03
322000 -- (-1107.191) (-1106.778) [-1106.797] (-1106.180) * [-1105.971] (-1109.594) (-1107.568) (-1113.220) -- 0:01:03
322500 -- [-1108.805] (-1108.857) (-1106.161) (-1106.180) * (-1107.171) [-1108.180] (-1107.994) (-1109.610) -- 0:01:03
323000 -- (-1106.545) (-1107.554) (-1109.788) [-1106.251] * (-1106.705) (-1111.163) [-1108.761] (-1107.204) -- 0:01:02
323500 -- (-1106.574) (-1106.402) (-1106.855) [-1106.847] * [-1106.566] (-1105.632) (-1107.490) (-1108.959) -- 0:01:02
324000 -- [-1107.131] (-1106.775) (-1107.400) (-1105.458) * (-1106.574) (-1107.996) (-1108.225) [-1106.999] -- 0:01:02
324500 -- (-1107.206) (-1106.258) (-1107.213) [-1105.625] * (-1105.922) (-1106.433) (-1108.496) [-1106.372] -- 0:01:02
325000 -- (-1108.613) (-1109.308) (-1109.996) [-1105.212] * (-1107.923) (-1111.565) [-1105.567] (-1105.539) -- 0:01:02
Average standard deviation of split frequencies: 0.020397
325500 -- (-1106.908) (-1110.692) [-1106.194] (-1107.108) * (-1107.762) (-1106.228) (-1105.529) [-1105.419] -- 0:01:02
326000 -- (-1106.419) (-1105.884) (-1106.391) [-1105.609] * (-1106.508) (-1106.112) (-1105.655) [-1105.932] -- 0:01:02
326500 -- (-1106.029) (-1105.745) [-1105.947] (-1105.470) * (-1107.089) (-1107.565) (-1105.815) [-1105.403] -- 0:01:01
327000 -- (-1110.673) (-1106.672) [-1110.215] (-1106.240) * (-1106.820) (-1109.672) [-1107.724] (-1106.568) -- 0:01:01
327500 -- (-1107.006) [-1105.450] (-1107.037) (-1106.229) * [-1107.692] (-1109.477) (-1107.360) (-1108.866) -- 0:01:01
328000 -- (-1105.956) (-1108.443) [-1107.365] (-1107.033) * [-1106.303] (-1109.484) (-1108.136) (-1109.930) -- 0:01:01
328500 -- [-1106.204] (-1107.262) (-1108.335) (-1106.115) * (-1107.004) [-1105.464] (-1109.895) (-1106.330) -- 0:01:03
329000 -- (-1105.615) (-1108.966) [-1106.659] (-1107.717) * (-1114.296) (-1105.439) (-1107.655) [-1106.757] -- 0:01:03
329500 -- (-1107.810) (-1108.873) [-1107.636] (-1106.960) * (-1107.663) (-1106.694) [-1106.933] (-1106.471) -- 0:01:03
330000 -- (-1106.188) [-1106.901] (-1110.949) (-1107.667) * (-1109.963) (-1109.616) [-1111.291] (-1106.790) -- 0:01:02
Average standard deviation of split frequencies: 0.018929
330500 -- (-1106.061) (-1106.523) [-1107.747] (-1108.632) * [-1110.710] (-1106.271) (-1109.418) (-1107.700) -- 0:01:02
331000 -- (-1105.471) [-1107.133] (-1109.906) (-1109.855) * (-1111.447) [-1107.751] (-1110.947) (-1109.921) -- 0:01:02
331500 -- (-1105.385) (-1108.413) (-1110.691) [-1106.972] * (-1105.456) [-1106.881] (-1111.190) (-1107.418) -- 0:01:02
332000 -- (-1107.202) (-1109.563) (-1109.417) [-1108.761] * [-1105.487] (-1106.241) (-1108.930) (-1107.701) -- 0:01:02
332500 -- [-1106.987] (-1111.008) (-1108.457) (-1107.113) * (-1106.427) (-1107.266) [-1106.565] (-1106.294) -- 0:01:02
333000 -- (-1107.434) [-1107.186] (-1108.573) (-1106.646) * (-1118.264) [-1111.700] (-1108.236) (-1105.485) -- 0:01:02
333500 -- (-1108.178) [-1106.959] (-1106.792) (-1106.603) * (-1106.017) (-1110.678) [-1108.910] (-1106.629) -- 0:01:01
334000 -- (-1109.166) (-1107.160) (-1105.148) [-1106.770] * (-1107.465) [-1109.941] (-1106.513) (-1106.918) -- 0:01:01
334500 -- (-1110.194) (-1108.340) [-1105.466] (-1108.452) * (-1107.244) (-1108.681) (-1107.575) [-1106.037] -- 0:01:01
335000 -- (-1109.872) (-1106.583) [-1106.914] (-1105.651) * [-1108.120] (-1109.362) (-1106.866) (-1107.643) -- 0:01:01
Average standard deviation of split frequencies: 0.018387
335500 -- (-1107.510) (-1107.489) (-1105.596) [-1105.461] * (-1111.257) (-1106.456) [-1107.290] (-1106.664) -- 0:01:01
336000 -- (-1109.933) (-1107.416) (-1111.899) [-1106.245] * (-1107.831) (-1106.672) [-1105.828] (-1106.455) -- 0:01:01
336500 -- (-1107.826) [-1106.296] (-1111.309) (-1107.759) * (-1107.451) [-1107.734] (-1109.027) (-1107.317) -- 0:01:01
337000 -- (-1107.826) (-1110.694) [-1108.606] (-1106.649) * (-1108.206) (-1107.513) [-1106.316] (-1108.913) -- 0:01:00
337500 -- (-1106.782) [-1106.562] (-1107.722) (-1108.926) * (-1105.640) [-1109.468] (-1107.176) (-1109.349) -- 0:01:00
338000 -- (-1110.392) (-1106.675) [-1107.987] (-1106.881) * (-1106.497) (-1111.402) (-1111.279) [-1106.563] -- 0:01:00
338500 -- [-1106.883] (-1112.175) (-1110.145) (-1108.395) * (-1105.881) (-1110.068) (-1110.899) [-1107.844] -- 0:01:00
339000 -- (-1107.869) [-1109.428] (-1110.207) (-1106.299) * (-1106.398) (-1109.137) (-1108.219) [-1105.379] -- 0:01:02
339500 -- (-1107.535) (-1108.733) (-1107.890) [-1107.486] * (-1106.391) (-1107.336) (-1107.196) [-1105.273] -- 0:01:02
340000 -- (-1106.494) (-1107.901) (-1107.785) [-1107.333] * (-1107.882) (-1107.605) [-1107.370] (-1105.286) -- 0:01:02
Average standard deviation of split frequencies: 0.016298
340500 -- (-1106.009) [-1107.686] (-1107.296) (-1107.059) * (-1108.551) (-1110.295) (-1108.093) [-1105.790] -- 0:01:01
341000 -- (-1107.174) [-1106.934] (-1106.686) (-1108.820) * (-1106.943) [-1112.099] (-1105.689) (-1109.563) -- 0:01:01
341500 -- (-1107.376) (-1106.436) [-1107.532] (-1111.619) * (-1105.999) (-1108.056) [-1105.901] (-1110.169) -- 0:01:01
342000 -- (-1106.345) (-1109.754) (-1107.531) [-1108.129] * (-1109.772) (-1109.019) (-1106.419) [-1106.264] -- 0:01:01
342500 -- (-1106.213) (-1109.147) (-1107.916) [-1107.412] * (-1107.500) (-1108.650) (-1107.615) [-1109.493] -- 0:01:01
343000 -- (-1105.858) (-1107.995) (-1109.034) [-1111.026] * (-1106.690) (-1107.040) [-1108.809] (-1110.038) -- 0:01:01
343500 -- (-1107.560) (-1107.800) [-1106.214] (-1107.881) * (-1107.143) (-1106.864) [-1107.841] (-1106.942) -- 0:01:01
344000 -- (-1107.585) (-1107.990) [-1107.123] (-1107.620) * (-1106.316) (-1108.359) [-1107.247] (-1106.098) -- 0:01:01
344500 -- (-1107.004) (-1106.357) (-1106.697) [-1109.889] * (-1105.330) (-1106.350) [-1105.962] (-1105.533) -- 0:01:00
345000 -- [-1105.376] (-1106.658) (-1107.397) (-1110.701) * (-1106.978) [-1108.923] (-1110.536) (-1105.578) -- 0:01:00
Average standard deviation of split frequencies: 0.016576
345500 -- [-1111.339] (-1109.799) (-1109.382) (-1109.459) * (-1107.531) (-1108.472) [-1106.506] (-1105.805) -- 0:01:00
346000 -- [-1106.228] (-1108.898) (-1112.248) (-1110.237) * (-1106.247) (-1108.608) (-1107.702) [-1106.224] -- 0:01:00
346500 -- [-1107.067] (-1107.142) (-1108.866) (-1110.266) * (-1107.881) (-1107.629) [-1106.865] (-1106.988) -- 0:01:00
347000 -- (-1110.271) (-1106.968) (-1110.063) [-1108.197] * (-1106.674) (-1108.889) [-1108.498] (-1108.554) -- 0:01:00
347500 -- (-1109.264) (-1106.817) (-1106.852) [-1105.720] * (-1108.017) (-1107.711) [-1107.719] (-1110.973) -- 0:01:00
348000 -- (-1106.319) [-1106.755] (-1109.592) (-1106.565) * [-1110.349] (-1107.286) (-1107.851) (-1112.489) -- 0:00:59
348500 -- (-1107.824) (-1106.717) [-1109.656] (-1105.667) * (-1111.615) (-1108.467) [-1105.542] (-1109.975) -- 0:00:59
349000 -- [-1106.251] (-1106.797) (-1107.500) (-1107.102) * (-1105.659) (-1109.128) [-1109.632] (-1108.839) -- 0:00:59
349500 -- [-1105.584] (-1106.530) (-1106.921) (-1109.027) * (-1106.314) (-1106.595) [-1105.335] (-1108.119) -- 0:00:59
350000 -- [-1108.232] (-1105.730) (-1108.860) (-1114.760) * [-1108.407] (-1109.903) (-1106.574) (-1105.990) -- 0:01:01
Average standard deviation of split frequencies: 0.016768
350500 -- [-1107.360] (-1105.540) (-1105.456) (-1108.031) * (-1105.425) [-1106.602] (-1107.737) (-1106.095) -- 0:01:01
351000 -- (-1107.298) (-1105.720) (-1106.445) [-1105.781] * (-1107.907) [-1107.013] (-1107.139) (-1110.052) -- 0:01:01
351500 -- [-1107.312] (-1106.026) (-1106.807) (-1107.281) * (-1110.011) [-1106.815] (-1106.470) (-1110.429) -- 0:01:00
352000 -- (-1110.353) (-1107.351) [-1106.783] (-1106.199) * (-1106.695) (-1107.085) (-1109.824) [-1105.457] -- 0:01:00
352500 -- (-1107.355) [-1107.369] (-1106.186) (-1108.690) * (-1109.008) (-1107.431) [-1107.533] (-1108.676) -- 0:01:00
353000 -- (-1107.275) (-1109.389) (-1107.177) [-1107.627] * [-1107.253] (-1107.971) (-1105.206) (-1109.071) -- 0:01:00
353500 -- (-1108.852) [-1110.552] (-1108.792) (-1106.878) * [-1105.529] (-1109.222) (-1105.752) (-1106.616) -- 0:01:00
354000 -- (-1107.989) (-1112.174) [-1107.386] (-1108.095) * (-1107.706) [-1107.342] (-1106.342) (-1115.428) -- 0:01:00
354500 -- (-1108.142) (-1107.597) [-1106.103] (-1104.960) * (-1108.729) [-1106.956] (-1107.216) (-1112.531) -- 0:01:00
355000 -- (-1105.974) (-1108.350) (-1106.088) [-1105.807] * (-1107.006) (-1106.981) (-1105.501) [-1107.222] -- 0:00:59
Average standard deviation of split frequencies: 0.016029
355500 -- (-1108.561) (-1107.868) (-1107.406) [-1105.421] * [-1107.972] (-1106.770) (-1108.360) (-1107.520) -- 0:00:59
356000 -- (-1109.849) [-1107.966] (-1109.521) (-1106.696) * (-1107.919) (-1109.630) [-1111.585] (-1107.977) -- 0:00:59
356500 -- [-1109.532] (-1107.273) (-1107.827) (-1110.256) * [-1106.995] (-1105.701) (-1106.449) (-1106.902) -- 0:00:59
357000 -- [-1107.982] (-1107.891) (-1106.723) (-1107.195) * (-1107.114) (-1110.266) (-1106.810) [-1107.051] -- 0:00:59
357500 -- (-1108.903) (-1107.313) (-1106.962) [-1106.186] * [-1105.763] (-1108.064) (-1106.619) (-1108.905) -- 0:00:59
358000 -- (-1107.614) (-1109.380) [-1107.282] (-1108.885) * [-1105.307] (-1107.122) (-1110.783) (-1108.818) -- 0:00:59
358500 -- [-1105.770] (-1107.497) (-1107.893) (-1108.336) * (-1105.989) (-1106.526) [-1107.878] (-1105.689) -- 0:00:59
359000 -- [-1105.835] (-1107.614) (-1107.676) (-1106.784) * (-1105.730) (-1106.445) (-1109.256) [-1108.246] -- 0:00:58
359500 -- (-1107.491) (-1106.948) (-1105.829) [-1111.081] * (-1107.050) (-1107.175) [-1106.286] (-1109.814) -- 0:00:58
360000 -- (-1107.333) (-1106.744) [-1107.204] (-1107.208) * (-1106.455) (-1107.201) (-1105.932) [-1106.439] -- 0:00:58
Average standard deviation of split frequencies: 0.015822
360500 -- (-1106.598) (-1107.692) (-1111.920) [-1107.110] * (-1109.325) [-1106.119] (-1106.946) (-1110.878) -- 0:01:00
361000 -- (-1106.116) (-1108.039) [-1108.074] (-1107.106) * (-1108.313) [-1105.931] (-1107.504) (-1108.813) -- 0:01:00
361500 -- (-1111.081) (-1109.003) [-1108.832] (-1108.442) * [-1106.771] (-1108.510) (-1106.029) (-1107.766) -- 0:01:00
362000 -- (-1108.148) (-1107.292) [-1107.002] (-1109.146) * (-1105.736) [-1106.990] (-1108.692) (-1108.565) -- 0:00:59
362500 -- (-1106.657) [-1108.581] (-1108.112) (-1106.776) * [-1108.335] (-1108.897) (-1106.437) (-1107.852) -- 0:00:59
363000 -- (-1105.696) [-1107.160] (-1108.822) (-1106.221) * (-1107.039) (-1109.068) [-1107.084] (-1106.657) -- 0:00:59
363500 -- (-1105.452) (-1106.959) [-1107.973] (-1107.426) * (-1105.350) [-1107.559] (-1106.499) (-1108.470) -- 0:00:59
364000 -- (-1106.446) [-1106.670] (-1107.831) (-1111.279) * (-1107.287) (-1106.119) [-1106.620] (-1111.364) -- 0:00:59
364500 -- (-1107.946) (-1106.971) [-1105.687] (-1111.361) * [-1106.836] (-1107.393) (-1104.969) (-1114.408) -- 0:00:59
365000 -- (-1108.265) (-1106.691) (-1105.696) [-1105.918] * [-1113.072] (-1108.116) (-1108.957) (-1114.988) -- 0:00:59
Average standard deviation of split frequencies: 0.015524
365500 -- (-1107.408) [-1110.904] (-1105.397) (-1105.977) * (-1108.453) (-1110.554) [-1108.792] (-1107.645) -- 0:00:59
366000 -- (-1106.049) (-1107.538) [-1107.669] (-1107.325) * (-1110.699) (-1111.571) (-1107.838) [-1107.201] -- 0:00:58
366500 -- (-1107.031) (-1108.561) (-1108.050) [-1107.804] * (-1110.143) [-1112.288] (-1105.734) (-1106.932) -- 0:00:58
367000 -- (-1107.000) [-1107.474] (-1109.716) (-1109.053) * (-1112.346) (-1107.086) [-1105.786] (-1106.250) -- 0:00:58
367500 -- (-1107.724) (-1107.647) (-1106.856) [-1107.720] * (-1109.858) (-1109.088) [-1105.451] (-1111.390) -- 0:00:58
368000 -- (-1106.270) (-1105.617) [-1108.604] (-1110.879) * (-1109.345) (-1108.532) [-1107.793] (-1107.653) -- 0:00:58
368500 -- (-1106.074) (-1105.871) [-1109.275] (-1107.928) * [-1109.613] (-1108.839) (-1108.781) (-1106.226) -- 0:00:58
369000 -- (-1106.970) (-1106.196) [-1106.633] (-1109.151) * (-1108.615) (-1110.298) (-1105.040) [-1106.011] -- 0:00:58
369500 -- (-1107.258) [-1106.515] (-1107.622) (-1108.359) * (-1108.153) (-1107.273) [-1105.049] (-1108.030) -- 0:00:58
370000 -- [-1105.816] (-1105.805) (-1105.898) (-1108.719) * (-1105.833) (-1107.466) [-1105.004] (-1107.279) -- 0:00:57
Average standard deviation of split frequencies: 0.015328
370500 -- (-1105.924) (-1108.826) (-1108.967) [-1111.818] * (-1106.557) (-1106.764) (-1105.387) [-1106.967] -- 0:00:57
371000 -- (-1109.151) [-1110.835] (-1109.976) (-1109.552) * (-1106.086) (-1108.176) (-1106.577) [-1109.428] -- 0:00:57
371500 -- [-1107.789] (-1109.318) (-1109.142) (-1106.881) * (-1107.272) [-1108.777] (-1106.710) (-1107.804) -- 0:00:57
372000 -- (-1107.631) [-1109.190] (-1108.341) (-1107.614) * (-1107.647) [-1107.061] (-1105.584) (-1107.231) -- 0:00:57
372500 -- [-1106.672] (-1109.719) (-1112.568) (-1110.110) * (-1109.935) [-1107.954] (-1107.760) (-1106.186) -- 0:00:58
373000 -- (-1108.827) (-1111.054) (-1106.754) [-1107.488] * (-1108.657) [-1108.492] (-1108.062) (-1108.854) -- 0:00:58
373500 -- (-1106.897) [-1106.352] (-1109.095) (-1106.843) * (-1106.755) (-1105.633) [-1106.391] (-1107.780) -- 0:00:58
374000 -- (-1110.712) (-1108.555) (-1108.945) [-1105.117] * (-1106.572) (-1112.503) [-1110.264] (-1107.524) -- 0:00:58
374500 -- (-1107.946) [-1107.381] (-1110.167) (-1112.976) * (-1105.341) (-1105.730) (-1107.249) [-1107.760] -- 0:00:58
375000 -- (-1107.408) [-1106.244] (-1106.910) (-1108.195) * (-1106.911) (-1107.280) (-1105.951) [-1106.267] -- 0:00:58
Average standard deviation of split frequencies: 0.014627
375500 -- [-1108.754] (-1105.697) (-1105.808) (-1110.040) * (-1109.774) (-1108.244) [-1105.583] (-1107.822) -- 0:00:58
376000 -- (-1109.979) [-1107.834] (-1105.808) (-1108.434) * [-1106.725] (-1108.527) (-1105.798) (-1109.375) -- 0:00:58
376500 -- [-1109.662] (-1109.102) (-1108.790) (-1107.390) * (-1110.442) [-1106.760] (-1106.652) (-1109.820) -- 0:00:57
377000 -- (-1107.050) (-1109.015) (-1109.131) [-1105.956] * [-1109.809] (-1113.647) (-1108.739) (-1107.066) -- 0:00:57
377500 -- (-1107.530) [-1108.406] (-1108.843) (-1107.831) * [-1106.540] (-1106.864) (-1115.011) (-1106.973) -- 0:00:57
378000 -- (-1105.355) [-1108.855] (-1105.527) (-1107.911) * (-1108.969) (-1109.765) [-1107.684] (-1109.141) -- 0:00:57
378500 -- [-1108.040] (-1106.523) (-1107.048) (-1107.510) * (-1108.753) (-1107.363) (-1107.468) [-1109.075] -- 0:00:57
379000 -- (-1112.562) (-1107.132) [-1108.055] (-1108.457) * (-1109.388) (-1107.682) (-1107.273) [-1106.011] -- 0:00:57
379500 -- (-1109.002) (-1106.534) [-1107.426] (-1109.236) * [-1110.387] (-1105.800) (-1105.889) (-1108.646) -- 0:00:57
380000 -- (-1107.608) (-1109.222) (-1106.093) [-1109.022] * (-1110.060) (-1105.827) (-1105.919) [-1109.378] -- 0:00:57
Average standard deviation of split frequencies: 0.013691
380500 -- (-1108.304) (-1111.350) (-1107.379) [-1107.799] * [-1106.012] (-1107.495) (-1106.405) (-1107.511) -- 0:00:56
381000 -- (-1107.169) [-1107.824] (-1107.554) (-1106.964) * (-1108.838) (-1108.794) [-1106.525] (-1109.544) -- 0:00:56
381500 -- [-1106.587] (-1111.497) (-1107.104) (-1106.696) * [-1109.009] (-1108.964) (-1107.449) (-1108.984) -- 0:00:56
382000 -- (-1106.474) (-1107.407) [-1105.211] (-1112.947) * (-1108.422) (-1107.238) (-1107.937) [-1105.556] -- 0:00:56
382500 -- (-1108.768) [-1107.449] (-1109.532) (-1110.770) * (-1106.939) (-1106.240) (-1108.359) [-1107.100] -- 0:00:56
383000 -- [-1105.929] (-1106.575) (-1111.739) (-1107.474) * (-1111.391) [-1108.641] (-1105.690) (-1107.769) -- 0:00:56
383500 -- (-1105.732) [-1106.385] (-1111.260) (-1107.438) * [-1105.277] (-1114.869) (-1110.664) (-1108.356) -- 0:00:56
384000 -- (-1107.737) (-1108.870) (-1111.900) [-1106.907] * [-1106.159] (-1112.828) (-1108.366) (-1105.367) -- 0:00:57
384500 -- [-1105.700] (-1111.737) (-1109.679) (-1106.162) * (-1107.090) [-1106.576] (-1110.830) (-1106.392) -- 0:00:57
385000 -- (-1109.954) (-1108.151) [-1108.546] (-1106.666) * (-1111.687) (-1107.088) [-1109.318] (-1107.101) -- 0:00:57
Average standard deviation of split frequencies: 0.014655
385500 -- (-1106.702) (-1108.446) [-1106.644] (-1106.533) * (-1109.545) [-1110.209] (-1109.206) (-1107.256) -- 0:00:57
386000 -- (-1106.454) (-1108.074) [-1107.131] (-1107.261) * [-1106.079] (-1109.627) (-1108.526) (-1109.587) -- 0:00:57
386500 -- (-1107.165) (-1109.992) (-1108.147) [-1108.062] * (-1105.995) (-1107.860) (-1109.311) [-1108.801] -- 0:00:57
387000 -- (-1107.308) (-1109.438) (-1105.907) [-1105.968] * [-1106.259] (-1112.179) (-1108.410) (-1105.785) -- 0:00:57
387500 -- (-1107.843) (-1108.434) [-1106.074] (-1109.744) * (-1108.414) (-1108.485) [-1114.488] (-1110.295) -- 0:00:56
388000 -- (-1107.852) [-1105.706] (-1109.615) (-1111.311) * (-1106.911) [-1107.988] (-1111.220) (-1107.635) -- 0:00:56
388500 -- (-1107.900) (-1107.694) (-1106.172) [-1105.838] * [-1108.462] (-1114.996) (-1108.486) (-1109.328) -- 0:00:56
389000 -- (-1106.664) (-1108.499) (-1110.449) [-1105.723] * (-1105.968) [-1111.909] (-1107.617) (-1109.328) -- 0:00:56
389500 -- [-1107.425] (-1107.474) (-1109.321) (-1112.013) * (-1106.181) (-1106.202) (-1107.991) [-1106.786] -- 0:00:56
390000 -- (-1112.974) [-1105.288] (-1109.255) (-1108.251) * (-1106.412) [-1106.227] (-1107.694) (-1105.307) -- 0:00:56
Average standard deviation of split frequencies: 0.013005
390500 -- (-1106.639) (-1106.490) (-1106.745) [-1105.376] * (-1106.408) [-1109.898] (-1105.603) (-1108.962) -- 0:00:56
391000 -- [-1106.812] (-1110.954) (-1108.781) (-1106.897) * [-1107.659] (-1108.627) (-1105.495) (-1106.723) -- 0:00:56
391500 -- (-1106.220) (-1106.897) (-1108.900) [-1105.064] * (-1106.814) (-1107.674) [-1106.780] (-1107.454) -- 0:00:55
392000 -- [-1106.338] (-1105.097) (-1107.903) (-1105.749) * (-1107.654) (-1107.291) [-1105.723] (-1108.201) -- 0:00:55
392500 -- [-1107.190] (-1105.542) (-1111.381) (-1105.681) * [-1107.256] (-1112.422) (-1108.496) (-1109.584) -- 0:00:55
393000 -- (-1109.355) (-1106.457) (-1116.754) [-1107.235] * (-1106.622) (-1111.833) [-1110.554] (-1107.941) -- 0:00:55
393500 -- (-1111.367) [-1107.280] (-1113.204) (-1106.980) * (-1106.562) [-1107.716] (-1109.841) (-1106.715) -- 0:00:55
394000 -- (-1117.885) (-1108.599) [-1106.017] (-1105.559) * (-1107.331) (-1107.794) [-1109.683] (-1109.605) -- 0:00:56
394500 -- [-1113.730] (-1107.278) (-1106.615) (-1108.945) * (-1105.065) (-1106.935) (-1107.163) [-1108.013] -- 0:00:56
395000 -- [-1107.489] (-1108.620) (-1108.805) (-1109.023) * (-1105.104) [-1106.378] (-1108.681) (-1105.530) -- 0:00:56
Average standard deviation of split frequencies: 0.013822
395500 -- (-1108.124) (-1105.512) (-1107.141) [-1105.965] * (-1105.192) (-1106.084) (-1106.481) [-1105.623] -- 0:00:56
396000 -- (-1107.016) (-1105.491) (-1106.302) [-1105.775] * (-1107.207) [-1107.658] (-1107.214) (-1105.351) -- 0:00:56
396500 -- (-1106.260) (-1105.579) [-1106.771] (-1105.578) * (-1108.978) (-1105.245) [-1106.879] (-1105.891) -- 0:00:56
397000 -- (-1106.167) [-1105.920] (-1107.514) (-1107.543) * (-1107.700) [-1105.517] (-1106.320) (-1106.412) -- 0:00:56
397500 -- (-1106.562) (-1109.690) (-1107.664) [-1105.451] * (-1107.047) [-1109.628] (-1106.260) (-1110.656) -- 0:00:56
398000 -- (-1108.270) (-1114.638) [-1108.560] (-1107.111) * (-1109.897) [-1106.327] (-1105.716) (-1107.685) -- 0:00:55
398500 -- (-1107.742) (-1107.436) [-1107.473] (-1108.701) * (-1108.358) (-1106.566) (-1105.957) [-1109.778] -- 0:00:55
399000 -- [-1106.134] (-1106.885) (-1110.657) (-1108.599) * (-1105.986) (-1105.772) (-1105.627) [-1105.631] -- 0:00:55
399500 -- (-1106.646) [-1106.286] (-1106.418) (-1105.709) * (-1111.184) (-1106.663) (-1106.239) [-1106.322] -- 0:00:55
400000 -- [-1105.243] (-1109.154) (-1107.708) (-1106.952) * [-1107.875] (-1106.661) (-1108.309) (-1106.920) -- 0:00:55
Average standard deviation of split frequencies: 0.013011
400500 -- [-1107.288] (-1110.297) (-1109.001) (-1107.030) * [-1106.920] (-1105.975) (-1110.683) (-1105.520) -- 0:00:55
401000 -- (-1106.508) (-1106.346) (-1108.427) [-1107.209] * [-1106.948] (-1106.109) (-1109.598) (-1106.074) -- 0:00:55
401500 -- (-1105.987) [-1106.322] (-1108.735) (-1110.049) * [-1113.357] (-1106.085) (-1110.209) (-1109.212) -- 0:00:55
402000 -- (-1106.232) (-1109.548) (-1110.749) [-1105.134] * [-1108.067] (-1109.037) (-1106.336) (-1106.757) -- 0:00:55
402500 -- (-1105.773) [-1111.332] (-1110.503) (-1109.195) * (-1107.932) (-1107.573) [-1105.648] (-1109.606) -- 0:00:54
403000 -- (-1107.349) [-1105.887] (-1112.399) (-1106.464) * [-1107.127] (-1105.304) (-1105.737) (-1110.248) -- 0:00:54
403500 -- (-1109.272) (-1106.921) (-1106.178) [-1106.989] * [-1108.400] (-1109.029) (-1105.996) (-1110.551) -- 0:00:54
404000 -- (-1109.213) (-1107.770) (-1109.419) [-1106.562] * (-1106.332) [-1106.760] (-1106.241) (-1107.027) -- 0:00:54
404500 -- (-1107.024) [-1106.528] (-1106.602) (-1108.105) * (-1105.562) (-1106.731) (-1106.256) [-1106.295] -- 0:00:54
405000 -- (-1113.436) (-1107.923) [-1106.616] (-1106.933) * [-1106.829] (-1106.861) (-1108.485) (-1105.400) -- 0:00:55
Average standard deviation of split frequencies: 0.014062
405500 -- (-1108.117) [-1106.685] (-1106.034) (-1107.302) * (-1108.069) [-1107.735] (-1108.176) (-1107.455) -- 0:00:55
406000 -- (-1108.625) (-1109.747) (-1106.852) [-1109.137] * (-1105.719) (-1107.894) [-1107.520] (-1106.253) -- 0:00:55
406500 -- [-1108.882] (-1111.488) (-1108.991) (-1106.628) * (-1106.479) (-1107.812) (-1105.483) [-1106.134] -- 0:00:55
407000 -- (-1109.443) (-1108.781) [-1106.234] (-1107.550) * [-1105.166] (-1105.341) (-1106.069) (-1109.548) -- 0:00:55
407500 -- [-1107.070] (-1108.845) (-1108.144) (-1107.727) * (-1106.593) (-1106.256) (-1106.662) [-1107.860] -- 0:00:55
408000 -- (-1109.016) [-1105.578] (-1108.564) (-1107.489) * (-1111.574) (-1106.270) [-1107.010] (-1107.733) -- 0:00:55
408500 -- [-1106.315] (-1105.553) (-1108.792) (-1105.497) * (-1110.917) (-1107.135) [-1107.028] (-1107.779) -- 0:00:55
409000 -- [-1107.240] (-1107.634) (-1105.697) (-1108.322) * (-1106.584) [-1105.301] (-1105.525) (-1108.257) -- 0:00:54
409500 -- (-1109.966) (-1106.671) [-1105.785] (-1111.180) * [-1108.840] (-1105.301) (-1106.980) (-1108.396) -- 0:00:54
410000 -- (-1111.324) [-1108.273] (-1109.113) (-1106.798) * (-1111.803) (-1105.788) [-1107.219] (-1107.692) -- 0:00:54
Average standard deviation of split frequencies: 0.014859
410500 -- [-1106.897] (-1108.122) (-1107.067) (-1107.007) * [-1106.358] (-1105.684) (-1106.875) (-1110.069) -- 0:00:54
411000 -- [-1106.329] (-1107.820) (-1107.443) (-1106.033) * (-1109.775) (-1106.672) (-1105.828) [-1107.020] -- 0:00:54
411500 -- [-1108.184] (-1111.483) (-1110.214) (-1106.474) * [-1107.630] (-1106.495) (-1111.232) (-1105.867) -- 0:00:54
412000 -- [-1109.298] (-1107.541) (-1106.754) (-1107.994) * (-1111.334) (-1111.415) (-1107.682) [-1108.989] -- 0:00:54
412500 -- (-1107.411) (-1105.305) (-1107.207) [-1106.717] * (-1109.976) (-1112.275) (-1105.917) [-1106.024] -- 0:00:54
413000 -- [-1108.470] (-1105.304) (-1106.950) (-1107.031) * (-1107.914) [-1108.060] (-1106.741) (-1107.633) -- 0:00:54
413500 -- (-1108.234) [-1106.099] (-1107.484) (-1107.367) * (-1107.168) (-1110.172) (-1106.981) [-1107.210] -- 0:00:53
414000 -- [-1107.102] (-1105.552) (-1108.219) (-1109.707) * [-1105.761] (-1110.045) (-1105.431) (-1105.723) -- 0:00:53
414500 -- (-1106.024) (-1105.305) [-1106.306] (-1109.939) * (-1107.450) (-1107.288) (-1105.718) [-1106.653] -- 0:00:53
415000 -- [-1106.772] (-1105.303) (-1107.595) (-1109.577) * (-1105.427) (-1106.872) (-1107.218) [-1106.620] -- 0:00:53
Average standard deviation of split frequencies: 0.015424
415500 -- [-1109.997] (-1105.431) (-1108.472) (-1110.562) * [-1108.358] (-1105.309) (-1109.144) (-1107.046) -- 0:00:53
416000 -- (-1107.620) (-1106.031) (-1105.208) [-1108.318] * (-1107.585) (-1111.876) [-1110.071] (-1111.779) -- 0:00:54
416500 -- [-1106.430] (-1106.399) (-1106.182) (-1107.889) * (-1108.768) (-1110.518) [-1108.081] (-1109.931) -- 0:00:54
417000 -- (-1108.084) (-1108.054) (-1106.254) [-1109.390] * (-1109.056) (-1106.716) [-1108.090] (-1109.784) -- 0:00:54
417500 -- (-1109.566) [-1105.679] (-1107.772) (-1107.823) * (-1107.656) (-1106.642) [-1105.899] (-1109.628) -- 0:00:54
418000 -- (-1107.142) [-1106.898] (-1107.206) (-1107.036) * [-1108.033] (-1107.259) (-1107.012) (-1107.813) -- 0:00:54
418500 -- (-1109.944) [-1105.543] (-1107.917) (-1107.239) * (-1110.876) (-1107.174) (-1106.498) [-1107.515] -- 0:00:54
419000 -- (-1108.975) [-1105.991] (-1105.924) (-1113.223) * (-1107.482) (-1107.534) (-1105.355) [-1107.651] -- 0:00:54
419500 -- (-1106.343) (-1107.097) (-1107.053) [-1109.331] * (-1107.561) (-1109.505) [-1105.526] (-1109.549) -- 0:00:53
420000 -- (-1106.016) (-1106.728) (-1106.381) [-1107.616] * (-1108.769) (-1109.378) [-1107.329] (-1110.512) -- 0:00:53
Average standard deviation of split frequencies: 0.014436
420500 -- (-1105.551) [-1106.446] (-1105.604) (-1113.598) * (-1107.547) (-1114.576) [-1106.619] (-1110.653) -- 0:00:53
421000 -- (-1106.745) [-1108.760] (-1107.730) (-1105.912) * [-1107.046] (-1108.638) (-1107.897) (-1108.323) -- 0:00:53
421500 -- (-1107.796) (-1106.831) (-1106.403) [-1106.784] * [-1106.810] (-1107.241) (-1106.169) (-1107.376) -- 0:00:53
422000 -- (-1106.637) [-1106.397] (-1108.894) (-1107.258) * (-1108.723) (-1106.979) (-1106.689) [-1105.484] -- 0:00:53
422500 -- (-1112.201) [-1106.823] (-1107.642) (-1109.009) * [-1107.343] (-1108.347) (-1107.553) (-1105.834) -- 0:00:53
423000 -- [-1108.986] (-1107.115) (-1107.636) (-1105.620) * [-1107.561] (-1106.367) (-1106.325) (-1107.914) -- 0:00:53
423500 -- (-1106.840) [-1107.500] (-1108.449) (-1110.259) * [-1108.382] (-1110.144) (-1106.855) (-1109.323) -- 0:00:53
424000 -- (-1108.209) [-1108.954] (-1108.907) (-1106.680) * (-1105.426) (-1106.118) (-1110.586) [-1108.785] -- 0:00:52
424500 -- (-1105.800) [-1106.866] (-1106.512) (-1109.368) * (-1105.429) [-1109.741] (-1107.180) (-1106.672) -- 0:00:52
425000 -- (-1108.568) [-1109.647] (-1113.671) (-1107.882) * (-1107.047) (-1111.298) [-1105.935] (-1110.319) -- 0:00:52
Average standard deviation of split frequencies: 0.014646
425500 -- (-1110.689) [-1111.179] (-1107.089) (-1107.110) * (-1107.158) (-1106.773) [-1106.434] (-1106.746) -- 0:00:52
426000 -- [-1109.841] (-1108.821) (-1108.296) (-1107.394) * (-1107.854) (-1107.104) (-1107.066) [-1109.052] -- 0:00:52
426500 -- (-1111.130) (-1108.882) (-1107.368) [-1105.270] * (-1106.607) (-1107.562) [-1108.173] (-1112.766) -- 0:00:53
427000 -- (-1106.712) [-1107.071] (-1109.307) (-1105.990) * (-1105.569) (-1107.002) [-1106.416] (-1108.897) -- 0:00:53
427500 -- (-1107.886) (-1106.670) [-1108.092] (-1107.623) * (-1105.898) (-1107.319) [-1106.416] (-1109.701) -- 0:00:53
428000 -- (-1105.861) (-1106.391) (-1109.772) [-1106.266] * (-1108.102) (-1105.246) [-1108.383] (-1107.281) -- 0:00:53
428500 -- (-1106.229) (-1110.099) [-1107.824] (-1109.655) * [-1108.276] (-1108.950) (-1108.379) (-1106.258) -- 0:00:53
429000 -- (-1105.569) [-1111.160] (-1106.663) (-1106.369) * (-1110.355) (-1106.866) (-1107.165) [-1105.765] -- 0:00:53
429500 -- (-1105.131) (-1107.981) [-1105.962] (-1107.949) * [-1109.382] (-1106.219) (-1106.295) (-1106.084) -- 0:00:53
430000 -- (-1105.249) [-1111.418] (-1105.691) (-1107.663) * (-1112.128) [-1106.091] (-1105.867) (-1109.481) -- 0:00:53
Average standard deviation of split frequencies: 0.015002
430500 -- (-1105.754) [-1106.709] (-1112.039) (-1106.770) * (-1109.416) [-1106.695] (-1106.436) (-1111.234) -- 0:00:52
431000 -- (-1106.233) (-1105.794) [-1108.712] (-1106.627) * [-1108.506] (-1108.345) (-1106.033) (-1108.189) -- 0:00:52
431500 -- (-1105.509) [-1106.691] (-1107.933) (-1105.480) * (-1108.350) (-1107.644) (-1106.601) [-1106.895] -- 0:00:52
432000 -- (-1107.492) (-1106.143) (-1108.799) [-1112.861] * (-1107.221) [-1107.650] (-1107.458) (-1105.712) -- 0:00:52
432500 -- [-1108.178] (-1106.322) (-1108.553) (-1107.296) * (-1105.506) [-1109.860] (-1106.291) (-1106.935) -- 0:00:52
433000 -- [-1106.406] (-1107.300) (-1110.894) (-1105.250) * [-1105.086] (-1111.739) (-1111.460) (-1107.572) -- 0:00:52
433500 -- (-1107.650) (-1107.142) [-1107.533] (-1107.608) * (-1106.115) (-1110.737) [-1107.609] (-1107.865) -- 0:00:52
434000 -- (-1106.765) (-1109.104) (-1107.019) [-1108.009] * (-1106.134) (-1109.952) (-1108.483) [-1111.227] -- 0:00:52
434500 -- (-1106.589) (-1107.640) [-1105.198] (-1107.947) * (-1107.644) (-1106.146) (-1110.085) [-1107.926] -- 0:00:52
435000 -- (-1107.812) [-1107.844] (-1105.867) (-1107.231) * (-1106.476) (-1105.789) (-1106.842) [-1105.298] -- 0:00:51
Average standard deviation of split frequencies: 0.015391
435500 -- (-1105.875) [-1105.993] (-1105.661) (-1106.208) * [-1105.980] (-1106.603) (-1107.085) (-1105.892) -- 0:00:51
436000 -- (-1108.345) (-1108.785) (-1108.629) [-1107.240] * [-1105.838] (-1110.222) (-1107.296) (-1108.134) -- 0:00:51
436500 -- [-1106.507] (-1106.807) (-1105.334) (-1107.025) * (-1105.940) [-1105.190] (-1112.782) (-1107.984) -- 0:00:52
437000 -- (-1106.366) (-1110.055) [-1107.100] (-1109.020) * (-1108.006) (-1106.899) (-1108.864) [-1106.254] -- 0:00:52
437500 -- (-1107.835) [-1105.737] (-1107.970) (-1107.857) * [-1107.824] (-1106.384) (-1108.534) (-1110.073) -- 0:00:52
438000 -- (-1108.508) (-1106.550) [-1107.141] (-1108.373) * (-1107.566) [-1106.930] (-1108.931) (-1106.385) -- 0:00:52
438500 -- (-1110.395) (-1106.628) [-1108.090] (-1105.983) * (-1108.021) (-1105.759) (-1110.897) [-1108.512] -- 0:00:52
439000 -- [-1106.824] (-1106.930) (-1107.947) (-1106.032) * [-1105.762] (-1107.538) (-1106.796) (-1111.517) -- 0:00:52
439500 -- (-1109.165) (-1109.267) [-1107.526] (-1108.359) * [-1106.513] (-1107.522) (-1106.639) (-1109.044) -- 0:00:52
440000 -- (-1113.069) [-1108.215] (-1108.004) (-1106.206) * [-1108.723] (-1107.336) (-1105.340) (-1108.679) -- 0:00:52
Average standard deviation of split frequencies: 0.015354
440500 -- (-1108.516) (-1110.011) [-1105.806] (-1107.097) * (-1108.054) (-1108.046) (-1107.734) [-1106.419] -- 0:00:52
441000 -- (-1107.286) [-1109.138] (-1106.301) (-1108.824) * (-1106.358) (-1107.716) [-1106.806] (-1107.927) -- 0:00:51
441500 -- (-1107.202) [-1106.427] (-1107.142) (-1109.104) * (-1105.447) (-1109.070) (-1109.816) [-1108.260] -- 0:00:51
442000 -- (-1111.331) [-1107.550] (-1107.991) (-1108.966) * (-1106.388) (-1110.965) (-1105.939) [-1106.521] -- 0:00:51
442500 -- (-1109.250) [-1107.565] (-1106.361) (-1106.769) * (-1106.376) [-1106.162] (-1105.974) (-1106.734) -- 0:00:51
443000 -- (-1106.828) [-1108.233] (-1106.030) (-1105.808) * (-1110.044) (-1105.763) [-1113.748] (-1106.582) -- 0:00:51
443500 -- (-1112.760) (-1110.619) [-1106.960] (-1107.646) * (-1106.025) [-1105.493] (-1109.843) (-1106.837) -- 0:00:51
444000 -- (-1105.913) [-1106.254] (-1105.688) (-1106.121) * (-1106.894) [-1108.156] (-1109.853) (-1107.791) -- 0:00:51
444500 -- (-1107.638) (-1106.260) [-1107.327] (-1109.962) * (-1109.015) (-1110.084) [-1107.427] (-1106.681) -- 0:00:51
445000 -- (-1108.157) (-1106.162) [-1107.609] (-1107.231) * (-1105.367) (-1108.990) (-1109.781) [-1110.703] -- 0:00:51
Average standard deviation of split frequencies: 0.015668
445500 -- (-1107.832) (-1105.658) [-1105.800] (-1109.653) * (-1105.367) [-1108.205] (-1108.071) (-1114.665) -- 0:00:51
446000 -- [-1109.873] (-1106.411) (-1107.498) (-1109.165) * (-1106.603) (-1111.986) (-1107.757) [-1108.507] -- 0:00:50
446500 -- (-1107.294) [-1106.206] (-1107.737) (-1110.253) * [-1108.343] (-1107.495) (-1107.738) (-1106.841) -- 0:00:52
447000 -- (-1105.481) (-1106.962) [-1106.117] (-1108.601) * (-1106.278) (-1105.508) (-1108.150) [-1108.877] -- 0:00:51
447500 -- [-1106.244] (-1106.517) (-1105.655) (-1111.760) * [-1106.908] (-1107.033) (-1109.284) (-1106.541) -- 0:00:51
448000 -- (-1106.358) (-1105.391) [-1107.667] (-1106.912) * (-1105.829) (-1111.031) (-1109.450) [-1106.571] -- 0:00:51
448500 -- (-1111.942) (-1106.440) [-1109.262] (-1108.737) * [-1106.083] (-1106.797) (-1109.206) (-1105.467) -- 0:00:51
449000 -- (-1110.101) [-1108.991] (-1106.615) (-1105.694) * (-1109.283) [-1106.526] (-1107.331) (-1107.179) -- 0:00:51
449500 -- (-1108.090) [-1106.793] (-1107.781) (-1109.810) * [-1107.872] (-1107.762) (-1109.567) (-1105.682) -- 0:00:51
450000 -- (-1108.824) [-1107.502] (-1107.459) (-1106.021) * (-1113.675) [-1107.380] (-1111.181) (-1105.647) -- 0:00:51
Average standard deviation of split frequencies: 0.016059
450500 -- (-1105.351) (-1106.592) (-1107.505) [-1107.339] * (-1111.247) (-1108.140) (-1108.395) [-1108.872] -- 0:00:51
451000 -- (-1106.450) [-1106.349] (-1108.941) (-1105.990) * (-1108.078) (-1108.013) [-1108.714] (-1107.504) -- 0:00:51
451500 -- [-1108.063] (-1110.197) (-1107.770) (-1106.676) * (-1105.866) (-1109.287) (-1107.950) [-1105.490] -- 0:00:51
452000 -- (-1109.441) (-1110.084) [-1107.827] (-1107.632) * (-1110.877) [-1106.721] (-1109.944) (-1105.375) -- 0:00:50
452500 -- [-1108.948] (-1105.638) (-1110.928) (-1107.959) * (-1108.400) (-1107.076) [-1110.608] (-1105.227) -- 0:00:50
453000 -- (-1111.873) [-1106.536] (-1109.888) (-1107.827) * (-1105.944) [-1106.722] (-1112.783) (-1105.850) -- 0:00:50
453500 -- (-1110.362) (-1107.123) [-1106.657] (-1106.928) * (-1107.050) (-1107.887) (-1111.667) [-1105.963] -- 0:00:50
454000 -- (-1107.371) [-1106.034] (-1105.913) (-1106.000) * [-1109.196] (-1115.421) (-1109.661) (-1105.917) -- 0:00:50
454500 -- (-1108.167) (-1106.998) (-1106.616) [-1105.954] * (-1107.708) (-1108.954) [-1107.831] (-1110.015) -- 0:00:50
455000 -- (-1107.172) [-1105.916] (-1105.645) (-1106.890) * (-1105.520) (-1105.966) [-1108.012] (-1106.883) -- 0:00:50
Average standard deviation of split frequencies: 0.017270
455500 -- (-1106.657) [-1105.828] (-1109.019) (-1107.928) * (-1105.676) (-1105.461) (-1109.488) [-1107.386] -- 0:00:50
456000 -- [-1107.127] (-1106.207) (-1108.499) (-1109.030) * [-1106.836] (-1112.034) (-1111.258) (-1107.349) -- 0:00:50
456500 -- (-1107.543) (-1106.686) [-1108.376] (-1109.062) * (-1106.822) (-1105.853) (-1114.034) [-1106.764] -- 0:00:50
457000 -- (-1107.439) (-1106.258) [-1105.906] (-1107.817) * (-1108.538) [-1108.381] (-1105.965) (-1109.887) -- 0:00:49
457500 -- (-1107.218) (-1107.246) [-1105.702] (-1106.784) * (-1109.031) (-1106.558) [-1108.080] (-1108.224) -- 0:00:50
458000 -- (-1109.554) (-1109.599) [-1105.106] (-1107.067) * (-1108.713) [-1109.346] (-1107.433) (-1106.161) -- 0:00:50
458500 -- (-1109.922) (-1109.683) [-1105.749] (-1108.459) * [-1108.223] (-1108.324) (-1105.733) (-1106.417) -- 0:00:50
459000 -- [-1105.686] (-1107.690) (-1109.318) (-1106.755) * (-1106.882) (-1108.735) (-1107.125) [-1105.613] -- 0:00:50
459500 -- (-1105.541) [-1105.611] (-1108.565) (-1111.361) * (-1107.460) (-1107.553) (-1107.148) [-1105.083] -- 0:00:50
460000 -- (-1105.720) (-1106.924) (-1106.105) [-1106.812] * (-1106.897) [-1107.057] (-1107.221) (-1106.811) -- 0:00:50
Average standard deviation of split frequencies: 0.016975
460500 -- (-1107.421) [-1106.546] (-1105.211) (-1108.591) * (-1106.578) (-1108.089) (-1106.960) [-1106.159] -- 0:00:50
461000 -- (-1109.663) [-1109.342] (-1105.213) (-1106.386) * (-1109.854) [-1106.480] (-1109.330) (-1108.959) -- 0:00:50
461500 -- (-1107.021) (-1106.439) [-1105.696] (-1107.370) * (-1109.163) (-1109.013) (-1105.787) [-1105.326] -- 0:00:50
462000 -- (-1106.902) [-1105.428] (-1107.703) (-1107.547) * [-1107.872] (-1106.125) (-1109.055) (-1105.951) -- 0:00:50
462500 -- (-1106.923) [-1106.215] (-1106.374) (-1106.913) * [-1105.239] (-1111.631) (-1113.041) (-1110.518) -- 0:00:49
463000 -- [-1106.604] (-1109.835) (-1106.011) (-1107.871) * (-1108.420) (-1105.883) [-1107.051] (-1106.687) -- 0:00:49
463500 -- (-1106.621) (-1107.688) (-1108.483) [-1106.177] * (-1107.541) (-1108.625) [-1108.306] (-1108.296) -- 0:00:49
464000 -- (-1107.758) (-1108.963) [-1106.602] (-1106.302) * [-1105.482] (-1107.842) (-1106.448) (-1108.911) -- 0:00:49
464500 -- (-1107.423) (-1106.826) [-1107.529] (-1108.227) * (-1105.937) (-1106.126) (-1107.250) [-1108.249] -- 0:00:49
465000 -- (-1107.982) (-1106.759) [-1106.301] (-1107.352) * (-1109.933) [-1105.526] (-1105.881) (-1105.633) -- 0:00:49
Average standard deviation of split frequencies: 0.016305
465500 -- (-1110.944) (-1106.648) (-1108.589) [-1109.890] * [-1107.299] (-1106.606) (-1111.346) (-1106.783) -- 0:00:49
466000 -- (-1106.280) (-1106.039) [-1106.176] (-1106.179) * [-1108.045] (-1110.064) (-1107.836) (-1105.853) -- 0:00:49
466500 -- (-1105.580) (-1106.618) (-1105.308) [-1106.050] * (-1106.686) (-1108.448) (-1108.705) [-1106.661] -- 0:00:49
467000 -- (-1106.059) [-1106.601] (-1113.763) (-1106.930) * (-1107.002) [-1105.557] (-1107.030) (-1106.687) -- 0:00:49
467500 -- [-1106.269] (-1108.645) (-1114.309) (-1106.404) * [-1107.199] (-1108.209) (-1105.662) (-1107.701) -- 0:00:48
468000 -- (-1106.616) [-1108.315] (-1106.637) (-1105.186) * (-1106.890) (-1109.302) [-1107.049] (-1107.883) -- 0:00:50
468500 -- [-1108.425] (-1105.735) (-1107.921) (-1107.940) * (-1106.663) (-1109.578) (-1107.071) [-1107.928] -- 0:00:49
469000 -- (-1110.180) [-1106.990] (-1108.256) (-1108.997) * [-1105.893] (-1108.478) (-1106.010) (-1109.225) -- 0:00:49
469500 -- [-1106.487] (-1106.289) (-1110.413) (-1105.531) * (-1107.784) [-1109.085] (-1106.950) (-1107.284) -- 0:00:49
470000 -- (-1107.486) (-1110.726) (-1107.607) [-1106.184] * (-1105.272) (-1108.049) [-1106.014] (-1107.831) -- 0:00:49
Average standard deviation of split frequencies: 0.016202
470500 -- (-1106.478) (-1108.778) [-1106.003] (-1106.963) * (-1106.957) [-1108.484] (-1110.931) (-1107.828) -- 0:00:49
471000 -- (-1110.235) [-1107.539] (-1108.770) (-1105.683) * [-1107.964] (-1106.008) (-1108.314) (-1106.816) -- 0:00:49
471500 -- (-1108.621) [-1107.537] (-1111.468) (-1105.701) * (-1106.065) (-1106.439) [-1105.936] (-1107.665) -- 0:00:49
472000 -- (-1106.284) (-1107.273) [-1108.090] (-1106.653) * (-1105.691) [-1106.189] (-1106.504) (-1107.731) -- 0:00:49
472500 -- (-1108.161) (-1107.930) [-1113.463] (-1108.363) * (-1106.702) [-1106.737] (-1111.326) (-1105.192) -- 0:00:49
473000 -- (-1108.737) (-1108.933) [-1110.414] (-1106.318) * (-1106.284) (-1106.577) (-1106.763) [-1106.337] -- 0:00:49
473500 -- [-1105.942] (-1107.577) (-1106.328) (-1106.597) * (-1109.372) (-1107.888) [-1106.552] (-1105.306) -- 0:00:48
474000 -- (-1107.575) (-1113.618) [-1106.949] (-1107.381) * (-1107.950) (-1108.866) [-1107.584] (-1108.405) -- 0:00:48
474500 -- [-1105.863] (-1107.286) (-1105.917) (-1106.841) * (-1105.955) (-1106.521) (-1108.228) [-1105.838] -- 0:00:48
475000 -- [-1105.274] (-1108.977) (-1105.054) (-1107.079) * (-1106.435) [-1105.649] (-1106.250) (-1105.434) -- 0:00:48
Average standard deviation of split frequencies: 0.016451
475500 -- (-1106.103) (-1106.619) [-1105.642] (-1108.038) * (-1105.717) (-1105.738) [-1109.010] (-1105.586) -- 0:00:48
476000 -- (-1106.675) (-1108.406) (-1110.317) [-1106.106] * (-1108.552) [-1111.302] (-1106.927) (-1107.378) -- 0:00:48
476500 -- (-1110.828) [-1108.451] (-1109.298) (-1105.984) * (-1108.324) [-1108.133] (-1110.768) (-1106.409) -- 0:00:48
477000 -- [-1107.137] (-1107.336) (-1108.477) (-1107.410) * [-1105.923] (-1107.510) (-1106.754) (-1106.711) -- 0:00:48
477500 -- [-1108.430] (-1105.645) (-1106.861) (-1105.404) * (-1107.903) (-1108.282) [-1106.493] (-1108.713) -- 0:00:49
478000 -- (-1106.555) (-1112.932) (-1106.377) [-1107.067] * (-1107.410) (-1106.302) [-1105.454] (-1111.118) -- 0:00:49
478500 -- (-1106.366) (-1107.358) (-1105.857) [-1108.799] * (-1107.788) (-1106.103) (-1112.985) [-1107.938] -- 0:00:49
479000 -- (-1106.886) (-1109.218) [-1106.619] (-1109.288) * (-1111.883) (-1107.985) (-1109.688) [-1106.503] -- 0:00:48
479500 -- (-1107.405) (-1110.932) (-1105.723) [-1112.171] * (-1107.014) (-1107.505) [-1112.539] (-1108.901) -- 0:00:48
480000 -- [-1106.526] (-1117.516) (-1105.071) (-1108.363) * [-1106.543] (-1110.550) (-1109.523) (-1110.389) -- 0:00:48
Average standard deviation of split frequencies: 0.016442
480500 -- (-1109.649) (-1107.446) (-1106.154) [-1108.263] * (-1106.260) (-1109.467) (-1108.965) [-1116.515] -- 0:00:48
481000 -- (-1110.847) (-1106.803) [-1106.006] (-1105.250) * (-1106.632) (-1105.963) (-1107.667) [-1106.731] -- 0:00:48
481500 -- (-1107.290) (-1106.626) (-1108.532) [-1108.547] * (-1110.122) (-1105.910) [-1108.832] (-1106.699) -- 0:00:48
482000 -- [-1106.424] (-1108.176) (-1107.758) (-1107.796) * (-1107.323) (-1105.804) [-1111.307] (-1107.183) -- 0:00:48
482500 -- (-1108.046) (-1106.962) [-1106.868] (-1108.423) * (-1105.801) (-1107.686) [-1106.530] (-1106.781) -- 0:00:48
483000 -- (-1107.371) [-1106.393] (-1105.539) (-1107.676) * (-1107.148) [-1105.366] (-1106.717) (-1106.093) -- 0:00:48
483500 -- (-1106.543) [-1107.431] (-1105.635) (-1107.255) * (-1107.435) [-1106.700] (-1105.183) (-1106.090) -- 0:00:48
484000 -- (-1108.665) (-1106.942) (-1106.345) [-1106.301] * (-1109.918) (-1106.465) [-1105.511] (-1107.541) -- 0:00:47
484500 -- (-1108.544) (-1106.176) [-1107.541] (-1108.767) * (-1108.213) (-1106.379) [-1106.995] (-1108.800) -- 0:00:47
485000 -- (-1107.746) (-1105.916) [-1108.443] (-1106.557) * [-1108.622] (-1105.703) (-1106.544) (-1107.032) -- 0:00:47
Average standard deviation of split frequencies: 0.016597
485500 -- [-1107.977] (-1105.763) (-1110.314) (-1107.373) * (-1108.671) (-1108.248) [-1108.864] (-1105.720) -- 0:00:47
486000 -- [-1106.738] (-1105.604) (-1108.167) (-1111.869) * (-1110.056) (-1110.484) (-1108.322) [-1106.470] -- 0:00:47
486500 -- (-1106.707) (-1105.508) (-1106.870) [-1106.866] * [-1105.421] (-1107.924) (-1105.610) (-1105.924) -- 0:00:47
487000 -- (-1109.721) (-1105.751) (-1106.258) [-1111.151] * (-1109.210) (-1111.320) (-1107.952) [-1110.413] -- 0:00:47
487500 -- [-1107.731] (-1106.241) (-1109.679) (-1108.076) * (-1106.460) (-1110.210) (-1106.132) [-1111.683] -- 0:00:48
488000 -- (-1108.858) [-1107.194] (-1109.301) (-1111.748) * (-1107.561) (-1110.497) (-1108.562) [-1107.070] -- 0:00:48
488500 -- [-1107.818] (-1112.078) (-1108.429) (-1112.084) * (-1107.015) (-1108.547) (-1106.524) [-1106.399] -- 0:00:48
489000 -- [-1108.391] (-1110.708) (-1110.721) (-1105.664) * (-1106.565) (-1106.190) [-1107.537] (-1106.347) -- 0:00:48
489500 -- [-1110.067] (-1109.128) (-1106.444) (-1109.233) * (-1113.321) (-1105.686) [-1107.947] (-1109.010) -- 0:00:47
490000 -- (-1108.326) (-1110.774) [-1108.608] (-1107.228) * (-1111.502) (-1105.332) [-1107.905] (-1111.159) -- 0:00:47
Average standard deviation of split frequencies: 0.015881
490500 -- [-1107.314] (-1108.907) (-1110.695) (-1108.471) * (-1109.794) (-1105.126) (-1106.980) [-1110.837] -- 0:00:47
491000 -- [-1108.025] (-1111.003) (-1109.517) (-1109.223) * (-1109.581) [-1107.825] (-1109.951) (-1106.865) -- 0:00:47
491500 -- (-1111.427) (-1107.830) [-1107.001] (-1109.669) * (-1108.049) (-1105.752) [-1110.737] (-1106.736) -- 0:00:47
492000 -- (-1108.389) (-1105.599) (-1107.673) [-1106.830] * (-1106.391) (-1107.796) (-1107.549) [-1107.043] -- 0:00:47
492500 -- (-1106.214) [-1106.745] (-1111.359) (-1107.546) * (-1107.029) [-1108.354] (-1108.461) (-1106.577) -- 0:00:47
493000 -- (-1106.581) (-1109.983) [-1106.496] (-1108.651) * (-1108.465) [-1106.041] (-1108.499) (-1107.445) -- 0:00:47
493500 -- (-1106.530) [-1107.614] (-1106.362) (-1106.996) * (-1107.897) (-1107.887) (-1106.059) [-1107.137] -- 0:00:47
494000 -- [-1105.914] (-1108.474) (-1108.898) (-1106.292) * (-1111.933) (-1107.586) [-1106.542] (-1107.395) -- 0:00:47
494500 -- (-1109.831) (-1105.383) [-1112.329] (-1106.535) * [-1106.151] (-1116.814) (-1108.475) (-1106.872) -- 0:00:47
495000 -- (-1106.985) (-1106.036) [-1108.197] (-1105.324) * (-1108.992) (-1107.127) (-1108.217) [-1107.783] -- 0:00:46
Average standard deviation of split frequencies: 0.014424
495500 -- (-1106.735) (-1105.813) (-1107.783) [-1105.312] * (-1110.092) [-1105.115] (-1109.969) (-1108.389) -- 0:00:46
496000 -- (-1105.494) (-1106.093) (-1108.833) [-1106.420] * (-1106.527) (-1107.328) (-1106.840) [-1110.388] -- 0:00:46
496500 -- (-1105.570) [-1107.522] (-1113.223) (-1106.786) * (-1106.857) (-1107.485) (-1107.683) [-1112.894] -- 0:00:46
497000 -- (-1105.214) (-1111.580) [-1105.953] (-1106.629) * [-1109.822] (-1107.096) (-1107.290) (-1112.766) -- 0:00:46
497500 -- [-1106.783] (-1106.717) (-1107.268) (-1106.242) * (-1106.857) (-1109.170) [-1107.479] (-1109.734) -- 0:00:46
498000 -- (-1108.782) (-1106.680) (-1105.848) [-1106.849] * (-1106.741) (-1109.818) (-1106.461) [-1109.091] -- 0:00:47
498500 -- (-1106.622) [-1106.410] (-1105.382) (-1107.643) * (-1108.117) [-1107.212] (-1107.096) (-1109.386) -- 0:00:47
499000 -- (-1106.022) (-1106.303) (-1105.068) [-1106.355] * [-1107.594] (-1107.697) (-1109.153) (-1106.375) -- 0:00:47
499500 -- (-1106.195) (-1106.892) [-1106.815] (-1105.625) * (-1107.584) [-1110.872] (-1108.971) (-1106.268) -- 0:00:47
500000 -- [-1106.511] (-1108.504) (-1105.994) (-1106.061) * (-1106.270) (-1110.206) (-1108.450) [-1106.185] -- 0:00:47
Average standard deviation of split frequencies: 0.014068
500500 -- (-1106.054) (-1108.020) [-1107.497] (-1110.493) * (-1107.729) [-1106.563] (-1106.700) (-1107.869) -- 0:00:46
501000 -- (-1107.644) (-1105.809) (-1108.278) [-1107.471] * (-1105.434) (-1107.177) [-1105.367] (-1109.885) -- 0:00:46
501500 -- (-1105.785) (-1106.126) [-1106.755] (-1106.213) * (-1109.478) (-1107.876) (-1105.954) [-1105.136] -- 0:00:46
502000 -- (-1106.244) [-1107.091] (-1107.112) (-1105.107) * (-1107.312) [-1106.781] (-1105.723) (-1105.047) -- 0:00:46
502500 -- (-1110.218) [-1106.399] (-1106.341) (-1107.966) * (-1109.421) (-1106.249) (-1106.243) [-1107.859] -- 0:00:46
503000 -- [-1106.831] (-1106.479) (-1108.457) (-1107.019) * [-1106.711] (-1106.158) (-1109.468) (-1109.658) -- 0:00:46
503500 -- (-1107.180) [-1108.349] (-1106.600) (-1107.043) * (-1106.375) (-1109.397) (-1106.268) [-1108.029] -- 0:00:46
504000 -- (-1107.575) (-1110.038) [-1107.499] (-1106.335) * (-1106.374) [-1105.805] (-1110.395) (-1109.407) -- 0:00:46
504500 -- [-1105.787] (-1109.741) (-1107.123) (-1106.979) * (-1109.847) (-1106.021) [-1107.058] (-1109.406) -- 0:00:46
505000 -- [-1106.054] (-1108.055) (-1105.669) (-1109.263) * (-1105.392) (-1110.369) [-1105.905] (-1107.754) -- 0:00:46
Average standard deviation of split frequencies: 0.013974
505500 -- (-1106.207) (-1106.410) (-1109.183) [-1108.612] * [-1106.728] (-1106.172) (-1107.619) (-1106.139) -- 0:00:45
506000 -- (-1106.121) (-1106.194) [-1110.360] (-1107.579) * (-1106.597) (-1106.214) (-1106.396) [-1105.508] -- 0:00:45
506500 -- [-1107.006] (-1106.362) (-1108.034) (-1106.312) * [-1108.043] (-1108.929) (-1108.075) (-1107.307) -- 0:00:45
507000 -- (-1107.956) (-1106.478) (-1110.663) [-1106.131] * (-1108.968) (-1105.982) (-1112.254) [-1106.981] -- 0:00:45
507500 -- (-1108.757) (-1105.816) [-1107.695] (-1105.235) * (-1109.626) (-1108.212) [-1107.223] (-1108.446) -- 0:00:45
508000 -- (-1107.969) [-1106.651] (-1110.166) (-1108.338) * (-1109.223) (-1107.769) (-1117.071) [-1105.632] -- 0:00:46
508500 -- (-1112.725) [-1107.055] (-1115.354) (-1108.263) * (-1109.229) (-1106.380) (-1108.428) [-1106.135] -- 0:00:46
509000 -- [-1106.765] (-1108.814) (-1109.052) (-1106.088) * (-1108.230) (-1110.587) (-1106.309) [-1105.892] -- 0:00:46
509500 -- (-1107.328) [-1106.152] (-1109.875) (-1108.035) * (-1108.114) [-1107.750] (-1107.122) (-1108.351) -- 0:00:46
510000 -- (-1107.491) (-1107.819) [-1109.770] (-1106.850) * [-1107.234] (-1106.967) (-1106.410) (-1110.262) -- 0:00:46
Average standard deviation of split frequencies: 0.013077
510500 -- (-1107.552) (-1107.716) [-1108.004] (-1106.801) * (-1109.078) (-1107.267) [-1106.402] (-1105.719) -- 0:00:46
511000 -- (-1106.358) (-1109.557) (-1105.495) [-1106.399] * (-1106.524) (-1105.603) [-1106.333] (-1105.589) -- 0:00:45
511500 -- (-1106.347) (-1118.078) (-1107.269) [-1108.210] * (-1106.272) (-1109.484) (-1106.308) [-1109.237] -- 0:00:45
512000 -- [-1107.100] (-1117.114) (-1107.951) (-1108.996) * (-1105.774) [-1107.586] (-1106.097) (-1111.032) -- 0:00:45
512500 -- (-1106.659) (-1110.089) [-1111.288] (-1106.469) * [-1108.503] (-1107.514) (-1112.014) (-1111.348) -- 0:00:45
513000 -- [-1106.657] (-1107.571) (-1107.906) (-1106.651) * (-1106.053) [-1111.291] (-1117.842) (-1107.044) -- 0:00:45
513500 -- [-1108.116] (-1108.954) (-1106.647) (-1109.233) * [-1108.945] (-1106.434) (-1109.251) (-1107.031) -- 0:00:45
514000 -- (-1107.826) (-1105.479) [-1107.080] (-1107.173) * [-1109.519] (-1109.591) (-1110.044) (-1106.956) -- 0:00:45
514500 -- (-1110.722) (-1106.039) (-1105.693) [-1105.801] * (-1109.075) (-1109.795) (-1105.780) [-1106.398] -- 0:00:45
515000 -- (-1108.438) (-1107.605) (-1105.761) [-1107.018] * (-1111.202) (-1108.120) [-1106.677] (-1106.642) -- 0:00:45
Average standard deviation of split frequencies: 0.012587
515500 -- (-1109.157) (-1108.351) (-1106.012) [-1106.785] * [-1107.932] (-1106.389) (-1107.447) (-1106.929) -- 0:00:45
516000 -- (-1107.366) [-1106.911] (-1105.325) (-1106.954) * (-1110.725) (-1106.013) [-1107.496] (-1111.795) -- 0:00:45
516500 -- [-1108.163] (-1108.027) (-1108.493) (-1107.726) * (-1110.764) (-1107.398) [-1106.482] (-1109.380) -- 0:00:45
517000 -- (-1109.311) (-1108.254) (-1107.736) [-1108.533] * (-1112.960) [-1105.474] (-1106.632) (-1110.873) -- 0:00:45
517500 -- (-1107.657) (-1112.320) (-1108.438) [-1105.600] * [-1108.881] (-1105.906) (-1106.623) (-1107.277) -- 0:00:45
518000 -- (-1106.741) [-1109.526] (-1107.757) (-1105.507) * (-1109.718) (-1111.005) (-1106.281) [-1107.039] -- 0:00:45
518500 -- (-1106.180) [-1106.313] (-1107.210) (-1109.481) * [-1108.592] (-1109.470) (-1113.165) (-1105.520) -- 0:00:45
519000 -- (-1112.342) [-1105.317] (-1108.321) (-1106.846) * [-1106.295] (-1107.734) (-1111.160) (-1105.475) -- 0:00:45
519500 -- (-1110.607) [-1105.368] (-1108.153) (-1107.601) * (-1105.145) [-1110.608] (-1106.933) (-1106.081) -- 0:00:45
520000 -- [-1109.144] (-1106.604) (-1107.964) (-1107.382) * (-1105.718) (-1110.694) [-1107.180] (-1106.976) -- 0:00:45
Average standard deviation of split frequencies: 0.013480
520500 -- [-1108.780] (-1108.448) (-1110.109) (-1105.868) * (-1108.104) (-1113.010) [-1106.441] (-1108.195) -- 0:00:45
521000 -- (-1106.415) (-1109.022) [-1106.657] (-1106.466) * (-1110.613) (-1108.707) (-1107.734) [-1106.803] -- 0:00:45
521500 -- (-1106.501) (-1111.368) (-1106.962) [-1106.496] * (-1107.616) (-1110.445) [-1105.242] (-1106.336) -- 0:00:44
522000 -- (-1106.679) (-1110.643) [-1109.512] (-1107.810) * (-1106.913) (-1108.007) [-1107.227] (-1109.997) -- 0:00:44
522500 -- (-1109.000) (-1106.751) (-1109.250) [-1105.655] * (-1109.053) (-1108.186) [-1106.927] (-1107.193) -- 0:00:44
523000 -- (-1106.416) (-1105.817) (-1106.819) [-1105.539] * (-1106.882) (-1106.581) [-1106.014] (-1109.654) -- 0:00:44
523500 -- [-1106.494] (-1106.628) (-1106.283) (-1109.181) * (-1107.599) [-1109.798] (-1106.416) (-1112.544) -- 0:00:44
524000 -- (-1105.926) [-1105.753] (-1106.936) (-1107.283) * (-1107.080) [-1107.514] (-1106.994) (-1108.226) -- 0:00:44
524500 -- (-1106.345) (-1106.033) [-1106.510] (-1106.752) * (-1107.177) [-1106.398] (-1110.563) (-1107.068) -- 0:00:44
525000 -- (-1105.360) [-1105.715] (-1106.367) (-1106.420) * (-1107.514) (-1107.074) (-1108.584) [-1108.155] -- 0:00:44
Average standard deviation of split frequencies: 0.013537
525500 -- [-1105.978] (-1106.246) (-1110.535) (-1105.669) * (-1108.534) [-1109.207] (-1112.458) (-1108.717) -- 0:00:44
526000 -- (-1106.094) (-1106.158) (-1107.571) [-1105.612] * [-1106.172] (-1108.665) (-1108.276) (-1108.708) -- 0:00:44
526500 -- (-1106.161) (-1107.021) (-1108.312) [-1105.906] * (-1109.210) [-1106.113] (-1106.413) (-1108.133) -- 0:00:44
527000 -- (-1106.317) (-1106.600) [-1109.600] (-1108.858) * [-1105.676] (-1108.390) (-1106.968) (-1110.196) -- 0:00:44
527500 -- (-1107.421) (-1110.204) [-1106.127] (-1110.700) * (-1108.710) (-1108.695) [-1106.405] (-1108.000) -- 0:00:44
528000 -- (-1107.005) (-1110.943) [-1106.479] (-1107.222) * (-1109.639) (-1109.358) (-1109.399) [-1109.553] -- 0:00:44
528500 -- [-1105.327] (-1111.885) (-1111.074) (-1105.769) * [-1107.845] (-1106.390) (-1109.164) (-1108.809) -- 0:00:44
529000 -- (-1105.557) (-1109.166) [-1107.447] (-1107.483) * (-1111.085) [-1108.324] (-1108.291) (-1109.825) -- 0:00:44
529500 -- (-1105.618) (-1107.184) (-1106.683) [-1109.722] * (-1106.012) (-1106.152) [-1107.055] (-1105.203) -- 0:00:44
530000 -- (-1107.097) (-1107.565) (-1111.682) [-1108.703] * (-1106.640) (-1105.933) (-1107.117) [-1105.789] -- 0:00:44
Average standard deviation of split frequencies: 0.012802
530500 -- (-1106.418) (-1106.922) (-1110.449) [-1106.469] * [-1105.909] (-1105.797) (-1108.441) (-1105.643) -- 0:00:44
531000 -- [-1107.475] (-1105.688) (-1111.107) (-1106.418) * (-1105.602) (-1106.676) (-1107.006) [-1107.473] -- 0:00:44
531500 -- (-1108.367) (-1107.025) (-1106.251) [-1105.989] * (-1105.983) [-1108.076] (-1105.744) (-1107.271) -- 0:00:44
532000 -- (-1105.867) [-1106.683] (-1107.747) (-1106.839) * (-1105.762) [-1106.910] (-1106.530) (-1115.359) -- 0:00:43
532500 -- (-1105.961) [-1106.847] (-1108.478) (-1106.083) * [-1106.249] (-1108.079) (-1107.066) (-1110.622) -- 0:00:43
533000 -- (-1106.204) (-1106.669) [-1107.893] (-1106.812) * (-1106.037) (-1106.746) (-1107.288) [-1105.272] -- 0:00:43
533500 -- (-1107.858) (-1106.284) (-1107.464) [-1107.856] * (-1106.769) [-1107.035] (-1108.167) (-1112.988) -- 0:00:43
534000 -- (-1106.164) [-1106.887] (-1107.463) (-1110.180) * [-1107.965] (-1106.559) (-1112.269) (-1112.480) -- 0:00:43
534500 -- [-1105.131] (-1108.847) (-1109.364) (-1111.519) * (-1108.010) (-1108.141) (-1111.695) [-1106.952] -- 0:00:43
535000 -- (-1105.559) (-1107.262) (-1106.725) [-1107.074] * [-1106.359] (-1105.337) (-1113.471) (-1105.963) -- 0:00:43
Average standard deviation of split frequencies: 0.012830
535500 -- [-1107.252] (-1106.754) (-1108.235) (-1110.657) * (-1108.742) [-1106.420] (-1107.527) (-1107.441) -- 0:00:43
536000 -- (-1107.761) [-1105.484] (-1107.700) (-1106.788) * (-1107.867) (-1106.105) (-1105.584) [-1108.196] -- 0:00:43
536500 -- (-1109.114) (-1106.670) (-1106.865) [-1106.373] * (-1106.417) (-1106.913) (-1106.545) [-1107.500] -- 0:00:43
537000 -- (-1108.968) (-1107.348) [-1106.918] (-1105.528) * (-1105.583) (-1105.944) [-1110.978] (-1106.588) -- 0:00:43
537500 -- [-1105.908] (-1106.052) (-1108.077) (-1106.352) * (-1105.944) (-1109.260) (-1112.344) [-1106.804] -- 0:00:43
538000 -- [-1106.514] (-1106.952) (-1108.501) (-1107.586) * (-1108.273) (-1107.950) [-1106.767] (-1106.020) -- 0:00:43
538500 -- (-1106.555) [-1107.820] (-1107.609) (-1108.368) * [-1105.863] (-1108.056) (-1106.532) (-1106.231) -- 0:00:43
539000 -- (-1106.182) [-1108.870] (-1107.379) (-1105.960) * (-1106.997) (-1107.542) (-1106.532) [-1106.627] -- 0:00:43
539500 -- (-1107.787) [-1111.069] (-1107.722) (-1107.923) * [-1106.801] (-1109.121) (-1106.053) (-1106.127) -- 0:00:43
540000 -- (-1108.418) (-1108.291) (-1105.750) [-1108.917] * (-1110.435) (-1111.403) [-1106.640] (-1109.326) -- 0:00:43
Average standard deviation of split frequencies: 0.013514
540500 -- (-1109.143) (-1109.084) (-1107.409) [-1106.793] * (-1106.723) (-1108.856) (-1108.705) [-1107.983] -- 0:00:43
541000 -- (-1107.875) (-1106.913) (-1106.568) [-1106.279] * (-1105.541) (-1105.455) (-1107.975) [-1107.094] -- 0:00:43
541500 -- (-1110.223) (-1105.758) (-1111.426) [-1107.733] * (-1110.063) [-1107.369] (-1108.610) (-1107.624) -- 0:00:43
542000 -- (-1111.142) [-1108.564] (-1108.846) (-1108.216) * (-1109.175) [-1108.183] (-1114.789) (-1106.372) -- 0:00:43
542500 -- [-1109.616] (-1106.022) (-1108.574) (-1106.587) * (-1108.622) (-1111.443) [-1108.458] (-1105.569) -- 0:00:43
543000 -- (-1106.884) (-1107.486) [-1109.516] (-1108.319) * (-1108.896) (-1110.527) (-1113.257) [-1106.903] -- 0:00:42
543500 -- (-1108.478) (-1109.362) [-1106.247] (-1108.433) * (-1106.157) (-1108.242) [-1108.449] (-1109.198) -- 0:00:42
544000 -- (-1107.032) (-1107.178) (-1106.880) [-1106.571] * (-1105.120) (-1108.980) (-1108.017) [-1107.081] -- 0:00:42
544500 -- (-1107.299) [-1109.574] (-1111.344) (-1107.691) * (-1110.799) (-1107.465) (-1109.565) [-1107.333] -- 0:00:42
545000 -- (-1108.778) [-1106.741] (-1106.743) (-1111.102) * (-1112.711) (-1107.212) (-1109.567) [-1106.058] -- 0:00:42
Average standard deviation of split frequencies: 0.012999
545500 -- (-1110.040) (-1105.147) [-1106.229] (-1108.653) * (-1109.009) (-1106.330) [-1108.841] (-1105.766) -- 0:00:42
546000 -- (-1111.710) [-1106.578] (-1106.832) (-1107.136) * (-1108.457) (-1107.031) (-1106.102) [-1108.468] -- 0:00:42
546500 -- (-1107.119) [-1108.381] (-1110.385) (-1109.972) * (-1107.992) (-1106.840) (-1106.978) [-1106.975] -- 0:00:42
547000 -- (-1108.179) [-1106.489] (-1111.019) (-1106.322) * (-1108.003) [-1107.231] (-1106.413) (-1106.972) -- 0:00:42
547500 -- [-1107.394] (-1106.163) (-1111.890) (-1106.868) * (-1108.299) (-1108.230) (-1105.723) [-1107.031] -- 0:00:42
548000 -- (-1106.166) [-1106.156] (-1107.449) (-1107.149) * [-1109.120] (-1109.464) (-1107.071) (-1108.370) -- 0:00:42
548500 -- (-1106.555) [-1107.858] (-1106.162) (-1105.492) * (-1108.447) (-1107.062) (-1109.523) [-1108.016] -- 0:00:41
549000 -- (-1108.915) (-1106.115) [-1108.058] (-1106.476) * [-1106.906] (-1105.834) (-1105.917) (-1106.827) -- 0:00:41
549500 -- (-1111.382) (-1108.703) [-1105.643] (-1106.686) * (-1108.531) (-1106.428) (-1108.612) [-1107.038] -- 0:00:42
550000 -- (-1109.584) (-1108.703) [-1109.336] (-1106.501) * (-1107.326) (-1106.428) (-1106.599) [-1109.000] -- 0:00:42
Average standard deviation of split frequencies: 0.012365
550500 -- (-1106.422) [-1108.901] (-1107.167) (-1106.978) * (-1107.779) (-1107.302) (-1105.466) [-1106.022] -- 0:00:42
551000 -- [-1106.009] (-1106.718) (-1108.686) (-1106.829) * (-1107.065) (-1105.348) (-1107.961) [-1106.123] -- 0:00:42
551500 -- (-1107.992) (-1107.727) (-1106.838) [-1105.489] * [-1107.139] (-1110.014) (-1110.432) (-1105.506) -- 0:00:42
552000 -- (-1106.909) [-1106.340] (-1107.839) (-1105.475) * (-1108.752) (-1108.069) [-1111.994] (-1107.927) -- 0:00:42
552500 -- [-1107.932] (-1110.351) (-1110.966) (-1105.964) * (-1108.077) [-1106.650] (-1108.723) (-1106.998) -- 0:00:42
553000 -- (-1108.865) [-1106.725] (-1107.050) (-1108.034) * (-1108.398) [-1106.429] (-1108.163) (-1109.785) -- 0:00:42
553500 -- (-1106.277) [-1109.616] (-1105.456) (-1110.217) * (-1106.483) (-1106.060) [-1110.102] (-1112.355) -- 0:00:41
554000 -- [-1109.084] (-1109.120) (-1108.145) (-1107.509) * [-1107.632] (-1107.327) (-1107.172) (-1108.694) -- 0:00:41
554500 -- (-1111.882) [-1109.378] (-1107.139) (-1114.402) * [-1106.343] (-1108.033) (-1106.508) (-1106.577) -- 0:00:41
555000 -- (-1114.130) (-1105.974) [-1108.964] (-1108.750) * (-1108.382) (-1106.827) (-1108.640) [-1105.796] -- 0:00:41
Average standard deviation of split frequencies: 0.011234
555500 -- (-1107.405) (-1108.506) [-1107.555] (-1109.267) * (-1106.705) [-1106.536] (-1107.700) (-1105.916) -- 0:00:41
556000 -- [-1107.013] (-1107.739) (-1107.415) (-1108.166) * (-1109.294) (-1106.642) [-1106.013] (-1105.592) -- 0:00:41
556500 -- (-1109.142) [-1105.227] (-1110.454) (-1106.744) * [-1109.562] (-1106.955) (-1106.734) (-1107.543) -- 0:00:41
557000 -- (-1107.994) [-1106.284] (-1106.256) (-1108.243) * [-1111.519] (-1106.987) (-1109.882) (-1108.350) -- 0:00:41
557500 -- (-1106.717) [-1105.472] (-1108.153) (-1108.323) * (-1108.564) (-1106.160) (-1105.986) [-1107.511] -- 0:00:41
558000 -- [-1107.771] (-1106.925) (-1106.489) (-1107.701) * (-1107.881) (-1106.027) [-1107.637] (-1106.469) -- 0:00:41
558500 -- (-1106.990) [-1107.764] (-1106.331) (-1109.120) * [-1109.727] (-1106.970) (-1107.777) (-1106.890) -- 0:00:41
559000 -- (-1106.088) (-1105.747) [-1106.747] (-1106.077) * (-1110.093) (-1105.413) [-1106.004] (-1106.439) -- 0:00:41
559500 -- [-1106.700] (-1104.988) (-1106.481) (-1105.600) * (-1106.883) (-1105.785) [-1106.857] (-1110.020) -- 0:00:40
560000 -- (-1106.590) (-1105.002) [-1106.633] (-1107.465) * (-1108.840) (-1105.803) (-1114.683) [-1106.316] -- 0:00:40
Average standard deviation of split frequencies: 0.011351
560500 -- (-1107.180) [-1105.337] (-1106.214) (-1108.016) * (-1108.161) (-1107.851) [-1110.694] (-1107.167) -- 0:00:41
561000 -- (-1107.286) [-1110.361] (-1106.069) (-1105.599) * (-1106.596) [-1106.616] (-1110.948) (-1115.092) -- 0:00:41
561500 -- (-1108.106) (-1107.976) (-1106.667) [-1106.016] * (-1109.252) [-1106.072] (-1110.008) (-1108.639) -- 0:00:41
562000 -- (-1106.036) (-1107.211) [-1109.605] (-1106.113) * (-1106.590) (-1111.428) [-1106.483] (-1106.193) -- 0:00:41
562500 -- [-1107.639] (-1108.031) (-1107.982) (-1106.833) * (-1108.276) (-1108.173) (-1108.864) [-1105.945] -- 0:00:41
563000 -- (-1107.878) [-1108.383] (-1106.915) (-1106.911) * (-1111.037) (-1106.425) (-1109.917) [-1108.723] -- 0:00:41
563500 -- (-1105.837) (-1106.355) (-1107.273) [-1108.386] * (-1109.377) [-1109.896] (-1105.794) (-1108.962) -- 0:00:41
564000 -- (-1107.305) (-1107.678) (-1106.756) [-1107.010] * (-1106.562) (-1106.768) (-1107.827) [-1106.152] -- 0:00:40
564500 -- (-1107.847) (-1106.939) [-1106.625] (-1106.213) * (-1107.832) (-1107.525) (-1107.395) [-1107.953] -- 0:00:40
565000 -- [-1107.934] (-1105.781) (-1108.084) (-1107.134) * (-1106.502) (-1109.683) (-1106.669) [-1106.837] -- 0:00:40
Average standard deviation of split frequencies: 0.011562
565500 -- [-1109.513] (-1108.714) (-1115.651) (-1105.423) * (-1109.561) [-1111.962] (-1107.731) (-1106.698) -- 0:00:40
566000 -- [-1105.575] (-1108.608) (-1109.645) (-1106.786) * (-1107.095) [-1106.814] (-1109.201) (-1106.340) -- 0:00:40
566500 -- [-1111.189] (-1114.641) (-1108.572) (-1105.324) * (-1108.062) [-1105.078] (-1110.940) (-1108.419) -- 0:00:40
567000 -- (-1109.280) (-1108.773) [-1106.997] (-1106.017) * (-1107.196) (-1107.901) (-1108.778) [-1107.705] -- 0:00:40
567500 -- (-1108.061) [-1107.806] (-1108.333) (-1107.489) * [-1107.294] (-1106.371) (-1109.427) (-1105.963) -- 0:00:40
568000 -- (-1109.926) (-1110.071) [-1106.211] (-1107.595) * (-1107.781) (-1108.137) [-1110.108] (-1109.083) -- 0:00:40
568500 -- (-1107.510) [-1110.967] (-1106.481) (-1108.429) * (-1111.530) (-1111.684) (-1108.302) [-1108.733] -- 0:00:40
569000 -- (-1105.402) [-1105.569] (-1106.300) (-1106.802) * [-1108.886] (-1106.471) (-1111.064) (-1106.434) -- 0:00:40
569500 -- (-1107.253) (-1106.776) [-1108.952] (-1105.931) * (-1107.257) [-1108.167] (-1106.926) (-1108.497) -- 0:00:40
570000 -- [-1107.951] (-1110.044) (-1108.123) (-1110.375) * (-1107.693) [-1105.931] (-1105.552) (-1111.582) -- 0:00:40
Average standard deviation of split frequencies: 0.010298
570500 -- (-1106.030) (-1107.941) (-1106.115) [-1107.610] * (-1107.017) (-1108.508) [-1105.959] (-1107.286) -- 0:00:40
571000 -- (-1108.491) (-1108.645) (-1106.210) [-1107.563] * [-1106.621] (-1111.669) (-1106.567) (-1110.190) -- 0:00:40
571500 -- (-1106.471) [-1106.197] (-1106.609) (-1110.090) * (-1106.549) (-1107.378) (-1106.684) [-1106.702] -- 0:00:40
572000 -- (-1108.149) [-1106.707] (-1107.873) (-1108.218) * (-1108.800) [-1105.732] (-1109.643) (-1106.691) -- 0:00:40
572500 -- (-1106.053) [-1107.278] (-1106.090) (-1109.388) * (-1107.409) [-1108.806] (-1107.968) (-1106.107) -- 0:00:40
573000 -- (-1107.578) (-1109.300) [-1107.651] (-1111.097) * (-1109.253) (-1107.323) [-1108.283] (-1105.528) -- 0:00:40
573500 -- [-1113.992] (-1109.172) (-1109.484) (-1113.080) * (-1106.297) (-1109.461) (-1107.683) [-1107.267] -- 0:00:40
574000 -- (-1108.397) (-1107.203) [-1108.043] (-1108.466) * [-1106.719] (-1106.780) (-1108.113) (-1107.478) -- 0:00:40
574500 -- (-1107.164) (-1110.253) [-1111.274] (-1106.461) * (-1107.313) (-1107.002) (-1108.124) [-1106.208] -- 0:00:39
575000 -- (-1108.707) [-1106.383] (-1105.957) (-1106.445) * (-1106.654) (-1105.801) [-1107.491] (-1105.996) -- 0:00:39
Average standard deviation of split frequencies: 0.009603
575500 -- (-1106.587) (-1106.732) (-1107.912) [-1109.087] * [-1107.561] (-1109.014) (-1110.081) (-1106.322) -- 0:00:39
576000 -- (-1107.107) (-1107.005) [-1109.224] (-1108.226) * (-1111.403) (-1106.869) (-1107.510) [-1111.216] -- 0:00:39
576500 -- (-1107.025) (-1108.893) [-1105.880] (-1107.636) * [-1106.720] (-1112.531) (-1107.435) (-1109.334) -- 0:00:39
577000 -- (-1106.613) (-1111.169) (-1108.174) [-1106.435] * (-1108.589) (-1111.635) [-1105.394] (-1111.891) -- 0:00:39
577500 -- (-1110.260) (-1114.311) (-1106.510) [-1105.845] * [-1106.435] (-1106.006) (-1105.992) (-1106.470) -- 0:00:39
578000 -- [-1106.955] (-1111.642) (-1108.284) (-1109.785) * (-1106.658) [-1105.478] (-1109.038) (-1106.364) -- 0:00:39
578500 -- [-1106.665] (-1114.150) (-1108.143) (-1110.973) * (-1110.157) (-1107.451) [-1107.640] (-1106.235) -- 0:00:39
579000 -- (-1108.118) (-1108.778) (-1108.957) [-1105.972] * (-1109.988) (-1105.632) [-1109.552] (-1106.497) -- 0:00:39
579500 -- (-1106.673) (-1107.597) (-1110.690) [-1106.384] * (-1106.875) (-1108.167) [-1109.376] (-1106.102) -- 0:00:39
580000 -- [-1107.649] (-1108.558) (-1108.840) (-1106.052) * (-1107.404) (-1107.683) (-1108.777) [-1111.177] -- 0:00:39
Average standard deviation of split frequencies: 0.009417
580500 -- [-1105.900] (-1112.886) (-1106.845) (-1105.968) * (-1109.117) [-1107.247] (-1107.712) (-1106.913) -- 0:00:39
581000 -- (-1107.218) (-1107.465) [-1105.346] (-1111.434) * (-1108.063) (-1107.842) [-1106.330] (-1106.532) -- 0:00:39
581500 -- (-1109.100) (-1107.046) (-1107.871) [-1109.276] * (-1105.687) (-1108.730) [-1107.684] (-1107.436) -- 0:00:39
582000 -- (-1108.398) (-1107.568) (-1110.586) [-1107.308] * (-1106.730) [-1106.366] (-1109.080) (-1107.156) -- 0:00:39
582500 -- (-1107.416) [-1107.739] (-1108.761) (-1110.608) * (-1107.141) (-1107.939) (-1106.998) [-1110.505] -- 0:00:39
583000 -- (-1109.864) (-1108.977) [-1106.853] (-1109.515) * (-1109.601) (-1112.016) [-1105.649] (-1109.621) -- 0:00:39
583500 -- (-1106.069) (-1108.677) (-1107.990) [-1108.125] * (-1107.448) [-1107.023] (-1107.415) (-1106.694) -- 0:00:39
584000 -- (-1106.069) [-1108.380] (-1106.531) (-1105.474) * [-1106.962] (-1112.907) (-1106.843) (-1108.471) -- 0:00:39
584500 -- (-1105.628) (-1109.016) (-1106.853) [-1107.915] * (-1107.032) (-1113.575) (-1109.845) [-1110.463] -- 0:00:39
585000 -- (-1107.524) (-1109.328) [-1106.627] (-1109.838) * [-1107.144] (-1109.506) (-1110.217) (-1108.481) -- 0:00:39
Average standard deviation of split frequencies: 0.009804
585500 -- (-1107.428) [-1108.493] (-1107.139) (-1106.082) * (-1109.435) (-1109.759) [-1108.785] (-1105.098) -- 0:00:38
586000 -- (-1107.268) (-1107.607) [-1106.458] (-1108.578) * [-1107.621] (-1106.100) (-1108.705) (-1105.668) -- 0:00:38
586500 -- [-1107.687] (-1108.899) (-1107.381) (-1106.735) * [-1107.626] (-1106.599) (-1108.590) (-1105.719) -- 0:00:38
587000 -- (-1108.034) (-1110.909) (-1107.830) [-1108.592] * (-1111.596) [-1105.351] (-1106.428) (-1107.793) -- 0:00:38
587500 -- [-1105.422] (-1106.410) (-1107.146) (-1106.170) * [-1105.984] (-1107.566) (-1109.081) (-1109.634) -- 0:00:38
588000 -- (-1106.759) (-1106.839) (-1109.124) [-1106.854] * (-1108.026) (-1107.873) [-1109.445] (-1107.673) -- 0:00:38
588500 -- [-1105.348] (-1106.014) (-1105.476) (-1107.462) * [-1112.644] (-1109.053) (-1106.593) (-1107.727) -- 0:00:38
589000 -- [-1106.376] (-1106.389) (-1108.333) (-1105.917) * (-1108.651) (-1110.319) (-1108.466) [-1110.596] -- 0:00:38
589500 -- [-1107.407] (-1106.205) (-1108.226) (-1106.908) * [-1107.615] (-1109.080) (-1109.866) (-1106.534) -- 0:00:38
590000 -- (-1106.369) (-1106.218) (-1109.326) [-1105.470] * [-1106.152] (-1108.973) (-1105.758) (-1108.951) -- 0:00:38
Average standard deviation of split frequencies: 0.009737
590500 -- (-1108.077) (-1108.102) (-1108.724) [-1107.386] * (-1107.107) (-1110.531) [-1106.756] (-1106.317) -- 0:00:38
591000 -- (-1108.599) (-1107.367) [-1105.405] (-1106.425) * [-1106.940] (-1108.600) (-1109.204) (-1109.702) -- 0:00:38
591500 -- (-1108.980) (-1107.899) [-1105.323] (-1105.769) * (-1108.326) (-1111.731) [-1107.724] (-1105.876) -- 0:00:37
592000 -- (-1108.018) [-1108.825] (-1106.768) (-1107.386) * (-1106.436) (-1106.885) [-1107.692] (-1107.159) -- 0:00:38
592500 -- [-1109.009] (-1107.680) (-1107.544) (-1107.899) * (-1112.385) [-1106.023] (-1109.621) (-1109.186) -- 0:00:38
593000 -- [-1108.975] (-1110.473) (-1107.422) (-1106.974) * (-1107.006) (-1110.709) (-1110.971) [-1105.505] -- 0:00:38
593500 -- (-1106.855) (-1112.677) [-1105.977] (-1107.084) * (-1106.573) (-1107.621) (-1111.889) [-1107.905] -- 0:00:38
594000 -- [-1110.390] (-1108.666) (-1105.542) (-1107.371) * [-1106.898] (-1108.153) (-1108.094) (-1105.845) -- 0:00:38
594500 -- (-1107.979) [-1106.079] (-1108.188) (-1107.405) * [-1107.889] (-1107.134) (-1108.435) (-1110.152) -- 0:00:38
595000 -- (-1108.221) [-1108.428] (-1108.130) (-1105.442) * (-1106.336) (-1106.382) (-1107.797) [-1110.517] -- 0:00:38
Average standard deviation of split frequencies: 0.009122
595500 -- (-1106.137) (-1107.576) (-1106.197) [-1105.901] * (-1107.267) (-1111.070) (-1107.479) [-1108.034] -- 0:00:38
596000 -- [-1106.290] (-1106.977) (-1116.191) (-1110.941) * (-1106.957) [-1109.885] (-1106.216) (-1106.659) -- 0:00:37
596500 -- (-1106.171) (-1109.194) [-1105.202] (-1111.112) * (-1110.550) (-1107.994) [-1106.043] (-1106.843) -- 0:00:37
597000 -- [-1105.581] (-1110.886) (-1106.420) (-1108.557) * [-1108.638] (-1110.360) (-1107.684) (-1106.884) -- 0:00:37
597500 -- [-1106.630] (-1112.569) (-1106.385) (-1106.461) * [-1108.095] (-1110.090) (-1109.674) (-1106.252) -- 0:00:37
598000 -- [-1106.872] (-1115.019) (-1107.015) (-1110.080) * (-1109.219) (-1110.402) (-1107.999) [-1107.417] -- 0:00:37
598500 -- (-1108.808) (-1106.059) (-1105.445) [-1106.224] * [-1107.043] (-1108.665) (-1106.935) (-1106.412) -- 0:00:37
599000 -- (-1109.277) (-1108.002) [-1105.749] (-1108.490) * (-1105.829) (-1108.187) [-1106.020] (-1108.227) -- 0:00:37
599500 -- (-1106.154) (-1109.234) [-1107.992] (-1109.165) * (-1108.008) [-1109.518] (-1106.620) (-1107.738) -- 0:00:37
600000 -- (-1107.669) (-1109.987) (-1108.770) [-1106.959] * (-1105.770) (-1111.075) (-1108.643) [-1106.097] -- 0:00:37
Average standard deviation of split frequencies: 0.008999
600500 -- (-1107.985) [-1106.935] (-1108.060) (-1106.588) * [-1105.605] (-1108.229) (-1106.135) (-1105.637) -- 0:00:37
601000 -- (-1106.485) (-1108.322) (-1105.977) [-1106.215] * [-1105.531] (-1107.326) (-1105.638) (-1106.314) -- 0:00:37
601500 -- [-1105.307] (-1110.462) (-1109.799) (-1106.456) * (-1105.457) (-1106.423) [-1105.612] (-1112.102) -- 0:00:37
602000 -- [-1108.096] (-1108.237) (-1109.263) (-1108.289) * [-1105.256] (-1106.462) (-1105.944) (-1111.196) -- 0:00:37
602500 -- (-1114.460) [-1107.052] (-1107.123) (-1108.965) * [-1105.764] (-1107.526) (-1105.656) (-1107.156) -- 0:00:36
603000 -- (-1110.652) (-1110.035) [-1106.603] (-1108.576) * (-1116.006) (-1108.837) [-1109.227] (-1106.594) -- 0:00:36
603500 -- (-1111.241) (-1108.121) (-1108.096) [-1107.011] * [-1109.810] (-1106.722) (-1111.022) (-1106.393) -- 0:00:36
604000 -- (-1105.577) (-1106.671) (-1106.309) [-1105.588] * (-1107.086) [-1106.371] (-1110.823) (-1105.796) -- 0:00:37
604500 -- (-1107.923) (-1107.978) (-1106.662) [-1105.952] * [-1105.494] (-1107.732) (-1107.221) (-1106.771) -- 0:00:37
605000 -- (-1109.727) (-1105.824) [-1105.547] (-1105.989) * (-1108.340) (-1107.382) (-1106.819) [-1106.540] -- 0:00:37
Average standard deviation of split frequencies: 0.009387
605500 -- [-1106.152] (-1107.127) (-1106.139) (-1105.846) * (-1109.010) [-1105.916] (-1109.595) (-1106.750) -- 0:00:37
606000 -- (-1107.383) [-1107.345] (-1108.154) (-1106.121) * (-1108.593) [-1106.073] (-1107.558) (-1108.360) -- 0:00:37
606500 -- [-1105.676] (-1106.843) (-1106.802) (-1107.514) * (-1106.352) (-1106.033) [-1107.811] (-1105.687) -- 0:00:36
607000 -- (-1106.416) [-1106.054] (-1107.083) (-1114.855) * (-1108.754) (-1106.597) (-1107.057) [-1105.408] -- 0:00:36
607500 -- [-1108.768] (-1106.019) (-1108.610) (-1109.804) * [-1106.896] (-1106.915) (-1105.552) (-1105.530) -- 0:00:36
608000 -- (-1106.767) (-1107.401) [-1107.059] (-1108.690) * (-1107.259) (-1116.311) [-1105.969] (-1108.061) -- 0:00:36
608500 -- (-1109.075) [-1106.203] (-1105.593) (-1105.789) * (-1105.548) (-1107.730) [-1105.923] (-1108.020) -- 0:00:36
609000 -- (-1110.705) (-1105.992) [-1106.823] (-1105.719) * [-1105.599] (-1107.331) (-1110.803) (-1108.336) -- 0:00:36
609500 -- (-1107.370) (-1105.380) [-1107.809] (-1107.577) * (-1105.869) (-1108.071) [-1107.192] (-1105.662) -- 0:00:36
610000 -- (-1106.140) (-1107.464) [-1108.115] (-1109.434) * (-1107.832) [-1108.057] (-1109.514) (-1106.467) -- 0:00:36
Average standard deviation of split frequencies: 0.009212
610500 -- [-1108.234] (-1106.459) (-1107.480) (-1106.005) * (-1105.565) [-1105.831] (-1112.196) (-1105.410) -- 0:00:36
611000 -- (-1105.309) [-1108.685] (-1105.724) (-1106.384) * [-1105.663] (-1106.750) (-1107.472) (-1107.009) -- 0:00:36
611500 -- [-1108.555] (-1108.685) (-1107.120) (-1106.387) * (-1110.416) (-1110.186) (-1107.484) [-1107.728] -- 0:00:36
612000 -- [-1105.790] (-1106.396) (-1109.452) (-1111.288) * (-1110.059) (-1107.967) (-1115.018) [-1106.680] -- 0:00:36
612500 -- [-1105.851] (-1106.396) (-1109.218) (-1108.203) * [-1107.631] (-1105.929) (-1110.861) (-1106.139) -- 0:00:36
613000 -- [-1108.043] (-1106.558) (-1109.347) (-1107.247) * [-1108.569] (-1106.280) (-1110.313) (-1106.019) -- 0:00:35
613500 -- [-1107.774] (-1106.807) (-1106.107) (-1106.366) * (-1105.638) [-1108.060] (-1109.804) (-1107.073) -- 0:00:35
614000 -- [-1106.107] (-1105.991) (-1111.369) (-1107.231) * (-1107.238) [-1106.122] (-1108.458) (-1110.403) -- 0:00:35
614500 -- [-1107.923] (-1106.264) (-1107.778) (-1107.647) * [-1106.167] (-1106.444) (-1111.380) (-1109.414) -- 0:00:35
615000 -- [-1107.220] (-1105.714) (-1105.589) (-1107.719) * (-1107.213) (-1105.943) (-1110.182) [-1105.947] -- 0:00:35
Average standard deviation of split frequencies: 0.009540
615500 -- [-1106.563] (-1106.007) (-1107.130) (-1106.629) * (-1106.430) (-1106.668) (-1107.519) [-1106.661] -- 0:00:36
616000 -- (-1108.366) (-1106.693) (-1106.533) [-1107.146] * (-1107.981) (-1108.640) [-1106.516] (-1105.993) -- 0:00:36
616500 -- (-1106.693) (-1107.528) [-1105.968] (-1108.809) * (-1107.987) (-1106.879) (-1106.202) [-1105.186] -- 0:00:36
617000 -- (-1108.345) (-1108.791) [-1105.520] (-1108.204) * (-1107.477) [-1108.033] (-1114.386) (-1105.500) -- 0:00:36
617500 -- (-1108.832) [-1106.716] (-1110.071) (-1107.324) * [-1108.585] (-1109.120) (-1108.245) (-1106.293) -- 0:00:35
618000 -- (-1107.251) (-1108.736) (-1110.904) [-1107.244] * (-1111.514) (-1110.869) (-1110.258) [-1105.958] -- 0:00:35
618500 -- [-1106.128] (-1106.884) (-1111.885) (-1107.047) * (-1109.274) (-1107.600) [-1107.591] (-1106.166) -- 0:00:35
619000 -- (-1108.339) (-1107.564) (-1108.067) [-1106.385] * [-1107.282] (-1108.011) (-1106.980) (-1105.882) -- 0:00:35
619500 -- (-1109.986) (-1106.986) (-1108.870) [-1105.682] * [-1106.874] (-1107.409) (-1112.168) (-1108.627) -- 0:00:35
620000 -- (-1114.721) (-1105.452) (-1108.637) [-1107.128] * (-1108.663) [-1108.045] (-1112.879) (-1106.002) -- 0:00:35
Average standard deviation of split frequencies: 0.009722
620500 -- [-1110.540] (-1109.065) (-1108.242) (-1106.504) * (-1111.602) (-1105.109) [-1105.394] (-1106.165) -- 0:00:35
621000 -- [-1108.288] (-1108.218) (-1106.283) (-1108.452) * (-1112.252) (-1108.019) [-1105.356] (-1107.191) -- 0:00:35
621500 -- (-1107.049) [-1107.662] (-1107.381) (-1110.188) * (-1110.215) [-1107.294] (-1106.080) (-1105.873) -- 0:00:35
622000 -- (-1108.825) (-1108.662) (-1108.854) [-1107.646] * (-1109.824) [-1106.705] (-1106.772) (-1106.388) -- 0:00:35
622500 -- (-1107.316) (-1106.642) (-1105.608) [-1107.804] * (-1109.755) (-1107.923) [-1107.850] (-1105.905) -- 0:00:35
623000 -- [-1105.720] (-1105.075) (-1108.092) (-1105.352) * (-1107.952) (-1109.071) (-1108.391) [-1109.053] -- 0:00:35
623500 -- (-1107.607) (-1105.947) [-1106.893] (-1109.127) * (-1107.457) [-1107.441] (-1110.834) (-1106.111) -- 0:00:35
624000 -- (-1107.122) (-1105.943) (-1106.831) [-1107.279] * [-1111.502] (-1109.233) (-1108.609) (-1109.392) -- 0:00:34
624500 -- [-1108.952] (-1106.271) (-1105.977) (-1110.352) * (-1106.356) (-1106.110) (-1105.829) [-1105.628] -- 0:00:34
625000 -- (-1108.022) (-1108.807) (-1105.826) [-1109.064] * (-1106.601) (-1106.529) (-1109.701) [-1105.602] -- 0:00:34
Average standard deviation of split frequencies: 0.009739
625500 -- [-1105.671] (-1105.472) (-1110.834) (-1107.890) * (-1107.855) [-1106.655] (-1107.022) (-1106.022) -- 0:00:34
626000 -- (-1105.727) [-1106.772] (-1107.967) (-1108.107) * (-1108.901) (-1108.190) [-1106.070] (-1111.664) -- 0:00:34
626500 -- [-1105.378] (-1105.725) (-1107.881) (-1109.705) * (-1108.953) (-1111.022) (-1106.158) [-1107.306] -- 0:00:34
627000 -- (-1106.374) (-1106.253) [-1106.571] (-1108.205) * [-1106.531] (-1108.308) (-1106.776) (-1106.819) -- 0:00:35
627500 -- (-1107.864) (-1106.276) [-1107.298] (-1107.744) * (-1106.257) (-1107.315) (-1105.729) [-1108.534] -- 0:00:35
628000 -- (-1106.601) (-1108.756) [-1105.487] (-1105.692) * (-1107.738) (-1106.448) (-1105.650) [-1106.596] -- 0:00:34
628500 -- [-1107.730] (-1110.722) (-1106.717) (-1106.223) * (-1106.946) [-1106.641] (-1106.590) (-1106.949) -- 0:00:34
629000 -- [-1107.182] (-1109.656) (-1107.411) (-1106.654) * (-1106.912) (-1108.736) (-1109.269) [-1108.850] -- 0:00:34
629500 -- [-1109.269] (-1105.899) (-1107.359) (-1108.552) * [-1106.825] (-1107.161) (-1110.487) (-1106.584) -- 0:00:34
630000 -- (-1109.217) (-1105.835) [-1106.710] (-1108.990) * (-1110.257) (-1106.518) [-1109.381] (-1107.580) -- 0:00:34
Average standard deviation of split frequencies: 0.009343
630500 -- (-1107.802) [-1106.856] (-1108.865) (-1108.026) * [-1108.364] (-1106.854) (-1116.263) (-1106.195) -- 0:00:34
631000 -- (-1108.247) (-1108.296) [-1108.341] (-1109.923) * (-1105.616) (-1106.043) (-1110.151) [-1108.400] -- 0:00:34
631500 -- [-1109.133] (-1107.203) (-1110.599) (-1110.798) * (-1109.552) (-1107.436) [-1110.099] (-1110.002) -- 0:00:34
632000 -- (-1106.241) [-1108.070] (-1108.155) (-1108.967) * (-1110.725) [-1106.376] (-1108.509) (-1107.091) -- 0:00:34
632500 -- (-1106.137) [-1107.300] (-1107.204) (-1108.014) * (-1107.705) (-1110.968) (-1107.994) [-1105.232] -- 0:00:34
633000 -- (-1105.495) (-1108.589) (-1107.198) [-1107.861] * (-1107.678) (-1108.775) (-1106.261) [-1110.841] -- 0:00:34
633500 -- [-1105.859] (-1113.772) (-1106.133) (-1107.716) * [-1106.240] (-1107.043) (-1108.281) (-1106.156) -- 0:00:34
634000 -- (-1110.005) [-1106.930] (-1105.919) (-1112.887) * [-1106.097] (-1107.350) (-1105.368) (-1106.158) -- 0:00:34
634500 -- (-1114.559) (-1106.566) [-1106.186] (-1107.470) * (-1106.512) (-1108.000) (-1109.354) [-1105.347] -- 0:00:33
635000 -- [-1111.132] (-1106.989) (-1107.225) (-1108.166) * (-1106.521) [-1109.177] (-1109.668) (-1106.492) -- 0:00:33
Average standard deviation of split frequencies: 0.009311
635500 -- (-1107.130) [-1106.774] (-1112.010) (-1109.194) * (-1107.541) (-1110.935) [-1108.854] (-1106.111) -- 0:00:33
636000 -- (-1110.127) (-1106.548) (-1110.425) [-1108.500] * (-1110.717) (-1108.576) [-1107.303] (-1105.551) -- 0:00:33
636500 -- (-1108.187) (-1105.237) (-1109.939) [-1106.299] * (-1107.700) (-1107.089) [-1111.844] (-1106.285) -- 0:00:33
637000 -- (-1107.512) [-1106.841] (-1108.101) (-1105.300) * (-1108.091) (-1105.917) [-1106.582] (-1105.621) -- 0:00:33
637500 -- (-1108.996) (-1107.138) (-1107.560) [-1106.722] * (-1111.551) (-1105.126) (-1106.997) [-1106.519] -- 0:00:33
638000 -- [-1107.978] (-1109.470) (-1110.412) (-1112.517) * (-1109.274) (-1106.459) (-1109.128) [-1108.590] -- 0:00:33
638500 -- (-1105.693) (-1110.258) [-1108.013] (-1116.395) * (-1108.050) (-1105.582) (-1108.927) [-1108.701] -- 0:00:33
639000 -- [-1105.991] (-1105.834) (-1108.151) (-1106.576) * (-1112.370) [-1105.597] (-1105.839) (-1108.272) -- 0:00:33
639500 -- (-1106.382) [-1106.481] (-1107.055) (-1105.280) * (-1106.976) (-1106.430) (-1106.708) [-1106.462] -- 0:00:33
640000 -- [-1106.070] (-1108.553) (-1110.261) (-1108.290) * [-1110.804] (-1108.880) (-1109.321) (-1105.600) -- 0:00:33
Average standard deviation of split frequencies: 0.009519
640500 -- (-1105.723) (-1108.725) [-1107.100] (-1112.119) * (-1106.820) (-1107.418) (-1108.026) [-1106.979] -- 0:00:33
641000 -- (-1106.349) (-1106.717) [-1108.171] (-1105.143) * (-1107.373) (-1108.241) (-1108.503) [-1106.975] -- 0:00:33
641500 -- (-1107.008) (-1110.408) (-1110.645) [-1105.104] * [-1106.213] (-1107.411) (-1108.509) (-1109.303) -- 0:00:33
642000 -- (-1109.249) (-1109.666) (-1107.486) [-1107.199] * (-1106.586) [-1107.318] (-1107.687) (-1106.482) -- 0:00:33
642500 -- (-1110.488) (-1106.406) [-1108.849] (-1105.388) * [-1105.853] (-1106.732) (-1106.156) (-1106.079) -- 0:00:33
643000 -- (-1108.831) (-1108.795) (-1108.453) [-1105.980] * [-1106.268] (-1106.815) (-1108.115) (-1106.426) -- 0:00:33
643500 -- (-1105.470) (-1107.493) [-1108.742] (-1111.213) * (-1108.346) (-1106.477) [-1106.335] (-1109.211) -- 0:00:33
644000 -- (-1109.171) [-1109.796] (-1106.267) (-1111.513) * [-1107.826] (-1107.336) (-1109.321) (-1106.414) -- 0:00:33
644500 -- [-1107.113] (-1108.164) (-1106.232) (-1108.419) * (-1107.842) (-1107.066) [-1106.197] (-1109.345) -- 0:00:33
645000 -- (-1108.456) (-1107.100) (-1107.646) [-1107.061] * [-1108.341] (-1105.837) (-1106.426) (-1108.225) -- 0:00:33
Average standard deviation of split frequencies: 0.009122
645500 -- (-1106.298) [-1113.119] (-1109.746) (-1106.570) * (-1107.160) [-1106.467] (-1106.988) (-1106.853) -- 0:00:32
646000 -- (-1105.639) (-1108.194) (-1106.075) [-1110.698] * [-1106.416] (-1107.660) (-1105.591) (-1106.650) -- 0:00:32
646500 -- [-1105.688] (-1106.226) (-1106.062) (-1110.526) * (-1106.317) (-1107.905) (-1109.284) [-1106.995] -- 0:00:32
647000 -- [-1105.353] (-1106.104) (-1105.993) (-1109.555) * (-1106.677) (-1108.458) [-1106.582] (-1110.149) -- 0:00:32
647500 -- (-1107.331) (-1108.264) (-1112.216) [-1106.462] * [-1108.070] (-1107.244) (-1115.788) (-1108.625) -- 0:00:32
648000 -- (-1108.256) (-1105.814) (-1108.353) [-1107.548] * (-1109.377) (-1107.522) [-1113.224] (-1106.488) -- 0:00:32
648500 -- (-1105.696) [-1105.437] (-1109.345) (-1108.437) * (-1108.801) (-1106.268) (-1109.782) [-1105.722] -- 0:00:32
649000 -- (-1107.445) [-1109.701] (-1105.795) (-1110.627) * [-1106.367] (-1107.366) (-1109.265) (-1106.921) -- 0:00:32
649500 -- [-1105.568] (-1105.453) (-1107.236) (-1106.157) * (-1106.676) (-1109.226) (-1110.383) [-1109.008] -- 0:00:32
650000 -- (-1107.859) (-1105.452) [-1105.526] (-1108.701) * (-1106.962) [-1108.641] (-1105.611) (-1107.934) -- 0:00:32
Average standard deviation of split frequencies: 0.008308
650500 -- (-1111.409) (-1107.047) (-1106.756) [-1110.220] * (-1108.224) (-1106.190) (-1107.073) [-1105.535] -- 0:00:32
651000 -- (-1106.533) [-1107.265] (-1106.695) (-1110.086) * (-1106.461) (-1108.450) [-1105.947] (-1105.842) -- 0:00:32
651500 -- [-1105.605] (-1107.753) (-1108.573) (-1110.891) * (-1108.080) (-1109.937) [-1105.443] (-1106.344) -- 0:00:32
652000 -- (-1105.863) (-1105.135) (-1109.914) [-1106.214] * (-1107.418) (-1105.807) (-1112.500) [-1105.626] -- 0:00:32
652500 -- (-1105.232) [-1105.135] (-1109.529) (-1108.774) * (-1105.376) [-1108.465] (-1109.542) (-1110.874) -- 0:00:32
653000 -- [-1106.408] (-1111.959) (-1107.275) (-1106.604) * (-1105.515) (-1112.691) [-1105.617] (-1113.343) -- 0:00:32
653500 -- (-1110.532) (-1107.506) (-1107.363) [-1106.447] * (-1106.007) (-1107.107) [-1106.841] (-1108.616) -- 0:00:32
654000 -- (-1106.159) [-1106.623] (-1106.718) (-1106.232) * (-1106.116) [-1105.348] (-1105.668) (-1108.313) -- 0:00:32
654500 -- [-1106.978] (-1108.735) (-1107.932) (-1111.253) * [-1106.890] (-1105.585) (-1105.480) (-1105.675) -- 0:00:32
655000 -- (-1109.859) (-1106.609) [-1108.002] (-1109.554) * [-1106.980] (-1107.863) (-1107.644) (-1106.177) -- 0:00:32
Average standard deviation of split frequencies: 0.008384
655500 -- (-1107.360) (-1106.709) (-1107.054) [-1113.858] * (-1107.333) [-1106.174] (-1106.618) (-1106.248) -- 0:00:32
656000 -- (-1106.934) (-1108.829) [-1112.213] (-1108.477) * [-1106.688] (-1109.438) (-1108.058) (-1107.671) -- 0:00:31
656500 -- [-1105.784] (-1111.660) (-1108.153) (-1106.230) * [-1112.856] (-1109.328) (-1110.005) (-1107.279) -- 0:00:31
657000 -- (-1105.090) [-1106.838] (-1108.554) (-1108.236) * [-1109.403] (-1106.365) (-1110.815) (-1105.573) -- 0:00:31
657500 -- [-1105.992] (-1107.494) (-1107.290) (-1107.415) * [-1106.628] (-1106.334) (-1110.821) (-1105.640) -- 0:00:31
658000 -- (-1107.862) (-1106.189) [-1106.882] (-1106.367) * (-1106.052) (-1106.517) (-1108.614) [-1107.994] -- 0:00:31
658500 -- (-1108.675) (-1106.631) [-1110.285] (-1109.207) * (-1107.134) (-1107.768) (-1108.971) [-1107.808] -- 0:00:31
659000 -- (-1105.999) (-1105.704) [-1108.267] (-1106.352) * (-1108.809) (-1106.083) (-1106.970) [-1107.886] -- 0:00:31
659500 -- [-1110.542] (-1105.773) (-1107.497) (-1107.151) * (-1107.825) [-1107.796] (-1106.888) (-1108.267) -- 0:00:31
660000 -- (-1108.774) [-1106.188] (-1107.110) (-1111.625) * (-1110.445) [-1105.416] (-1107.327) (-1110.607) -- 0:00:31
Average standard deviation of split frequencies: 0.008182
660500 -- (-1110.609) (-1106.666) [-1106.322] (-1107.690) * [-1106.317] (-1107.171) (-1107.942) (-1105.344) -- 0:00:31
661000 -- [-1106.976] (-1109.090) (-1110.082) (-1108.984) * (-1107.756) (-1109.673) [-1109.370] (-1105.278) -- 0:00:31
661500 -- (-1107.729) (-1105.730) (-1107.728) [-1108.357] * (-1106.840) (-1106.228) [-1105.851] (-1106.941) -- 0:00:31
662000 -- [-1106.299] (-1106.719) (-1108.288) (-1108.647) * (-1106.115) (-1111.019) (-1109.942) [-1107.979] -- 0:00:31
662500 -- (-1106.785) (-1108.288) [-1108.495] (-1108.045) * [-1109.450] (-1106.877) (-1108.477) (-1106.995) -- 0:00:31
663000 -- (-1106.178) [-1106.659] (-1108.817) (-1107.017) * (-1111.937) [-1107.360] (-1107.765) (-1107.825) -- 0:00:31
663500 -- [-1106.723] (-1107.180) (-1106.931) (-1106.516) * (-1107.523) (-1107.747) (-1110.505) [-1107.720] -- 0:00:31
664000 -- (-1105.596) (-1109.822) (-1105.628) [-1107.337] * [-1106.443] (-1106.510) (-1111.311) (-1105.805) -- 0:00:31
664500 -- [-1107.142] (-1105.899) (-1109.803) (-1108.430) * (-1109.459) (-1106.735) [-1107.225] (-1107.727) -- 0:00:31
665000 -- (-1105.950) (-1106.416) (-1107.215) [-1107.606] * (-1107.108) (-1108.712) (-1108.723) [-1106.847] -- 0:00:31
Average standard deviation of split frequencies: 0.008361
665500 -- [-1109.191] (-1108.065) (-1105.442) (-1111.424) * (-1108.892) (-1110.097) (-1107.450) [-1106.761] -- 0:00:31
666000 -- (-1106.275) [-1106.924] (-1107.334) (-1109.701) * (-1109.785) (-1108.665) [-1105.702] (-1109.813) -- 0:00:31
666500 -- (-1107.620) (-1109.869) (-1111.053) [-1105.192] * (-1107.279) (-1106.542) (-1105.884) [-1106.162] -- 0:00:31
667000 -- (-1106.149) (-1107.608) (-1107.514) [-1108.513] * [-1107.425] (-1107.220) (-1105.952) (-1106.747) -- 0:00:30
667500 -- (-1108.200) [-1107.414] (-1112.768) (-1108.359) * (-1106.576) [-1106.234] (-1106.019) (-1106.675) -- 0:00:30
668000 -- (-1106.208) (-1107.586) (-1110.154) [-1105.776] * (-1105.877) (-1107.503) (-1105.680) [-1106.832] -- 0:00:30
668500 -- (-1108.311) [-1107.919] (-1110.989) (-1106.593) * [-1107.436] (-1107.028) (-1112.375) (-1105.891) -- 0:00:30
669000 -- (-1105.983) (-1107.944) [-1105.280] (-1105.380) * (-1108.971) (-1113.291) [-1105.314] (-1105.683) -- 0:00:30
669500 -- (-1107.143) (-1105.408) [-1105.412] (-1107.421) * [-1109.927] (-1111.636) (-1106.567) (-1105.446) -- 0:00:30
670000 -- (-1110.525) [-1107.501] (-1106.413) (-1105.843) * (-1105.586) [-1108.984] (-1108.037) (-1108.188) -- 0:00:30
Average standard deviation of split frequencies: 0.009138
670500 -- (-1108.290) (-1106.777) [-1106.760] (-1108.334) * (-1106.929) (-1108.333) [-1112.239] (-1113.944) -- 0:00:30
671000 -- [-1108.473] (-1106.953) (-1106.911) (-1106.938) * [-1110.620] (-1109.402) (-1107.466) (-1106.165) -- 0:00:30
671500 -- [-1106.318] (-1105.188) (-1107.048) (-1105.897) * (-1111.163) [-1106.706] (-1106.226) (-1109.762) -- 0:00:30
672000 -- (-1112.437) [-1105.165] (-1105.757) (-1107.600) * (-1108.573) [-1107.243] (-1108.188) (-1105.836) -- 0:00:30
672500 -- (-1108.033) (-1107.242) [-1107.939] (-1109.935) * [-1106.956] (-1110.678) (-1106.683) (-1107.690) -- 0:00:30
673000 -- (-1106.316) (-1106.786) [-1106.252] (-1107.335) * (-1105.775) [-1107.508] (-1109.378) (-1110.731) -- 0:00:30
673500 -- (-1107.096) [-1106.096] (-1105.814) (-1105.987) * (-1105.745) (-1111.772) [-1107.263] (-1110.076) -- 0:00:30
674000 -- (-1106.659) [-1108.105] (-1106.432) (-1109.497) * [-1105.884] (-1115.756) (-1106.605) (-1109.753) -- 0:00:30
674500 -- (-1106.363) (-1106.643) [-1107.676] (-1107.168) * (-1107.001) (-1113.902) [-1105.822] (-1107.572) -- 0:00:30
675000 -- (-1109.245) (-1106.023) (-1105.437) [-1106.258] * [-1105.611] (-1106.506) (-1107.866) (-1106.009) -- 0:00:30
Average standard deviation of split frequencies: 0.009240
675500 -- (-1106.203) (-1107.663) (-1108.388) [-1106.492] * (-1106.534) [-1107.513] (-1109.858) (-1105.553) -- 0:00:30
676000 -- (-1107.665) [-1107.452] (-1110.161) (-1108.417) * (-1109.302) [-1105.975] (-1110.084) (-1107.048) -- 0:00:30
676500 -- [-1105.991] (-1111.634) (-1108.961) (-1108.741) * [-1106.905] (-1105.760) (-1107.111) (-1113.349) -- 0:00:30
677000 -- (-1106.837) (-1110.304) (-1108.962) [-1107.570] * (-1106.569) (-1107.073) (-1108.937) [-1107.517] -- 0:00:30
677500 -- (-1108.904) [-1106.881] (-1108.128) (-1113.203) * [-1107.447] (-1107.700) (-1108.646) (-1108.992) -- 0:00:29
678000 -- (-1108.858) [-1105.997] (-1105.620) (-1108.194) * (-1106.792) (-1113.336) (-1111.144) [-1107.245] -- 0:00:29
678500 -- [-1108.942] (-1107.757) (-1110.039) (-1113.659) * [-1108.796] (-1110.361) (-1108.584) (-1107.449) -- 0:00:29
679000 -- (-1106.280) [-1107.384] (-1114.520) (-1106.977) * (-1106.955) (-1108.198) (-1105.951) [-1106.318] -- 0:00:29
679500 -- (-1106.444) [-1108.778] (-1110.540) (-1112.321) * (-1105.937) (-1110.680) [-1105.877] (-1108.680) -- 0:00:29
680000 -- (-1118.055) [-1112.746] (-1109.551) (-1109.323) * (-1106.215) (-1107.290) (-1105.685) [-1105.759] -- 0:00:29
Average standard deviation of split frequencies: 0.008960
680500 -- [-1106.800] (-1107.007) (-1113.526) (-1105.533) * [-1107.791] (-1106.371) (-1108.178) (-1105.398) -- 0:00:29
681000 -- (-1110.179) (-1106.884) (-1107.930) [-1106.712] * (-1108.390) (-1105.970) [-1108.592] (-1110.100) -- 0:00:29
681500 -- (-1108.414) (-1105.452) (-1106.833) [-1108.180] * [-1109.930] (-1109.186) (-1107.084) (-1110.108) -- 0:00:29
682000 -- (-1109.323) (-1108.212) [-1108.286] (-1107.557) * (-1109.417) (-1108.127) [-1108.239] (-1109.886) -- 0:00:29
682500 -- (-1109.423) (-1110.258) [-1110.409] (-1106.585) * (-1107.892) (-1108.065) [-1106.599] (-1109.911) -- 0:00:29
683000 -- (-1109.156) (-1105.818) [-1106.328] (-1108.428) * [-1108.718] (-1105.732) (-1107.087) (-1105.966) -- 0:00:29
683500 -- (-1108.333) [-1108.099] (-1106.666) (-1109.761) * (-1107.660) (-1108.135) (-1108.651) [-1105.286] -- 0:00:29
684000 -- (-1107.211) [-1108.842] (-1106.089) (-1107.684) * [-1107.879] (-1107.959) (-1106.043) (-1105.870) -- 0:00:29
684500 -- (-1105.936) (-1107.749) (-1108.867) [-1108.178] * (-1108.455) [-1105.718] (-1108.331) (-1109.312) -- 0:00:29
685000 -- [-1106.139] (-1113.177) (-1111.501) (-1108.511) * (-1105.464) [-1106.644] (-1110.458) (-1108.781) -- 0:00:29
Average standard deviation of split frequencies: 0.008719
685500 -- (-1108.901) (-1112.037) (-1108.061) [-1106.067] * (-1106.065) (-1107.229) (-1106.660) [-1106.538] -- 0:00:29
686000 -- (-1107.784) [-1111.293] (-1108.126) (-1106.121) * (-1105.978) [-1108.587] (-1108.605) (-1111.388) -- 0:00:29
686500 -- (-1110.000) (-1109.196) [-1109.744] (-1106.346) * [-1109.787] (-1108.410) (-1108.462) (-1114.707) -- 0:00:29
687000 -- [-1109.538] (-1106.606) (-1108.789) (-1109.312) * (-1109.999) (-1107.121) [-1106.298] (-1106.655) -- 0:00:29
687500 -- (-1106.194) (-1107.208) [-1107.754] (-1107.254) * (-1112.244) (-1106.405) (-1108.071) [-1109.046] -- 0:00:29
688000 -- (-1111.001) (-1107.252) [-1107.842] (-1108.184) * [-1109.064] (-1107.151) (-1106.008) (-1110.036) -- 0:00:29
688500 -- (-1105.570) (-1106.064) [-1110.095] (-1108.159) * (-1110.521) (-1107.681) (-1111.001) [-1107.150] -- 0:00:28
689000 -- (-1106.119) (-1106.489) [-1109.991] (-1106.148) * (-1112.685) [-1106.644] (-1106.764) (-1112.920) -- 0:00:28
689500 -- (-1107.562) (-1107.113) [-1106.548] (-1105.627) * (-1106.819) (-1107.022) [-1108.789] (-1114.805) -- 0:00:28
690000 -- (-1107.502) [-1105.794] (-1106.711) (-1105.577) * (-1106.205) [-1108.280] (-1108.267) (-1107.818) -- 0:00:28
Average standard deviation of split frequencies: 0.008827
690500 -- (-1107.502) (-1109.636) [-1106.912] (-1108.519) * [-1106.668] (-1111.289) (-1106.135) (-1113.929) -- 0:00:28
691000 -- (-1108.359) [-1107.756] (-1107.929) (-1107.777) * [-1106.765] (-1107.058) (-1107.288) (-1106.310) -- 0:00:28
691500 -- (-1109.639) (-1106.148) (-1106.645) [-1106.973] * (-1105.739) [-1105.913] (-1106.735) (-1108.383) -- 0:00:28
692000 -- (-1108.182) [-1109.291] (-1111.905) (-1107.053) * (-1109.377) [-1105.761] (-1109.990) (-1106.423) -- 0:00:28
692500 -- (-1107.006) (-1116.818) [-1108.059] (-1106.718) * (-1107.044) [-1106.834] (-1111.415) (-1108.766) -- 0:00:28
693000 -- (-1108.159) (-1106.297) [-1105.923] (-1106.997) * (-1106.939) (-1106.383) [-1109.703] (-1107.747) -- 0:00:28
693500 -- (-1112.335) (-1109.553) (-1106.518) [-1106.908] * (-1106.515) [-1105.117] (-1108.536) (-1109.356) -- 0:00:28
694000 -- (-1107.133) [-1106.240] (-1107.044) (-1105.206) * (-1108.517) (-1107.670) [-1107.528] (-1107.404) -- 0:00:28
694500 -- (-1107.626) (-1107.028) [-1106.403] (-1105.450) * (-1106.260) [-1105.688] (-1109.112) (-1107.532) -- 0:00:28
695000 -- (-1105.654) (-1106.130) [-1107.188] (-1107.654) * (-1107.274) [-1107.819] (-1107.957) (-1108.048) -- 0:00:28
Average standard deviation of split frequencies: 0.008624
695500 -- [-1105.890] (-1107.135) (-1105.658) (-1108.308) * [-1107.546] (-1109.617) (-1105.792) (-1106.061) -- 0:00:28
696000 -- (-1109.617) (-1108.168) (-1105.730) [-1108.773] * (-1106.316) (-1105.353) [-1107.759] (-1107.859) -- 0:00:28
696500 -- (-1107.679) [-1106.598] (-1109.144) (-1108.360) * (-1107.247) [-1110.124] (-1106.635) (-1105.696) -- 0:00:28
697000 -- (-1106.129) (-1105.805) (-1108.776) [-1107.193] * [-1106.937] (-1108.424) (-1106.265) (-1108.532) -- 0:00:28
697500 -- (-1105.703) (-1109.111) [-1109.437] (-1110.875) * (-1108.753) (-1106.820) [-1106.181] (-1109.421) -- 0:00:28
698000 -- (-1107.997) (-1106.333) [-1107.849] (-1108.425) * (-1106.606) [-1107.331] (-1109.430) (-1107.731) -- 0:00:28
698500 -- (-1108.046) (-1110.211) (-1105.267) [-1106.131] * [-1106.321] (-1105.615) (-1117.491) (-1107.101) -- 0:00:28
699000 -- (-1111.213) (-1107.171) (-1108.973) [-1105.566] * (-1106.426) (-1106.454) (-1116.609) [-1110.815] -- 0:00:27
699500 -- [-1105.833] (-1106.350) (-1108.149) (-1107.477) * [-1106.138] (-1106.068) (-1106.102) (-1107.058) -- 0:00:27
700000 -- [-1105.187] (-1105.887) (-1110.616) (-1106.538) * [-1106.950] (-1106.457) (-1107.855) (-1106.526) -- 0:00:27
Average standard deviation of split frequencies: 0.008971
700500 -- [-1105.207] (-1109.560) (-1107.569) (-1106.211) * [-1106.990] (-1106.661) (-1112.931) (-1107.515) -- 0:00:27
701000 -- (-1109.706) [-1112.393] (-1107.535) (-1105.948) * (-1106.959) [-1106.233] (-1107.124) (-1112.019) -- 0:00:27
701500 -- (-1110.865) (-1113.195) [-1107.160] (-1105.460) * (-1106.444) (-1107.880) (-1109.686) [-1105.623] -- 0:00:27
702000 -- [-1109.105] (-1109.734) (-1105.193) (-1108.022) * [-1111.353] (-1105.741) (-1107.782) (-1107.656) -- 0:00:27
702500 -- [-1110.091] (-1110.353) (-1108.385) (-1108.556) * [-1108.565] (-1105.529) (-1107.674) (-1106.608) -- 0:00:27
703000 -- (-1106.881) [-1106.749] (-1107.471) (-1108.713) * [-1110.125] (-1105.298) (-1108.480) (-1110.457) -- 0:00:27
703500 -- (-1105.456) (-1106.955) (-1108.147) [-1108.588] * (-1108.799) (-1105.968) [-1107.581] (-1108.092) -- 0:00:27
704000 -- [-1105.446] (-1105.894) (-1107.056) (-1105.636) * (-1107.951) (-1105.528) [-1105.734] (-1106.366) -- 0:00:27
704500 -- (-1106.739) [-1107.126] (-1108.872) (-1108.131) * (-1105.800) (-1109.218) (-1109.240) [-1109.610] -- 0:00:27
705000 -- (-1107.521) (-1110.555) [-1108.169] (-1106.548) * [-1108.459] (-1107.807) (-1114.774) (-1111.153) -- 0:00:27
Average standard deviation of split frequencies: 0.008992
705500 -- (-1110.397) (-1106.499) [-1105.505] (-1109.507) * (-1105.497) [-1105.114] (-1110.803) (-1113.470) -- 0:00:27
706000 -- (-1111.274) (-1106.770) [-1106.760] (-1108.352) * (-1106.072) (-1112.085) [-1113.322] (-1108.927) -- 0:00:27
706500 -- (-1107.817) [-1107.365] (-1106.448) (-1111.089) * (-1106.158) (-1114.545) (-1110.778) [-1107.236] -- 0:00:27
707000 -- (-1107.472) [-1109.070] (-1107.335) (-1106.567) * (-1106.148) (-1107.141) (-1106.964) [-1111.517] -- 0:00:27
707500 -- (-1106.937) (-1108.453) (-1108.809) [-1105.716] * (-1108.241) (-1106.001) (-1106.726) [-1108.538] -- 0:00:27
708000 -- (-1107.447) (-1111.329) (-1107.780) [-1105.569] * (-1105.175) (-1108.277) [-1106.009] (-1106.149) -- 0:00:27
708500 -- [-1106.596] (-1106.853) (-1114.221) (-1105.608) * (-1109.328) (-1109.483) (-1106.571) [-1108.610] -- 0:00:27
709000 -- [-1107.156] (-1106.783) (-1109.558) (-1110.392) * (-1109.373) (-1113.048) (-1107.995) [-1106.777] -- 0:00:27
709500 -- (-1107.348) [-1106.929] (-1108.061) (-1108.657) * [-1108.003] (-1109.472) (-1106.828) (-1107.274) -- 0:00:27
710000 -- (-1107.480) (-1106.670) [-1108.054] (-1108.464) * (-1105.856) (-1106.536) [-1105.886] (-1107.553) -- 0:00:26
Average standard deviation of split frequencies: 0.009154
710500 -- (-1108.486) (-1106.367) [-1108.727] (-1107.660) * (-1105.533) (-1107.385) [-1107.434] (-1108.557) -- 0:00:26
711000 -- (-1106.344) (-1107.859) [-1109.418] (-1107.169) * [-1105.678] (-1107.229) (-1106.808) (-1106.701) -- 0:00:26
711500 -- (-1107.739) (-1107.031) (-1111.827) [-1108.175] * (-1105.885) [-1106.779] (-1106.792) (-1105.344) -- 0:00:26
712000 -- (-1110.842) [-1106.734] (-1107.724) (-1109.020) * (-1105.585) [-1108.493] (-1109.575) (-1105.781) -- 0:00:26
712500 -- (-1107.321) (-1108.628) [-1106.277] (-1106.213) * [-1106.339] (-1106.836) (-1107.339) (-1105.763) -- 0:00:26
713000 -- (-1107.858) (-1108.945) (-1105.375) [-1106.539] * (-1107.858) (-1106.013) [-1111.866] (-1105.774) -- 0:00:26
713500 -- (-1109.405) [-1106.382] (-1105.925) (-1110.326) * (-1106.901) (-1106.618) (-1107.230) [-1108.093] -- 0:00:26
714000 -- (-1108.254) (-1111.979) (-1106.670) [-1109.377] * [-1106.714] (-1106.048) (-1108.319) (-1112.612) -- 0:00:26
714500 -- (-1108.075) (-1110.188) (-1105.581) [-1106.627] * (-1106.632) [-1106.793] (-1107.883) (-1107.521) -- 0:00:26
715000 -- [-1109.287] (-1106.740) (-1106.117) (-1108.408) * [-1105.930] (-1106.816) (-1111.236) (-1106.714) -- 0:00:26
Average standard deviation of split frequencies: 0.009174
715500 -- [-1106.658] (-1106.293) (-1108.675) (-1106.727) * (-1105.598) (-1105.985) [-1109.592] (-1107.632) -- 0:00:26
716000 -- (-1115.284) (-1108.750) (-1105.223) [-1108.834] * (-1108.145) (-1106.300) [-1109.564] (-1107.490) -- 0:00:26
716500 -- (-1107.813) (-1108.432) [-1106.810] (-1111.137) * [-1107.512] (-1108.207) (-1106.460) (-1107.926) -- 0:00:26
717000 -- [-1107.373] (-1110.611) (-1106.218) (-1108.282) * (-1105.859) (-1109.843) [-1106.554] (-1106.638) -- 0:00:26
717500 -- (-1107.462) (-1111.575) (-1106.380) [-1107.748] * [-1106.441] (-1109.200) (-1106.914) (-1105.223) -- 0:00:26
718000 -- (-1107.373) (-1111.195) (-1108.276) [-1110.074] * (-1106.380) [-1108.711] (-1107.811) (-1109.750) -- 0:00:26
718500 -- (-1107.996) (-1110.390) [-1107.974] (-1105.501) * (-1107.522) [-1105.645] (-1108.891) (-1112.333) -- 0:00:26
719000 -- (-1106.714) (-1113.479) (-1107.950) [-1108.545] * (-1107.915) (-1108.085) [-1108.971] (-1108.835) -- 0:00:26
719500 -- [-1105.291] (-1107.511) (-1107.258) (-1108.720) * (-1105.674) (-1106.830) (-1108.059) [-1105.730] -- 0:00:26
720000 -- (-1105.552) (-1107.383) (-1106.272) [-1108.242] * (-1108.105) [-1106.344] (-1107.285) (-1106.147) -- 0:00:26
Average standard deviation of split frequencies: 0.009158
720500 -- (-1106.868) (-1105.728) [-1106.495] (-1107.949) * (-1105.684) (-1109.262) (-1107.365) [-1107.252] -- 0:00:25
721000 -- (-1106.416) (-1106.179) (-1107.359) [-1108.312] * (-1105.343) (-1107.784) (-1107.805) [-1109.003] -- 0:00:25
721500 -- [-1109.190] (-1107.150) (-1106.126) (-1106.221) * (-1109.277) (-1108.513) (-1107.606) [-1107.895] -- 0:00:25
722000 -- (-1107.231) [-1107.226] (-1106.225) (-1107.790) * (-1106.270) [-1105.590] (-1108.901) (-1106.589) -- 0:00:25
722500 -- (-1107.474) [-1108.235] (-1106.344) (-1108.109) * [-1108.647] (-1107.892) (-1109.484) (-1109.988) -- 0:00:25
723000 -- (-1105.907) (-1106.351) (-1108.411) [-1108.552] * (-1106.714) (-1107.979) (-1106.796) [-1110.059] -- 0:00:25
723500 -- [-1106.779] (-1113.393) (-1108.524) (-1107.907) * (-1109.688) (-1106.922) (-1111.123) [-1109.024] -- 0:00:25
724000 -- (-1107.320) (-1108.825) [-1107.716] (-1109.756) * [-1106.162] (-1108.409) (-1107.628) (-1109.046) -- 0:00:25
724500 -- (-1107.502) [-1106.505] (-1106.560) (-1109.120) * (-1106.877) (-1107.449) [-1105.903] (-1106.107) -- 0:00:25
725000 -- (-1106.295) [-1105.503] (-1109.880) (-1109.308) * (-1109.378) [-1106.626] (-1105.878) (-1106.389) -- 0:00:25
Average standard deviation of split frequencies: 0.009220
725500 -- (-1107.499) (-1108.035) (-1108.409) [-1105.975] * [-1108.720] (-1114.042) (-1106.147) (-1108.307) -- 0:00:25
726000 -- [-1108.994] (-1114.487) (-1105.985) (-1105.716) * (-1110.472) [-1108.640] (-1109.066) (-1108.179) -- 0:00:25
726500 -- (-1110.964) (-1105.920) (-1106.385) [-1106.129] * (-1105.974) (-1107.498) (-1107.445) [-1107.116] -- 0:00:25
727000 -- (-1107.491) (-1105.965) [-1108.332] (-1108.777) * (-1105.593) (-1111.625) (-1107.576) [-1108.793] -- 0:00:25
727500 -- [-1105.832] (-1114.243) (-1105.952) (-1108.686) * (-1108.471) (-1107.118) (-1107.026) [-1106.222] -- 0:00:25
728000 -- (-1107.919) (-1107.731) [-1105.488] (-1108.704) * [-1106.226] (-1109.130) (-1110.855) (-1106.767) -- 0:00:25
728500 -- (-1106.140) [-1107.505] (-1109.573) (-1106.267) * (-1107.035) (-1108.044) (-1109.003) [-1106.801] -- 0:00:25
729000 -- (-1108.184) (-1106.595) (-1107.871) [-1106.156] * [-1107.038] (-1107.211) (-1106.587) (-1108.411) -- 0:00:25
729500 -- [-1106.458] (-1107.452) (-1107.512) (-1106.659) * (-1106.137) (-1108.855) (-1111.416) [-1108.296] -- 0:00:25
730000 -- (-1107.568) (-1107.490) (-1107.328) [-1105.930] * (-1106.272) (-1108.641) [-1109.038] (-1109.078) -- 0:00:25
Average standard deviation of split frequencies: 0.008860
730500 -- (-1105.585) (-1106.961) (-1107.555) [-1105.602] * [-1108.195] (-1110.124) (-1107.804) (-1110.199) -- 0:00:25
731000 -- (-1105.941) (-1110.001) (-1106.917) [-1108.971] * [-1106.135] (-1109.328) (-1108.371) (-1107.128) -- 0:00:25
731500 -- (-1105.784) (-1106.300) (-1105.747) [-1108.234] * [-1105.691] (-1112.514) (-1106.456) (-1107.355) -- 0:00:24
732000 -- (-1106.723) [-1107.554] (-1106.267) (-1108.324) * [-1107.003] (-1112.729) (-1109.261) (-1108.626) -- 0:00:24
732500 -- (-1108.233) [-1106.629] (-1108.772) (-1107.413) * [-1106.381] (-1107.121) (-1106.695) (-1107.754) -- 0:00:24
733000 -- (-1107.531) [-1108.484] (-1110.309) (-1107.196) * (-1105.139) (-1110.007) [-1109.689] (-1109.649) -- 0:00:24
733500 -- (-1108.499) (-1106.210) (-1110.856) [-1106.705] * (-1105.450) [-1108.099] (-1110.872) (-1108.681) -- 0:00:24
734000 -- [-1106.856] (-1106.915) (-1107.356) (-1106.112) * (-1105.563) [-1106.608] (-1109.324) (-1105.529) -- 0:00:24
734500 -- (-1106.497) (-1112.498) (-1107.717) [-1105.028] * (-1107.345) (-1105.620) [-1106.168] (-1107.049) -- 0:00:24
735000 -- (-1111.334) (-1109.369) (-1107.411) [-1106.402] * (-1112.822) [-1107.042] (-1106.364) (-1112.014) -- 0:00:24
Average standard deviation of split frequencies: 0.009180
735500 -- (-1112.475) [-1106.396] (-1106.649) (-1107.615) * (-1107.318) (-1107.963) [-1105.544] (-1108.309) -- 0:00:24
736000 -- (-1108.218) (-1108.755) (-1110.992) [-1106.096] * [-1106.136] (-1105.932) (-1105.587) (-1108.635) -- 0:00:24
736500 -- (-1105.212) (-1106.847) (-1109.912) [-1107.966] * [-1107.061] (-1105.624) (-1105.427) (-1106.517) -- 0:00:24
737000 -- (-1109.290) (-1108.567) (-1105.192) [-1107.146] * (-1109.533) [-1108.484] (-1105.469) (-1106.544) -- 0:00:24
737500 -- (-1107.140) (-1108.099) [-1105.296] (-1106.057) * [-1108.597] (-1105.978) (-1111.172) (-1107.110) -- 0:00:24
738000 -- (-1107.831) [-1107.228] (-1111.104) (-1110.342) * (-1106.490) [-1106.086] (-1110.245) (-1112.222) -- 0:00:24
738500 -- (-1111.504) (-1109.855) (-1106.173) [-1111.888] * (-1106.431) [-1107.376] (-1106.658) (-1107.920) -- 0:00:24
739000 -- (-1105.721) (-1111.020) [-1106.648] (-1111.715) * [-1105.487] (-1107.036) (-1109.493) (-1109.436) -- 0:00:24
739500 -- (-1106.098) [-1106.626] (-1106.107) (-1108.352) * (-1106.210) (-1107.100) (-1108.211) [-1106.579] -- 0:00:24
740000 -- [-1106.992] (-1108.353) (-1106.886) (-1109.058) * (-1107.120) (-1106.453) [-1105.683] (-1107.971) -- 0:00:24
Average standard deviation of split frequencies: 0.008868
740500 -- (-1106.135) (-1110.154) [-1106.027] (-1107.386) * (-1106.446) (-1107.075) [-1105.916] (-1105.648) -- 0:00:24
741000 -- [-1106.165] (-1107.417) (-1106.102) (-1108.396) * (-1107.838) [-1107.826] (-1106.913) (-1105.699) -- 0:00:24
741500 -- (-1106.746) (-1107.919) [-1107.810] (-1111.275) * (-1110.825) (-1106.735) [-1105.371] (-1106.157) -- 0:00:24
742000 -- (-1106.956) [-1110.366] (-1107.116) (-1106.986) * (-1112.954) (-1107.718) [-1107.744] (-1109.015) -- 0:00:23
742500 -- (-1106.505) (-1107.216) (-1107.408) [-1106.575] * (-1110.626) (-1106.274) (-1105.581) [-1106.202] -- 0:00:23
743000 -- (-1108.088) (-1107.031) [-1109.448] (-1107.783) * (-1115.409) [-1106.050] (-1106.177) (-1110.488) -- 0:00:23
743500 -- (-1105.992) [-1107.357] (-1106.104) (-1107.705) * (-1110.068) (-1105.946) [-1105.617] (-1106.440) -- 0:00:23
744000 -- (-1105.740) [-1106.870] (-1106.742) (-1106.514) * [-1109.810] (-1110.052) (-1106.081) (-1106.009) -- 0:00:23
744500 -- (-1106.382) [-1107.763] (-1107.710) (-1108.134) * [-1113.751] (-1105.940) (-1106.043) (-1106.784) -- 0:00:23
745000 -- [-1105.890] (-1113.005) (-1107.233) (-1105.973) * [-1107.203] (-1106.397) (-1107.257) (-1105.299) -- 0:00:23
Average standard deviation of split frequencies: 0.008973
745500 -- (-1105.680) (-1112.018) [-1106.835] (-1109.022) * (-1111.374) (-1107.601) [-1105.847] (-1109.916) -- 0:00:23
746000 -- (-1108.542) (-1108.908) (-1106.722) [-1107.242] * (-1106.314) (-1110.865) [-1106.865] (-1106.326) -- 0:00:23
746500 -- (-1108.205) [-1109.235] (-1107.597) (-1106.232) * (-1107.302) (-1108.368) (-1109.027) [-1109.705] -- 0:00:23
747000 -- (-1109.697) (-1106.561) (-1111.214) [-1106.225] * (-1105.418) (-1109.277) [-1105.915] (-1109.606) -- 0:00:23
747500 -- (-1109.974) (-1105.790) (-1111.565) [-1107.035] * (-1106.819) [-1108.462] (-1110.288) (-1113.046) -- 0:00:23
748000 -- (-1111.574) (-1109.520) (-1108.128) [-1106.589] * (-1108.786) (-1105.912) [-1107.513] (-1106.843) -- 0:00:23
748500 -- (-1107.281) (-1112.048) (-1106.957) [-1105.876] * (-1107.370) [-1110.263] (-1105.332) (-1111.617) -- 0:00:23
749000 -- (-1105.965) (-1108.297) [-1107.402] (-1106.126) * [-1106.083] (-1110.906) (-1107.998) (-1111.276) -- 0:00:23
749500 -- [-1108.137] (-1106.309) (-1107.365) (-1106.345) * (-1108.239) (-1108.725) [-1108.081] (-1108.997) -- 0:00:23
750000 -- [-1106.966] (-1106.166) (-1109.895) (-1108.208) * (-1107.498) [-1105.576] (-1111.070) (-1107.437) -- 0:00:23
Average standard deviation of split frequencies: 0.008750
750500 -- (-1108.379) [-1106.193] (-1106.857) (-1108.955) * (-1107.477) (-1107.900) (-1110.392) [-1106.426] -- 0:00:23
751000 -- (-1110.877) (-1107.149) (-1106.110) [-1105.535] * (-1107.995) (-1107.287) [-1106.538] (-1111.238) -- 0:00:23
751500 -- (-1109.345) (-1108.482) (-1107.806) [-1106.549] * (-1106.814) [-1106.480] (-1107.624) (-1105.172) -- 0:00:23
752000 -- [-1106.521] (-1108.505) (-1110.378) (-1106.423) * (-1107.044) (-1109.099) (-1106.630) [-1105.433] -- 0:00:23
752500 -- (-1106.969) [-1105.563] (-1108.870) (-1107.467) * (-1109.221) (-1108.132) (-1105.571) [-1105.681] -- 0:00:23
753000 -- (-1108.970) (-1107.282) (-1113.478) [-1105.261] * (-1110.395) [-1107.378] (-1109.422) (-1115.737) -- 0:00:22
753500 -- (-1105.984) (-1106.218) (-1106.944) [-1105.806] * (-1110.285) (-1106.246) [-1108.734] (-1106.733) -- 0:00:22
754000 -- (-1105.934) [-1106.262] (-1109.723) (-1107.266) * (-1107.550) [-1105.468] (-1106.797) (-1111.407) -- 0:00:22
754500 -- (-1106.635) (-1107.867) [-1107.355] (-1109.298) * (-1108.988) [-1107.105] (-1110.929) (-1114.934) -- 0:00:22
755000 -- (-1106.957) (-1109.165) (-1110.923) [-1107.233] * (-1107.168) (-1109.444) [-1106.788] (-1111.530) -- 0:00:22
Average standard deviation of split frequencies: 0.008439
755500 -- [-1108.282] (-1108.968) (-1109.528) (-1106.143) * (-1107.829) (-1108.428) [-1108.339] (-1110.646) -- 0:00:22
756000 -- (-1106.665) (-1110.925) [-1107.508] (-1108.025) * (-1106.788) (-1109.222) [-1106.220] (-1109.315) -- 0:00:22
756500 -- [-1106.851] (-1111.716) (-1109.512) (-1107.218) * (-1107.423) [-1106.846] (-1106.368) (-1105.985) -- 0:00:22
757000 -- (-1109.877) (-1108.022) (-1109.712) [-1106.784] * (-1107.330) (-1105.889) (-1107.396) [-1106.925] -- 0:00:22
757500 -- (-1105.275) [-1105.800] (-1105.927) (-1109.716) * (-1107.471) [-1109.554] (-1106.679) (-1107.191) -- 0:00:22
758000 -- [-1106.429] (-1109.951) (-1107.547) (-1106.319) * (-1106.068) (-1107.601) [-1107.089] (-1106.689) -- 0:00:22
758500 -- (-1106.262) (-1109.451) [-1107.513] (-1107.021) * (-1107.591) (-1106.769) (-1106.870) [-1106.136] -- 0:00:22
759000 -- (-1106.781) (-1107.912) (-1107.582) [-1108.428] * (-1106.957) [-1112.698] (-1112.406) (-1106.908) -- 0:00:22
759500 -- (-1105.648) (-1108.114) [-1107.282] (-1107.917) * (-1109.058) [-1106.344] (-1105.959) (-1107.915) -- 0:00:22
760000 -- [-1105.932] (-1110.875) (-1109.614) (-1110.603) * (-1106.007) (-1107.482) (-1106.481) [-1107.206] -- 0:00:22
Average standard deviation of split frequencies: 0.008717
760500 -- (-1105.897) (-1106.901) [-1106.289] (-1107.722) * (-1109.405) (-1107.050) [-1107.216] (-1111.070) -- 0:00:22
761000 -- [-1105.900] (-1108.147) (-1106.888) (-1108.094) * (-1106.531) (-1110.370) (-1108.425) [-1113.331] -- 0:00:22
761500 -- [-1106.726] (-1111.298) (-1105.896) (-1108.341) * (-1105.411) (-1108.023) (-1108.641) [-1106.382] -- 0:00:22
762000 -- (-1107.730) (-1112.341) [-1109.086] (-1106.075) * (-1105.444) (-1106.464) (-1111.234) [-1105.400] -- 0:00:22
762500 -- (-1106.871) (-1107.384) [-1106.163] (-1105.813) * (-1105.179) (-1107.788) (-1109.380) [-1106.397] -- 0:00:22
763000 -- (-1109.325) [-1106.823] (-1106.306) (-1107.696) * [-1106.071] (-1108.790) (-1107.431) (-1108.175) -- 0:00:22
763500 -- (-1106.528) [-1106.844] (-1108.654) (-1106.341) * (-1107.302) (-1106.842) (-1107.483) [-1105.793] -- 0:00:21
764000 -- [-1106.499] (-1108.059) (-1108.104) (-1106.173) * (-1107.564) (-1107.199) [-1107.089] (-1105.740) -- 0:00:21
764500 -- [-1110.294] (-1106.915) (-1106.579) (-1108.667) * (-1109.526) [-1110.281] (-1105.990) (-1107.662) -- 0:00:21
765000 -- (-1112.557) [-1107.340] (-1106.217) (-1107.739) * (-1107.783) (-1108.666) [-1105.878] (-1109.110) -- 0:00:21
Average standard deviation of split frequencies: 0.008452
765500 -- (-1106.652) (-1108.426) [-1105.078] (-1105.781) * (-1106.822) (-1110.902) (-1108.960) [-1108.683] -- 0:00:21
766000 -- [-1107.025] (-1107.461) (-1105.973) (-1105.781) * [-1105.383] (-1109.822) (-1106.323) (-1108.051) -- 0:00:21
766500 -- (-1110.235) (-1108.418) [-1111.033] (-1105.767) * (-1107.255) (-1106.375) (-1111.799) [-1108.746] -- 0:00:21
767000 -- (-1106.615) [-1105.760] (-1107.302) (-1108.403) * [-1108.878] (-1108.699) (-1110.018) (-1107.428) -- 0:00:21
767500 -- [-1105.457] (-1106.115) (-1108.202) (-1107.799) * [-1106.820] (-1107.268) (-1108.984) (-1105.709) -- 0:00:21
768000 -- [-1106.916] (-1106.164) (-1109.747) (-1107.784) * [-1106.739] (-1110.656) (-1111.372) (-1105.811) -- 0:00:21
768500 -- [-1108.300] (-1107.819) (-1110.510) (-1107.876) * [-1110.939] (-1112.619) (-1106.860) (-1106.255) -- 0:00:21
769000 -- (-1106.468) (-1108.671) [-1107.918] (-1107.265) * [-1106.346] (-1109.146) (-1107.306) (-1107.281) -- 0:00:21
769500 -- (-1107.685) [-1109.202] (-1108.261) (-1107.535) * (-1105.578) [-1107.020] (-1108.345) (-1107.337) -- 0:00:21
770000 -- (-1107.097) (-1106.702) (-1108.103) [-1107.814] * (-1107.598) (-1107.943) [-1106.225] (-1107.046) -- 0:00:21
Average standard deviation of split frequencies: 0.008523
770500 -- [-1107.298] (-1106.338) (-1107.190) (-1106.091) * (-1108.407) [-1108.345] (-1108.180) (-1106.434) -- 0:00:21
771000 -- (-1110.527) (-1107.182) [-1108.444] (-1107.378) * (-1106.760) (-1106.888) (-1108.703) [-1108.238] -- 0:00:21
771500 -- [-1110.907] (-1110.222) (-1106.548) (-1106.992) * [-1108.412] (-1107.226) (-1106.662) (-1105.324) -- 0:00:21
772000 -- [-1108.211] (-1108.252) (-1106.155) (-1110.616) * (-1106.399) (-1111.579) [-1112.799] (-1105.716) -- 0:00:21
772500 -- (-1108.129) (-1111.674) [-1107.240] (-1110.240) * (-1108.148) [-1108.739] (-1108.131) (-1105.692) -- 0:00:21
773000 -- (-1105.585) (-1109.104) (-1106.033) [-1108.447] * (-1109.105) (-1106.682) [-1105.975] (-1106.916) -- 0:00:21
773500 -- (-1107.424) [-1108.713] (-1106.457) (-1108.408) * [-1107.882] (-1105.816) (-1107.668) (-1107.124) -- 0:00:21
774000 -- (-1108.362) (-1109.602) [-1107.888] (-1106.768) * (-1106.426) (-1108.013) [-1106.740] (-1106.452) -- 0:00:21
774500 -- [-1108.232] (-1106.208) (-1111.042) (-1108.781) * (-1107.131) [-1107.353] (-1108.225) (-1107.755) -- 0:00:20
775000 -- (-1107.751) [-1107.199] (-1109.388) (-1109.441) * (-1108.289) (-1110.165) [-1106.332] (-1109.964) -- 0:00:20
Average standard deviation of split frequencies: 0.008707
775500 -- (-1107.104) [-1105.879] (-1107.333) (-1112.483) * (-1109.501) [-1106.844] (-1107.473) (-1111.583) -- 0:00:20
776000 -- (-1109.902) (-1107.635) [-1106.815] (-1109.303) * (-1111.289) (-1111.503) [-1106.174] (-1106.321) -- 0:00:20
776500 -- (-1107.684) (-1108.982) (-1106.074) [-1108.694] * (-1112.893) (-1107.746) [-1105.870] (-1107.481) -- 0:00:20
777000 -- (-1108.792) (-1108.102) (-1108.174) [-1110.872] * (-1110.960) (-1106.804) (-1107.052) [-1108.312] -- 0:00:20
777500 -- [-1106.727] (-1107.998) (-1108.875) (-1109.886) * (-1105.754) (-1106.635) (-1108.621) [-1106.896] -- 0:00:20
778000 -- [-1110.654] (-1109.467) (-1106.290) (-1107.838) * [-1108.296] (-1106.849) (-1108.694) (-1108.575) -- 0:00:20
778500 -- (-1110.366) (-1107.459) [-1106.028] (-1106.251) * [-1106.601] (-1107.863) (-1108.135) (-1111.721) -- 0:00:20
779000 -- (-1109.222) (-1112.268) (-1107.014) [-1106.823] * [-1108.802] (-1106.627) (-1105.739) (-1106.256) -- 0:00:20
779500 -- (-1110.448) (-1109.207) (-1105.497) [-1106.666] * (-1108.344) [-1106.276] (-1107.294) (-1107.546) -- 0:00:20
780000 -- [-1107.779] (-1106.728) (-1108.227) (-1107.919) * [-1109.091] (-1107.517) (-1109.009) (-1107.173) -- 0:00:20
Average standard deviation of split frequencies: 0.008736
780500 -- [-1110.571] (-1107.904) (-1109.461) (-1107.637) * (-1106.720) (-1106.596) (-1108.746) [-1106.179] -- 0:00:20
781000 -- (-1108.428) (-1109.860) (-1110.258) [-1107.317] * (-1108.135) (-1106.620) (-1107.316) [-1108.242] -- 0:00:20
781500 -- (-1107.662) (-1108.381) (-1109.577) [-1105.870] * (-1106.855) (-1106.875) (-1108.182) [-1106.867] -- 0:00:20
782000 -- (-1106.425) (-1111.389) (-1107.247) [-1107.268] * (-1105.858) (-1107.581) (-1111.823) [-1107.126] -- 0:00:20
782500 -- [-1109.915] (-1107.602) (-1105.459) (-1109.108) * [-1106.996] (-1109.626) (-1113.871) (-1106.031) -- 0:00:20
783000 -- (-1109.702) [-1107.419] (-1109.891) (-1107.933) * [-1107.037] (-1112.016) (-1108.275) (-1106.346) -- 0:00:20
783500 -- (-1109.876) (-1105.721) (-1109.709) [-1108.182] * (-1106.065) [-1106.864] (-1107.250) (-1106.063) -- 0:00:20
784000 -- (-1106.588) (-1105.443) (-1106.768) [-1109.306] * (-1106.244) (-1107.066) (-1111.110) [-1107.951] -- 0:00:20
784500 -- (-1107.110) [-1106.551] (-1107.531) (-1107.141) * (-1111.068) [-1106.951] (-1112.666) (-1106.956) -- 0:00:20
785000 -- (-1108.679) (-1107.379) [-1107.774] (-1107.316) * (-1111.461) (-1107.143) (-1108.245) [-1113.267] -- 0:00:19
Average standard deviation of split frequencies: 0.009076
785500 -- (-1107.288) (-1106.554) (-1110.865) [-1108.801] * (-1108.922) (-1105.882) [-1107.340] (-1112.708) -- 0:00:19
786000 -- [-1107.409] (-1108.165) (-1110.808) (-1110.360) * (-1110.305) (-1106.732) [-1105.724] (-1113.582) -- 0:00:19
786500 -- [-1106.309] (-1107.536) (-1112.035) (-1107.215) * (-1107.520) (-1107.088) [-1108.398] (-1115.781) -- 0:00:19
787000 -- [-1105.854] (-1108.579) (-1107.676) (-1108.715) * (-1107.605) [-1108.920] (-1111.425) (-1108.752) -- 0:00:19
787500 -- (-1112.350) (-1108.395) [-1107.579] (-1108.107) * (-1105.813) (-1109.749) [-1107.814] (-1110.877) -- 0:00:19
788000 -- [-1108.568] (-1105.704) (-1107.499) (-1107.142) * (-1106.320) (-1111.904) (-1109.019) [-1105.919] -- 0:00:19
788500 -- (-1106.790) (-1107.388) (-1110.245) [-1106.817] * (-1106.343) (-1110.864) (-1116.653) [-1106.622] -- 0:00:19
789000 -- (-1106.389) (-1110.435) [-1111.536] (-1109.236) * [-1107.217] (-1107.958) (-1112.077) (-1108.811) -- 0:00:19
789500 -- (-1105.910) [-1109.322] (-1109.431) (-1108.867) * (-1107.396) (-1107.181) [-1107.573] (-1107.353) -- 0:00:19
790000 -- (-1106.698) [-1108.030] (-1106.484) (-1109.934) * (-1107.243) (-1105.926) (-1106.927) [-1107.378] -- 0:00:19
Average standard deviation of split frequencies: 0.009420
790500 -- (-1108.231) [-1106.287] (-1106.707) (-1106.356) * [-1106.210] (-1108.671) (-1106.708) (-1109.709) -- 0:00:19
791000 -- (-1110.954) (-1108.172) (-1105.460) [-1107.257] * [-1108.758] (-1113.253) (-1105.669) (-1106.696) -- 0:00:19
791500 -- (-1107.568) (-1107.994) [-1106.988] (-1108.083) * (-1105.747) [-1106.638] (-1109.489) (-1106.258) -- 0:00:19
792000 -- (-1106.259) (-1107.987) [-1112.006] (-1111.798) * (-1106.736) [-1107.543] (-1107.584) (-1107.636) -- 0:00:19
792500 -- (-1106.146) (-1106.630) (-1108.013) [-1107.203] * (-1107.203) (-1107.391) (-1106.883) [-1105.398] -- 0:00:19
793000 -- (-1107.024) [-1106.746] (-1107.066) (-1107.874) * (-1105.379) (-1107.113) [-1108.948] (-1105.371) -- 0:00:19
793500 -- (-1111.435) (-1107.696) (-1109.293) [-1106.276] * (-1105.828) (-1108.598) (-1109.094) [-1106.156] -- 0:00:19
794000 -- (-1107.924) (-1106.113) [-1106.626] (-1105.459) * (-1107.092) (-1108.655) (-1106.821) [-1106.324] -- 0:00:19
794500 -- (-1107.697) (-1107.257) [-1105.345] (-1107.281) * (-1112.702) (-1108.992) [-1106.612] (-1106.172) -- 0:00:19
795000 -- [-1110.490] (-1107.268) (-1106.330) (-1105.641) * (-1106.367) (-1107.527) [-1105.410] (-1106.793) -- 0:00:19
Average standard deviation of split frequencies: 0.009041
795500 -- [-1109.696] (-1106.492) (-1110.418) (-1107.201) * (-1105.904) (-1106.728) (-1106.785) [-1111.347] -- 0:00:19
796000 -- (-1108.184) (-1106.444) [-1108.639] (-1108.310) * (-1105.955) (-1107.463) (-1109.623) [-1105.619] -- 0:00:18
796500 -- [-1105.798] (-1107.562) (-1107.391) (-1107.423) * (-1110.386) [-1105.714] (-1107.283) (-1111.058) -- 0:00:18
797000 -- [-1109.989] (-1106.216) (-1109.687) (-1110.480) * (-1107.075) (-1105.608) [-1109.310] (-1111.420) -- 0:00:18
797500 -- (-1109.366) [-1106.881] (-1106.734) (-1108.066) * [-1106.872] (-1106.023) (-1107.087) (-1108.811) -- 0:00:18
798000 -- (-1108.843) [-1107.304] (-1106.843) (-1107.108) * (-1108.058) [-1107.714] (-1106.739) (-1106.333) -- 0:00:18
798500 -- (-1111.368) [-1107.509] (-1106.475) (-1105.505) * (-1107.491) (-1110.132) [-1108.677] (-1106.666) -- 0:00:18
799000 -- (-1107.904) (-1107.519) [-1106.586] (-1106.121) * (-1108.077) (-1107.295) [-1107.115] (-1105.629) -- 0:00:18
799500 -- (-1109.382) (-1107.164) (-1107.508) [-1110.160] * (-1106.496) (-1106.491) (-1108.147) [-1107.145] -- 0:00:18
800000 -- [-1107.281] (-1106.897) (-1107.779) (-1106.567) * (-1107.337) [-1106.194] (-1107.374) (-1106.868) -- 0:00:18
Average standard deviation of split frequencies: 0.009616
800500 -- (-1108.037) (-1109.173) (-1107.131) [-1105.866] * (-1108.101) (-1107.725) [-1106.431] (-1108.497) -- 0:00:18
801000 -- [-1107.851] (-1108.547) (-1106.850) (-1105.609) * (-1108.487) (-1112.245) (-1111.358) [-1107.031] -- 0:00:18
801500 -- (-1108.328) (-1108.198) (-1105.664) [-1107.863] * (-1107.890) (-1105.113) [-1110.938] (-1107.967) -- 0:00:18
802000 -- (-1106.814) [-1106.452] (-1108.508) (-1109.660) * (-1109.970) (-1106.704) (-1108.460) [-1106.797] -- 0:00:18
802500 -- (-1109.122) [-1108.525] (-1107.563) (-1111.340) * (-1109.764) (-1105.663) (-1106.535) [-1109.649] -- 0:00:18
803000 -- (-1108.123) [-1108.553] (-1106.837) (-1111.165) * (-1108.910) [-1110.043] (-1107.700) (-1108.315) -- 0:00:18
803500 -- (-1107.968) (-1107.092) [-1105.811] (-1111.952) * (-1107.868) (-1110.128) [-1105.951] (-1105.970) -- 0:00:18
804000 -- (-1106.763) (-1109.278) (-1106.454) [-1109.027] * (-1107.569) (-1108.361) [-1106.905] (-1108.097) -- 0:00:18
804500 -- [-1109.161] (-1106.453) (-1105.628) (-1105.547) * (-1110.009) (-1107.684) [-1105.946] (-1109.224) -- 0:00:18
805000 -- [-1105.563] (-1107.371) (-1106.545) (-1109.345) * (-1109.845) (-1105.952) (-1106.292) [-1108.582] -- 0:00:18
Average standard deviation of split frequencies: 0.008968
805500 -- (-1108.902) (-1105.920) (-1105.412) [-1105.795] * (-1107.434) [-1106.996] (-1107.230) (-1105.830) -- 0:00:18
806000 -- (-1108.486) [-1106.448] (-1107.000) (-1106.168) * [-1105.889] (-1105.731) (-1106.181) (-1107.461) -- 0:00:18
806500 -- (-1106.984) (-1109.318) (-1108.221) [-1105.901] * (-1106.073) (-1106.270) (-1108.319) [-1105.900] -- 0:00:17
807000 -- (-1105.060) [-1106.224] (-1111.950) (-1108.949) * (-1106.410) (-1106.631) [-1109.419] (-1109.952) -- 0:00:17
807500 -- (-1106.047) [-1105.619] (-1106.840) (-1109.441) * (-1105.768) (-1107.124) (-1108.919) [-1105.225] -- 0:00:17
808000 -- (-1107.675) (-1108.338) (-1107.375) [-1108.827] * [-1108.477] (-1105.516) (-1109.799) (-1107.241) -- 0:00:17
808500 -- [-1106.885] (-1107.955) (-1108.800) (-1107.711) * [-1106.500] (-1108.301) (-1108.979) (-1107.699) -- 0:00:17
809000 -- (-1107.722) (-1105.687) [-1107.218] (-1111.021) * (-1108.042) (-1109.902) (-1107.127) [-1106.676] -- 0:00:17
809500 -- (-1108.657) [-1106.672] (-1106.295) (-1109.377) * (-1107.210) (-1109.643) (-1112.060) [-1107.068] -- 0:00:17
810000 -- [-1107.444] (-1105.735) (-1106.655) (-1111.622) * (-1106.744) (-1111.327) (-1109.121) [-1111.128] -- 0:00:17
Average standard deviation of split frequencies: 0.009149
810500 -- (-1107.991) (-1112.360) (-1106.214) [-1106.513] * (-1105.730) (-1107.854) (-1106.916) [-1109.599] -- 0:00:17
811000 -- [-1109.370] (-1113.723) (-1108.691) (-1111.071) * [-1107.845] (-1109.758) (-1112.494) (-1106.590) -- 0:00:17
811500 -- (-1107.499) (-1108.805) [-1105.615] (-1108.871) * (-1107.648) [-1105.681] (-1112.283) (-1108.416) -- 0:00:17
812000 -- (-1109.794) (-1105.436) (-1105.569) [-1107.146] * (-1108.007) [-1106.850] (-1110.718) (-1106.916) -- 0:00:17
812500 -- (-1106.939) [-1106.148] (-1105.979) (-1107.244) * (-1107.748) (-1107.008) [-1110.868] (-1106.240) -- 0:00:17
813000 -- [-1106.593] (-1106.322) (-1106.580) (-1111.887) * (-1107.734) (-1109.067) (-1108.900) [-1108.377] -- 0:00:17
813500 -- [-1105.367] (-1106.342) (-1105.987) (-1109.509) * [-1108.524] (-1106.532) (-1105.771) (-1106.767) -- 0:00:17
814000 -- (-1110.825) (-1105.785) [-1109.781] (-1108.210) * (-1107.336) [-1108.293] (-1107.598) (-1108.140) -- 0:00:17
814500 -- [-1107.261] (-1107.442) (-1109.420) (-1107.626) * (-1108.036) (-1106.614) (-1107.991) [-1106.764] -- 0:00:17
815000 -- (-1110.725) (-1106.860) [-1105.977] (-1109.852) * [-1108.941] (-1112.185) (-1109.074) (-1105.459) -- 0:00:17
Average standard deviation of split frequencies: 0.008897
815500 -- [-1106.831] (-1110.795) (-1105.928) (-1108.590) * (-1108.492) [-1107.573] (-1108.805) (-1105.453) -- 0:00:17
816000 -- [-1109.134] (-1106.633) (-1105.877) (-1106.377) * (-1108.094) (-1105.981) [-1106.094] (-1106.379) -- 0:00:17
816500 -- (-1112.345) (-1105.685) (-1105.426) [-1107.145] * (-1107.650) [-1106.547] (-1105.372) (-1107.129) -- 0:00:17
817000 -- (-1106.521) [-1108.845] (-1106.309) (-1106.843) * [-1107.394] (-1109.296) (-1105.248) (-1107.726) -- 0:00:17
817500 -- (-1108.002) (-1108.276) [-1109.710] (-1105.419) * [-1106.672] (-1109.188) (-1105.955) (-1106.248) -- 0:00:16
818000 -- (-1108.165) [-1109.433] (-1105.442) (-1110.842) * [-1107.503] (-1106.865) (-1106.566) (-1106.750) -- 0:00:16
818500 -- (-1107.397) (-1110.081) [-1106.195] (-1107.649) * (-1106.621) (-1107.428) [-1108.406] (-1106.358) -- 0:00:16
819000 -- (-1107.426) (-1112.229) (-1106.751) [-1109.392] * (-1106.279) (-1107.736) [-1107.567] (-1107.195) -- 0:00:16
819500 -- (-1106.554) (-1111.076) (-1107.483) [-1107.877] * [-1107.529] (-1106.847) (-1105.293) (-1108.254) -- 0:00:16
820000 -- (-1106.188) [-1108.541] (-1109.055) (-1109.354) * (-1107.475) (-1108.499) [-1106.110] (-1108.220) -- 0:00:16
Average standard deviation of split frequencies: 0.008846
820500 -- (-1108.428) (-1105.932) [-1107.615] (-1108.942) * (-1107.610) (-1107.997) [-1105.249] (-1107.263) -- 0:00:16
821000 -- [-1107.018] (-1105.988) (-1111.672) (-1106.909) * (-1106.138) (-1107.578) [-1106.167] (-1108.904) -- 0:00:16
821500 -- (-1106.991) (-1107.367) [-1107.970] (-1106.319) * (-1108.220) (-1108.864) [-1105.550] (-1111.604) -- 0:00:16
822000 -- (-1106.290) (-1106.011) [-1109.848] (-1109.233) * (-1107.341) [-1109.171] (-1107.357) (-1109.597) -- 0:00:16
822500 -- (-1107.146) (-1106.012) (-1106.432) [-1105.532] * [-1105.695] (-1106.686) (-1107.556) (-1106.412) -- 0:00:16
823000 -- (-1107.575) (-1106.243) [-1107.956] (-1106.905) * (-1106.238) [-1109.913] (-1108.017) (-1110.875) -- 0:00:16
823500 -- (-1106.983) [-1106.422] (-1108.153) (-1105.887) * (-1108.732) (-1107.978) (-1108.138) [-1108.190] -- 0:00:16
824000 -- (-1106.369) (-1105.598) [-1108.132] (-1106.076) * (-1108.566) (-1107.856) (-1106.896) [-1107.409] -- 0:00:16
824500 -- (-1105.887) (-1107.474) (-1113.070) [-1108.015] * (-1106.480) [-1107.750] (-1112.004) (-1105.855) -- 0:00:16
825000 -- (-1105.241) (-1107.077) [-1108.208] (-1106.977) * (-1106.903) (-1108.700) (-1107.076) [-1105.819] -- 0:00:16
Average standard deviation of split frequencies: 0.008637
825500 -- [-1105.249] (-1107.340) (-1108.153) (-1105.557) * [-1107.126] (-1108.387) (-1109.418) (-1106.791) -- 0:00:16
826000 -- (-1106.717) [-1111.326] (-1106.746) (-1107.095) * [-1106.730] (-1111.580) (-1114.640) (-1106.056) -- 0:00:16
826500 -- (-1106.959) [-1108.731] (-1110.463) (-1106.317) * [-1108.981] (-1110.444) (-1110.532) (-1105.048) -- 0:00:16
827000 -- (-1110.888) (-1109.067) [-1106.697] (-1107.189) * (-1105.597) (-1106.947) [-1108.614] (-1105.579) -- 0:00:16
827500 -- [-1107.861] (-1108.513) (-1109.260) (-1108.108) * [-1108.429] (-1106.987) (-1109.390) (-1107.549) -- 0:00:16
828000 -- (-1107.338) (-1108.395) [-1105.792] (-1106.718) * [-1107.294] (-1110.735) (-1106.972) (-1106.174) -- 0:00:15
828500 -- (-1105.594) (-1107.474) [-1107.998] (-1108.456) * (-1105.899) [-1106.960] (-1108.785) (-1106.567) -- 0:00:15
829000 -- (-1106.332) [-1109.124] (-1108.406) (-1107.086) * (-1107.890) [-1106.711] (-1109.167) (-1106.557) -- 0:00:15
829500 -- (-1109.242) (-1106.811) (-1106.338) [-1107.883] * (-1110.677) [-1109.031] (-1109.108) (-1108.133) -- 0:00:15
830000 -- (-1106.265) (-1107.296) (-1106.331) [-1106.799] * (-1111.109) (-1106.071) [-1110.615] (-1106.013) -- 0:00:15
Average standard deviation of split frequencies: 0.008702
830500 -- (-1108.305) (-1107.272) [-1113.078] (-1106.960) * (-1107.416) [-1110.326] (-1109.243) (-1106.465) -- 0:00:15
831000 -- [-1107.356] (-1107.773) (-1105.799) (-1106.252) * [-1111.628] (-1108.272) (-1110.641) (-1105.848) -- 0:00:15
831500 -- (-1105.741) (-1110.427) [-1107.158] (-1109.336) * (-1112.736) (-1107.279) (-1107.727) [-1106.869] -- 0:00:15
832000 -- (-1109.340) [-1109.131] (-1106.515) (-1110.670) * (-1108.237) (-1107.299) (-1106.449) [-1106.561] -- 0:00:15
832500 -- (-1106.990) (-1110.537) [-1107.965] (-1105.373) * (-1106.602) [-1105.724] (-1106.669) (-1107.514) -- 0:00:15
833000 -- (-1109.702) (-1108.634) [-1107.623] (-1105.294) * [-1106.360] (-1106.669) (-1106.660) (-1106.469) -- 0:00:15
833500 -- (-1114.580) [-1107.942] (-1108.319) (-1110.215) * (-1105.459) (-1108.736) (-1106.741) [-1107.344] -- 0:00:15
834000 -- (-1109.612) [-1108.060] (-1109.817) (-1109.549) * (-1107.394) (-1109.566) (-1109.767) [-1112.704] -- 0:00:15
834500 -- (-1108.408) (-1111.038) [-1105.623] (-1106.437) * [-1106.503] (-1107.225) (-1107.074) (-1109.479) -- 0:00:15
835000 -- (-1105.772) (-1107.110) (-1108.316) [-1106.403] * [-1106.221] (-1105.739) (-1108.294) (-1109.706) -- 0:00:15
Average standard deviation of split frequencies: 0.008684
835500 -- (-1106.342) (-1105.325) (-1110.699) [-1106.125] * (-1111.657) [-1105.766] (-1110.754) (-1110.449) -- 0:00:15
836000 -- (-1107.515) (-1105.492) (-1109.538) [-1108.442] * [-1107.333] (-1106.927) (-1107.306) (-1108.257) -- 0:00:15
836500 -- (-1108.383) (-1108.525) [-1108.237] (-1109.354) * (-1110.632) (-1108.142) (-1107.626) [-1107.654] -- 0:00:15
837000 -- (-1109.929) (-1109.352) [-1107.948] (-1107.243) * (-1111.743) [-1105.233] (-1107.206) (-1105.971) -- 0:00:14
837500 -- [-1109.856] (-1109.981) (-1112.029) (-1106.963) * (-1106.311) (-1107.648) [-1107.364] (-1107.704) -- 0:00:14
838000 -- (-1108.683) (-1106.032) (-1109.838) [-1107.410] * (-1111.259) [-1105.520] (-1111.231) (-1105.900) -- 0:00:15
838500 -- (-1107.489) [-1105.935] (-1108.144) (-1106.970) * (-1105.884) (-1109.663) (-1107.301) [-1106.228] -- 0:00:15
839000 -- [-1107.698] (-1110.670) (-1108.127) (-1107.702) * (-1105.779) (-1107.975) (-1108.820) [-1106.820] -- 0:00:14
839500 -- (-1107.809) (-1106.745) (-1108.102) [-1107.676] * (-1106.414) (-1107.888) [-1106.465] (-1105.948) -- 0:00:14
840000 -- [-1107.847] (-1110.649) (-1107.119) (-1107.162) * (-1108.506) (-1108.294) [-1106.144] (-1106.702) -- 0:00:14
Average standard deviation of split frequencies: 0.008486
840500 -- (-1107.497) (-1108.029) (-1106.591) [-1107.337] * (-1114.923) (-1107.054) [-1106.096] (-1108.055) -- 0:00:14
841000 -- (-1115.754) (-1110.903) (-1106.356) [-1111.044] * [-1106.462] (-1106.536) (-1112.205) (-1107.385) -- 0:00:14
841500 -- (-1107.252) [-1107.868] (-1107.145) (-1108.769) * (-1108.340) [-1107.145] (-1106.507) (-1106.188) -- 0:00:14
842000 -- (-1107.938) (-1106.905) [-1108.939] (-1109.006) * [-1106.927] (-1107.139) (-1107.204) (-1105.694) -- 0:00:14
842500 -- (-1109.675) (-1109.246) [-1108.007] (-1109.074) * (-1111.355) (-1110.239) [-1106.195] (-1105.751) -- 0:00:14
843000 -- (-1105.525) (-1111.418) [-1106.687] (-1106.532) * (-1108.021) (-1113.353) (-1107.359) [-1105.503] -- 0:00:14
843500 -- (-1109.412) [-1108.380] (-1108.879) (-1106.835) * (-1107.983) (-1106.837) [-1109.156] (-1107.879) -- 0:00:14
844000 -- [-1106.609] (-1110.134) (-1106.419) (-1106.230) * (-1105.803) (-1107.487) [-1107.429] (-1110.069) -- 0:00:14
844500 -- (-1106.248) [-1106.190] (-1110.252) (-1106.103) * (-1107.918) (-1115.980) (-1105.653) [-1109.240] -- 0:00:14
845000 -- [-1105.614] (-1108.438) (-1109.290) (-1106.100) * [-1107.643] (-1108.162) (-1106.876) (-1110.679) -- 0:00:14
Average standard deviation of split frequencies: 0.008321
845500 -- (-1110.025) [-1105.777] (-1107.851) (-1106.774) * (-1105.960) (-1109.815) (-1106.090) [-1110.672] -- 0:00:14
846000 -- (-1107.467) (-1106.515) (-1107.036) [-1106.412] * (-1108.023) (-1107.535) [-1110.674] (-1107.661) -- 0:00:14
846500 -- [-1107.754] (-1105.387) (-1107.122) (-1107.282) * (-1107.759) (-1109.303) [-1107.980] (-1107.430) -- 0:00:14
847000 -- [-1108.551] (-1106.065) (-1108.083) (-1106.443) * (-1109.106) (-1110.803) [-1107.176] (-1107.040) -- 0:00:14
847500 -- (-1105.866) [-1105.301] (-1105.750) (-1106.610) * (-1107.565) (-1110.432) (-1106.981) [-1111.989] -- 0:00:14
848000 -- [-1106.139] (-1105.409) (-1105.409) (-1107.161) * (-1108.067) [-1115.652] (-1107.770) (-1109.233) -- 0:00:13
848500 -- (-1107.676) [-1106.167] (-1112.737) (-1108.603) * (-1109.018) (-1111.705) (-1106.620) [-1108.982] -- 0:00:13
849000 -- [-1107.015] (-1106.269) (-1113.565) (-1107.582) * [-1107.857] (-1110.339) (-1106.095) (-1110.536) -- 0:00:13
849500 -- (-1108.825) (-1105.227) (-1111.745) [-1105.725] * (-1109.935) (-1108.412) [-1107.149] (-1109.229) -- 0:00:13
850000 -- [-1108.246] (-1106.312) (-1108.798) (-1108.651) * (-1108.328) [-1106.113] (-1108.393) (-1107.902) -- 0:00:13
Average standard deviation of split frequencies: 0.008312
850500 -- [-1107.508] (-1108.448) (-1110.342) (-1105.956) * (-1108.642) (-1106.261) (-1106.650) [-1108.364] -- 0:00:13
851000 -- (-1105.368) [-1108.775] (-1107.038) (-1107.155) * (-1111.911) [-1106.022] (-1106.971) (-1110.460) -- 0:00:13
851500 -- (-1105.751) (-1112.038) [-1108.041] (-1107.895) * (-1111.903) (-1109.201) (-1106.877) [-1106.103] -- 0:00:13
852000 -- (-1109.862) (-1110.982) (-1108.245) [-1112.719] * (-1109.104) [-1105.446] (-1107.028) (-1107.654) -- 0:00:13
852500 -- [-1105.508] (-1109.070) (-1108.198) (-1107.908) * (-1106.661) [-1111.165] (-1105.367) (-1111.913) -- 0:00:13
853000 -- (-1106.951) (-1109.956) [-1106.159] (-1107.407) * [-1105.812] (-1108.211) (-1105.332) (-1106.304) -- 0:00:13
853500 -- [-1110.609] (-1109.051) (-1105.137) (-1108.460) * (-1106.104) (-1108.500) (-1105.606) [-1107.536] -- 0:00:13
854000 -- (-1105.759) (-1106.605) (-1107.628) [-1108.635] * [-1105.658] (-1112.241) (-1107.786) (-1106.478) -- 0:00:13
854500 -- [-1106.807] (-1110.176) (-1110.434) (-1106.200) * (-1107.344) [-1107.342] (-1106.208) (-1105.754) -- 0:00:13
855000 -- (-1112.430) (-1108.965) (-1112.012) [-1107.051] * (-1111.560) (-1107.105) [-1106.327] (-1108.591) -- 0:00:13
Average standard deviation of split frequencies: 0.008407
855500 -- (-1107.679) (-1112.489) [-1107.241] (-1106.426) * (-1108.900) (-1107.330) [-1106.999] (-1110.058) -- 0:00:13
856000 -- (-1109.986) (-1107.063) (-1107.508) [-1108.228] * (-1107.320) (-1110.172) [-1106.258] (-1113.326) -- 0:00:13
856500 -- (-1110.906) (-1105.526) [-1111.091] (-1105.391) * [-1108.424] (-1110.260) (-1106.201) (-1108.236) -- 0:00:13
857000 -- (-1107.817) (-1106.606) (-1108.077) [-1110.931] * (-1105.719) (-1107.938) [-1105.364] (-1106.547) -- 0:00:13
857500 -- (-1107.228) [-1106.008] (-1107.363) (-1109.492) * (-1106.579) (-1110.698) [-1105.694] (-1105.699) -- 0:00:13
858000 -- (-1107.596) [-1108.356] (-1106.823) (-1112.097) * (-1105.672) (-1109.082) (-1106.382) [-1105.452] -- 0:00:13
858500 -- (-1105.846) (-1111.469) [-1109.056] (-1107.536) * [-1106.614] (-1109.213) (-1109.750) (-1108.375) -- 0:00:13
859000 -- (-1106.052) (-1111.936) (-1106.874) [-1105.565] * (-1107.589) (-1106.073) [-1107.033] (-1106.261) -- 0:00:12
859500 -- [-1106.646] (-1109.179) (-1106.950) (-1109.132) * (-1107.303) [-1107.147] (-1107.522) (-1110.454) -- 0:00:12
860000 -- [-1106.352] (-1109.794) (-1105.436) (-1106.348) * (-1106.419) (-1108.480) [-1107.216] (-1115.136) -- 0:00:12
Average standard deviation of split frequencies: 0.008143
860500 -- (-1107.026) [-1109.364] (-1109.558) (-1109.964) * (-1108.734) [-1108.566] (-1106.092) (-1109.049) -- 0:00:12
861000 -- [-1109.527] (-1105.235) (-1108.908) (-1108.016) * [-1108.579] (-1108.021) (-1106.202) (-1106.772) -- 0:00:12
861500 -- (-1107.326) (-1106.494) [-1105.840] (-1109.864) * (-1107.537) [-1108.788] (-1106.024) (-1109.964) -- 0:00:12
862000 -- (-1108.352) (-1108.412) [-1105.674] (-1106.421) * (-1107.966) [-1105.422] (-1105.695) (-1106.649) -- 0:00:12
862500 -- (-1108.831) (-1108.855) (-1107.811) [-1108.243] * (-1109.236) (-1108.102) [-1113.261] (-1107.604) -- 0:00:12
863000 -- (-1112.890) [-1108.629] (-1110.196) (-1110.042) * (-1109.953) (-1106.518) (-1111.100) [-1108.570] -- 0:00:12
863500 -- (-1105.931) [-1106.402] (-1109.600) (-1107.980) * (-1107.328) (-1106.526) [-1105.559] (-1107.431) -- 0:00:12
864000 -- (-1105.888) [-1105.799] (-1107.276) (-1105.851) * [-1106.263] (-1108.204) (-1106.477) (-1108.781) -- 0:00:12
864500 -- [-1106.016] (-1109.031) (-1106.793) (-1105.631) * (-1108.590) [-1106.712] (-1107.304) (-1106.235) -- 0:00:12
865000 -- (-1106.379) (-1109.613) [-1105.516] (-1105.760) * (-1107.061) (-1105.901) (-1107.755) [-1105.937] -- 0:00:12
Average standard deviation of split frequencies: 0.007875
865500 -- (-1106.880) (-1107.960) (-1106.020) [-1109.107] * (-1111.739) [-1105.934] (-1108.858) (-1106.694) -- 0:00:12
866000 -- [-1107.102] (-1107.565) (-1108.218) (-1108.232) * (-1108.434) [-1105.783] (-1110.441) (-1109.386) -- 0:00:12
866500 -- (-1110.202) [-1105.747] (-1108.920) (-1108.960) * (-1108.564) (-1106.551) (-1109.043) [-1108.007] -- 0:00:12
867000 -- (-1109.092) (-1105.973) (-1112.706) [-1107.370] * [-1108.302] (-1106.216) (-1108.024) (-1110.904) -- 0:00:12
867500 -- (-1106.528) [-1106.088] (-1107.942) (-1107.251) * (-1106.669) (-1107.751) (-1109.798) [-1106.441] -- 0:00:12
868000 -- (-1105.906) (-1107.221) (-1107.896) [-1105.449] * (-1106.600) [-1106.299] (-1108.426) (-1107.455) -- 0:00:12
868500 -- (-1107.541) (-1106.594) [-1108.583] (-1105.924) * (-1107.234) [-1105.251] (-1112.323) (-1105.515) -- 0:00:12
869000 -- (-1107.323) (-1107.029) [-1105.231] (-1107.195) * [-1108.271] (-1106.977) (-1108.135) (-1106.995) -- 0:00:12
869500 -- (-1105.582) (-1108.792) [-1105.707] (-1109.039) * (-1106.304) [-1106.859] (-1105.705) (-1109.483) -- 0:00:12
870000 -- (-1107.243) (-1107.470) [-1107.775] (-1107.547) * (-1112.572) [-1106.469] (-1106.227) (-1108.206) -- 0:00:11
Average standard deviation of split frequencies: 0.007905
870500 -- [-1108.511] (-1106.974) (-1111.225) (-1106.780) * [-1107.031] (-1108.477) (-1107.186) (-1108.150) -- 0:00:11
871000 -- (-1107.713) (-1106.590) [-1107.537] (-1113.888) * (-1107.354) (-1107.777) [-1107.308] (-1108.634) -- 0:00:11
871500 -- (-1107.790) [-1106.865] (-1105.534) (-1113.557) * [-1108.065] (-1106.200) (-1108.278) (-1110.985) -- 0:00:11
872000 -- [-1106.892] (-1107.386) (-1107.944) (-1107.164) * (-1107.368) (-1108.606) [-1106.284] (-1106.632) -- 0:00:11
872500 -- (-1112.646) [-1107.173] (-1110.856) (-1110.134) * (-1107.656) (-1113.338) [-1109.537] (-1106.786) -- 0:00:11
873000 -- (-1105.226) [-1105.660] (-1106.967) (-1108.202) * [-1108.135] (-1106.025) (-1106.299) (-1105.893) -- 0:00:11
873500 -- (-1106.808) [-1108.591] (-1108.280) (-1107.496) * [-1110.282] (-1109.135) (-1105.968) (-1108.724) -- 0:00:11
874000 -- (-1107.191) (-1107.010) [-1109.179] (-1108.245) * (-1108.814) [-1108.611] (-1105.918) (-1105.717) -- 0:00:11
874500 -- (-1106.032) (-1108.919) (-1106.788) [-1106.174] * (-1110.116) (-1108.665) (-1105.616) [-1105.402] -- 0:00:11
875000 -- (-1109.664) (-1106.616) (-1105.753) [-1109.786] * (-1108.207) (-1106.250) (-1112.746) [-1105.245] -- 0:00:11
Average standard deviation of split frequencies: 0.007928
875500 -- (-1107.538) (-1106.793) [-1106.868] (-1109.693) * (-1108.476) (-1105.834) (-1110.251) [-1109.469] -- 0:00:11
876000 -- (-1107.032) (-1108.971) (-1106.310) [-1110.237] * (-1112.745) (-1105.409) (-1114.628) [-1107.490] -- 0:00:11
876500 -- (-1108.027) (-1106.707) (-1109.053) [-1107.021] * (-1107.666) [-1107.608] (-1109.712) (-1106.121) -- 0:00:11
877000 -- (-1105.490) (-1107.004) (-1108.799) [-1107.442] * (-1107.392) [-1106.239] (-1106.491) (-1106.918) -- 0:00:11
877500 -- (-1109.530) [-1108.074] (-1108.033) (-1109.220) * (-1107.288) [-1105.688] (-1107.542) (-1106.462) -- 0:00:11
878000 -- [-1112.172] (-1110.086) (-1106.960) (-1110.174) * (-1106.563) (-1107.360) [-1111.447] (-1114.591) -- 0:00:11
878500 -- (-1109.126) [-1105.739] (-1112.912) (-1106.302) * (-1106.180) [-1105.343] (-1108.405) (-1109.174) -- 0:00:11
879000 -- [-1106.257] (-1108.376) (-1107.592) (-1105.909) * (-1106.332) [-1108.224] (-1107.277) (-1107.301) -- 0:00:11
879500 -- (-1106.689) (-1113.530) [-1110.184] (-1107.757) * (-1108.094) (-1106.541) (-1107.630) [-1105.360] -- 0:00:11
880000 -- [-1105.931] (-1111.881) (-1113.184) (-1106.733) * (-1115.249) (-1108.592) [-1107.850] (-1108.121) -- 0:00:11
Average standard deviation of split frequencies: 0.007958
880500 -- [-1105.916] (-1105.873) (-1108.438) (-1107.886) * (-1109.748) [-1106.822] (-1110.713) (-1109.834) -- 0:00:10
881000 -- [-1105.981] (-1105.993) (-1109.548) (-1106.927) * (-1108.941) (-1109.137) (-1108.265) [-1108.321] -- 0:00:10
881500 -- (-1105.812) (-1109.921) (-1109.475) [-1107.561] * [-1106.348] (-1106.819) (-1107.880) (-1111.399) -- 0:00:10
882000 -- (-1106.655) [-1110.665] (-1110.270) (-1105.591) * [-1106.875] (-1108.084) (-1107.785) (-1106.257) -- 0:00:10
882500 -- (-1107.377) (-1107.428) [-1108.809] (-1110.041) * (-1109.664) [-1111.026] (-1108.814) (-1106.185) -- 0:00:10
883000 -- (-1107.282) (-1107.353) (-1106.914) [-1107.079] * [-1113.107] (-1108.593) (-1107.862) (-1110.835) -- 0:00:10
883500 -- (-1108.871) (-1107.900) (-1107.638) [-1106.985] * (-1106.557) (-1109.189) [-1106.246] (-1106.352) -- 0:00:10
884000 -- (-1108.882) (-1108.569) [-1106.013] (-1105.696) * (-1109.419) [-1110.270] (-1105.862) (-1111.286) -- 0:00:10
884500 -- (-1108.992) [-1107.150] (-1110.379) (-1108.892) * [-1107.130] (-1105.972) (-1108.680) (-1112.212) -- 0:00:10
885000 -- (-1109.475) [-1107.248] (-1111.088) (-1107.877) * (-1107.565) (-1107.692) [-1106.896] (-1109.972) -- 0:00:10
Average standard deviation of split frequencies: 0.007804
885500 -- (-1107.230) (-1106.140) (-1108.574) [-1106.323] * (-1106.004) [-1107.238] (-1108.470) (-1111.234) -- 0:00:10
886000 -- (-1107.392) (-1105.439) [-1106.350] (-1105.789) * (-1109.798) (-1112.166) [-1111.017] (-1111.335) -- 0:00:10
886500 -- (-1112.010) (-1106.042) [-1105.578] (-1105.942) * (-1111.187) (-1107.997) [-1108.846] (-1110.166) -- 0:00:10
887000 -- [-1106.791] (-1105.795) (-1105.685) (-1105.858) * (-1113.522) (-1105.702) [-1106.882] (-1105.774) -- 0:00:10
887500 -- (-1108.044) [-1108.697] (-1105.955) (-1109.532) * [-1110.159] (-1105.640) (-1110.093) (-1105.589) -- 0:00:10
888000 -- (-1106.988) (-1110.003) [-1106.184] (-1111.285) * [-1109.017] (-1107.830) (-1109.551) (-1105.950) -- 0:00:10
888500 -- (-1111.664) [-1105.859] (-1107.992) (-1111.219) * (-1109.545) (-1106.878) [-1108.366] (-1106.880) -- 0:00:10
889000 -- (-1111.350) (-1105.827) [-1108.253] (-1106.404) * (-1107.108) (-1107.939) [-1108.303] (-1106.139) -- 0:00:10
889500 -- (-1108.141) [-1106.058] (-1108.438) (-1107.946) * [-1107.500] (-1107.996) (-1106.161) (-1106.736) -- 0:00:10
890000 -- [-1107.332] (-1110.017) (-1107.477) (-1106.172) * [-1106.388] (-1107.131) (-1107.202) (-1107.466) -- 0:00:10
Average standard deviation of split frequencies: 0.007692
890500 -- (-1109.446) (-1109.426) (-1107.788) [-1106.439] * (-1107.513) (-1107.276) (-1108.644) [-1106.923] -- 0:00:10
891000 -- (-1105.675) (-1108.298) [-1107.917] (-1108.359) * [-1107.649] (-1109.370) (-1106.629) (-1108.247) -- 0:00:10
891500 -- (-1106.623) [-1108.441] (-1107.416) (-1107.217) * (-1106.879) (-1110.061) (-1105.975) [-1106.830] -- 0:00:09
892000 -- (-1105.727) [-1109.786] (-1108.853) (-1108.236) * [-1108.119] (-1108.629) (-1107.797) (-1106.267) -- 0:00:09
892500 -- (-1108.012) (-1107.312) (-1105.839) [-1107.270] * (-1108.463) [-1108.082] (-1106.189) (-1105.638) -- 0:00:09
893000 -- (-1109.185) [-1108.446] (-1107.735) (-1107.234) * [-1113.886] (-1108.217) (-1107.282) (-1109.858) -- 0:00:09
893500 -- (-1112.432) [-1105.553] (-1107.776) (-1109.107) * [-1109.940] (-1107.526) (-1112.603) (-1105.865) -- 0:00:09
894000 -- [-1105.420] (-1105.806) (-1109.591) (-1106.799) * (-1108.021) [-1106.224] (-1109.472) (-1113.325) -- 0:00:09
894500 -- (-1105.146) [-1105.817] (-1111.833) (-1106.353) * [-1106.102] (-1106.433) (-1107.292) (-1114.779) -- 0:00:09
895000 -- (-1106.465) [-1108.314] (-1107.437) (-1105.796) * (-1107.620) [-1106.091] (-1108.493) (-1108.249) -- 0:00:09
Average standard deviation of split frequencies: 0.007681
895500 -- (-1107.757) (-1107.528) [-1109.690] (-1111.279) * (-1109.082) (-1106.025) (-1108.585) [-1106.203] -- 0:00:09
896000 -- [-1106.846] (-1106.110) (-1105.784) (-1112.072) * [-1107.883] (-1105.936) (-1106.586) (-1105.732) -- 0:00:09
896500 -- (-1114.527) [-1107.553] (-1105.700) (-1107.856) * (-1107.576) [-1107.905] (-1105.755) (-1106.603) -- 0:00:09
897000 -- (-1107.607) (-1107.250) (-1106.797) [-1107.523] * [-1107.276] (-1106.137) (-1106.823) (-1108.084) -- 0:00:09
897500 -- (-1106.199) (-1109.479) (-1108.610) [-1105.579] * [-1110.648] (-1105.901) (-1108.700) (-1106.022) -- 0:00:09
898000 -- (-1106.938) (-1113.654) (-1105.012) [-1106.480] * [-1109.239] (-1106.439) (-1106.523) (-1107.398) -- 0:00:09
898500 -- [-1107.759] (-1109.358) (-1107.173) (-1106.383) * (-1110.090) (-1105.554) (-1106.488) [-1105.574] -- 0:00:09
899000 -- [-1106.620] (-1110.871) (-1106.802) (-1106.637) * [-1106.246] (-1105.606) (-1110.715) (-1107.999) -- 0:00:09
899500 -- (-1107.413) (-1110.389) (-1106.709) [-1105.414] * (-1106.906) [-1105.857] (-1109.811) (-1105.427) -- 0:00:09
900000 -- (-1108.009) [-1107.817] (-1107.470) (-1107.817) * (-1105.383) (-1108.345) (-1109.448) [-1105.685] -- 0:00:09
Average standard deviation of split frequencies: 0.007188
900500 -- (-1108.591) (-1109.758) (-1107.695) [-1107.505] * [-1107.815] (-1106.122) (-1114.734) (-1106.278) -- 0:00:09
901000 -- (-1107.144) (-1111.448) [-1106.315] (-1107.313) * [-1108.455] (-1106.063) (-1110.743) (-1107.620) -- 0:00:09
901500 -- (-1109.098) [-1105.873] (-1107.682) (-1107.849) * (-1106.722) (-1106.743) [-1107.645] (-1106.676) -- 0:00:09
902000 -- [-1106.541] (-1107.711) (-1107.684) (-1109.034) * [-1106.449] (-1109.526) (-1106.857) (-1107.030) -- 0:00:09
902500 -- (-1106.154) (-1106.001) [-1107.841] (-1109.902) * [-1107.706] (-1109.226) (-1107.861) (-1105.785) -- 0:00:08
903000 -- (-1108.434) [-1109.340] (-1105.985) (-1106.903) * (-1106.240) [-1108.162] (-1107.775) (-1105.680) -- 0:00:08
903500 -- [-1106.357] (-1108.658) (-1105.809) (-1106.829) * (-1108.088) (-1107.372) (-1111.247) [-1106.556] -- 0:00:08
904000 -- (-1108.687) (-1106.545) [-1105.491] (-1107.095) * [-1109.725] (-1105.908) (-1111.936) (-1105.861) -- 0:00:08
904500 -- (-1110.073) (-1107.071) (-1106.706) [-1107.718] * (-1106.355) [-1107.024] (-1108.478) (-1106.094) -- 0:00:08
905000 -- (-1108.633) [-1107.142] (-1106.805) (-1109.636) * (-1106.599) (-1107.249) (-1109.267) [-1108.482] -- 0:00:08
Average standard deviation of split frequencies: 0.007180
905500 -- (-1106.669) [-1110.957] (-1107.033) (-1109.585) * (-1106.685) [-1106.459] (-1110.690) (-1108.012) -- 0:00:08
906000 -- (-1106.806) (-1105.519) [-1107.872] (-1111.607) * (-1108.246) (-1106.800) (-1110.703) [-1107.100] -- 0:00:08
906500 -- (-1105.530) [-1105.378] (-1106.567) (-1110.118) * (-1108.930) (-1107.639) (-1108.819) [-1105.633] -- 0:00:08
907000 -- (-1106.628) [-1106.444] (-1107.989) (-1110.218) * (-1105.833) [-1108.116] (-1109.876) (-1108.470) -- 0:00:08
907500 -- (-1105.768) (-1106.830) (-1108.953) [-1108.430] * (-1107.307) [-1107.643] (-1110.844) (-1110.185) -- 0:00:08
908000 -- [-1105.935] (-1107.298) (-1105.976) (-1107.667) * (-1107.114) [-1107.588] (-1107.551) (-1106.784) -- 0:00:08
908500 -- (-1107.691) (-1105.306) [-1109.408] (-1109.630) * (-1106.263) [-1106.582] (-1107.132) (-1107.986) -- 0:00:08
909000 -- [-1107.132] (-1105.863) (-1109.637) (-1109.150) * [-1107.676] (-1106.565) (-1106.915) (-1107.726) -- 0:00:08
909500 -- (-1109.903) (-1107.208) (-1106.534) [-1107.613] * (-1107.628) [-1105.429] (-1107.289) (-1110.307) -- 0:00:08
910000 -- [-1108.396] (-1107.254) (-1107.905) (-1107.170) * (-1109.122) [-1106.518] (-1105.990) (-1106.550) -- 0:00:08
Average standard deviation of split frequencies: 0.006798
910500 -- (-1114.504) [-1107.922] (-1108.229) (-1107.242) * [-1107.775] (-1106.658) (-1105.122) (-1106.226) -- 0:00:08
911000 -- (-1107.699) (-1110.091) [-1106.387] (-1108.380) * (-1106.477) (-1107.344) [-1105.125] (-1106.166) -- 0:00:08
911500 -- (-1107.078) [-1105.425] (-1109.347) (-1106.301) * (-1107.706) (-1109.939) [-1105.044] (-1105.945) -- 0:00:08
912000 -- (-1110.619) (-1106.787) [-1108.857] (-1105.735) * (-1107.674) [-1108.116] (-1106.378) (-1107.810) -- 0:00:08
912500 -- (-1107.547) (-1105.878) [-1108.464] (-1107.800) * (-1107.661) [-1108.612] (-1108.119) (-1107.038) -- 0:00:08
913000 -- (-1107.442) [-1105.389] (-1112.405) (-1106.631) * (-1107.107) (-1105.601) (-1112.016) [-1106.388] -- 0:00:08
913500 -- (-1107.085) [-1106.918] (-1111.063) (-1105.929) * (-1105.211) (-1107.670) (-1107.153) [-1105.921] -- 0:00:07
914000 -- (-1106.565) (-1107.426) [-1107.133] (-1106.795) * [-1106.909] (-1109.948) (-1107.348) (-1106.382) -- 0:00:07
914500 -- (-1107.065) [-1107.721] (-1106.175) (-1107.479) * (-1105.195) (-1107.574) [-1105.395] (-1107.399) -- 0:00:07
915000 -- (-1108.824) (-1108.003) (-1108.239) [-1108.546] * (-1110.321) (-1107.132) [-1105.508] (-1107.139) -- 0:00:07
Average standard deviation of split frequencies: 0.006930
915500 -- (-1110.737) [-1108.432] (-1108.808) (-1106.598) * (-1109.000) [-1106.036] (-1106.207) (-1109.364) -- 0:00:07
916000 -- (-1107.850) [-1106.352] (-1108.752) (-1105.344) * [-1106.655] (-1109.138) (-1105.897) (-1108.732) -- 0:00:07
916500 -- (-1105.707) (-1106.418) [-1106.761] (-1106.377) * [-1106.855] (-1108.042) (-1106.970) (-1107.494) -- 0:00:07
917000 -- (-1105.906) (-1106.333) (-1106.581) [-1105.351] * (-1106.228) (-1104.976) [-1106.610] (-1106.967) -- 0:00:07
917500 -- (-1106.008) (-1105.804) [-1106.401] (-1107.475) * (-1106.879) (-1108.680) (-1107.846) [-1107.257] -- 0:00:07
918000 -- (-1109.970) (-1106.605) (-1108.226) [-1109.463] * (-1109.002) (-1108.317) [-1106.808] (-1106.310) -- 0:00:07
918500 -- (-1108.862) (-1108.694) [-1109.444] (-1112.703) * [-1107.352] (-1112.308) (-1108.411) (-1107.759) -- 0:00:07
919000 -- (-1107.287) [-1107.644] (-1109.052) (-1112.886) * (-1105.595) [-1106.248] (-1108.289) (-1108.380) -- 0:00:07
919500 -- (-1105.934) (-1110.750) [-1110.762] (-1109.787) * (-1105.274) [-1105.728] (-1108.591) (-1110.869) -- 0:00:07
920000 -- [-1107.024] (-1108.960) (-1109.796) (-1106.809) * (-1106.117) (-1107.618) (-1107.998) [-1110.558] -- 0:00:07
Average standard deviation of split frequencies: 0.006929
920500 -- (-1107.106) (-1107.068) (-1106.048) [-1108.447] * (-1110.011) (-1109.581) (-1107.994) [-1108.439] -- 0:00:07
921000 -- (-1111.032) (-1110.308) (-1109.286) [-1109.130] * [-1106.579] (-1107.566) (-1105.932) (-1109.057) -- 0:00:07
921500 -- (-1105.912) (-1107.201) [-1106.210] (-1105.667) * [-1106.190] (-1110.610) (-1106.198) (-1109.543) -- 0:00:07
922000 -- (-1106.575) (-1112.823) [-1106.711] (-1107.693) * [-1107.217] (-1106.738) (-1105.329) (-1108.337) -- 0:00:07
922500 -- (-1108.746) (-1108.324) [-1106.433] (-1107.952) * (-1109.884) (-1107.102) [-1106.509] (-1106.646) -- 0:00:07
923000 -- [-1105.369] (-1109.698) (-1107.216) (-1107.449) * [-1110.048] (-1107.537) (-1107.019) (-1106.380) -- 0:00:07
923500 -- (-1107.458) [-1105.428] (-1107.402) (-1107.267) * (-1107.406) (-1105.628) [-1107.593] (-1108.254) -- 0:00:07
924000 -- (-1108.412) [-1105.705] (-1105.678) (-1112.253) * (-1107.073) (-1108.391) (-1106.839) [-1110.157] -- 0:00:06
924500 -- (-1106.309) (-1105.721) (-1105.954) [-1107.910] * (-1108.247) [-1107.205] (-1106.504) (-1106.579) -- 0:00:06
925000 -- (-1105.297) [-1106.540] (-1106.712) (-1109.220) * (-1109.427) (-1108.508) (-1107.288) [-1105.254] -- 0:00:06
Average standard deviation of split frequencies: 0.007433
925500 -- (-1106.774) (-1106.509) (-1106.469) [-1109.330] * [-1108.769] (-1109.321) (-1107.230) (-1108.006) -- 0:00:06
926000 -- (-1106.759) (-1107.641) (-1106.432) [-1109.405] * (-1109.339) (-1108.458) [-1107.852] (-1108.000) -- 0:00:06
926500 -- (-1106.750) (-1106.180) (-1105.559) [-1108.714] * (-1106.093) [-1105.919] (-1109.169) (-1106.988) -- 0:00:06
927000 -- [-1107.182] (-1109.286) (-1110.272) (-1105.624) * (-1106.909) [-1106.423] (-1108.133) (-1106.918) -- 0:00:06
927500 -- (-1108.049) [-1108.565] (-1110.507) (-1109.637) * [-1108.667] (-1106.429) (-1105.937) (-1107.664) -- 0:00:06
928000 -- (-1106.510) [-1111.767] (-1106.166) (-1107.840) * (-1107.274) [-1107.543] (-1109.113) (-1108.831) -- 0:00:06
928500 -- (-1107.592) [-1108.050] (-1105.575) (-1107.776) * (-1107.667) [-1105.947] (-1110.144) (-1109.472) -- 0:00:06
929000 -- (-1109.284) (-1106.704) (-1105.174) [-1105.898] * (-1109.117) (-1108.266) (-1108.280) [-1105.998] -- 0:00:06
929500 -- (-1109.468) (-1107.792) (-1105.174) [-1107.286] * (-1109.348) (-1105.770) (-1106.235) [-1106.885] -- 0:00:06
930000 -- (-1108.462) (-1106.854) [-1109.518] (-1105.748) * (-1112.498) [-1105.065] (-1105.265) (-1108.996) -- 0:00:06
Average standard deviation of split frequencies: 0.007530
930500 -- (-1107.317) (-1108.854) (-1106.294) [-1106.934] * (-1107.433) (-1107.996) [-1105.746] (-1114.716) -- 0:00:06
931000 -- [-1106.573] (-1106.350) (-1107.780) (-1106.458) * (-1106.507) [-1109.645] (-1108.758) (-1109.885) -- 0:00:06
931500 -- (-1110.277) (-1105.973) [-1105.654] (-1108.161) * [-1106.768] (-1107.741) (-1110.048) (-1111.155) -- 0:00:06
932000 -- (-1109.386) [-1106.075] (-1107.509) (-1109.279) * (-1105.464) (-1105.668) (-1108.572) [-1107.551] -- 0:00:06
932500 -- (-1107.499) [-1105.014] (-1105.530) (-1108.072) * (-1106.307) (-1107.174) (-1105.582) [-1107.809] -- 0:00:06
933000 -- (-1109.089) [-1105.680] (-1105.765) (-1106.501) * (-1106.565) (-1107.287) [-1106.359] (-1108.461) -- 0:00:06
933500 -- (-1106.857) [-1105.380] (-1106.297) (-1110.973) * (-1108.797) (-1108.353) [-1107.775] (-1107.811) -- 0:00:06
934000 -- (-1108.289) [-1106.522] (-1107.409) (-1112.827) * (-1106.388) (-1107.132) [-1106.993] (-1110.246) -- 0:00:06
934500 -- [-1108.246] (-1107.188) (-1105.742) (-1108.284) * (-1106.382) (-1106.304) [-1107.358] (-1112.061) -- 0:00:06
935000 -- (-1109.914) [-1107.436] (-1105.741) (-1110.833) * [-1106.057] (-1108.466) (-1108.767) (-1109.893) -- 0:00:05
Average standard deviation of split frequencies: 0.007118
935500 -- (-1106.840) (-1108.676) (-1106.756) [-1106.043] * (-1106.240) (-1107.868) [-1109.333] (-1106.165) -- 0:00:05
936000 -- (-1105.826) (-1108.521) (-1110.509) [-1108.516] * (-1107.175) [-1105.649] (-1108.066) (-1107.293) -- 0:00:05
936500 -- (-1106.737) (-1107.507) [-1107.783] (-1106.198) * [-1107.654] (-1110.938) (-1108.091) (-1110.238) -- 0:00:05
937000 -- (-1105.721) (-1108.271) (-1106.175) [-1108.390] * (-1106.374) (-1108.508) [-1106.411] (-1112.840) -- 0:00:05
937500 -- (-1105.671) [-1107.286] (-1108.125) (-1109.446) * (-1106.001) (-1113.933) [-1107.916] (-1112.892) -- 0:00:05
938000 -- (-1107.367) (-1106.962) [-1107.611] (-1111.691) * [-1105.728] (-1108.576) (-1108.671) (-1109.416) -- 0:00:05
938500 -- (-1107.468) [-1107.632] (-1111.400) (-1105.785) * [-1108.616] (-1105.843) (-1120.112) (-1107.156) -- 0:00:05
939000 -- (-1107.019) (-1108.644) (-1106.254) [-1106.042] * (-1108.199) [-1106.326] (-1106.582) (-1107.014) -- 0:00:05
939500 -- (-1106.155) (-1105.802) [-1106.839] (-1107.234) * (-1105.639) [-1107.155] (-1107.048) (-1108.607) -- 0:00:05
940000 -- [-1105.059] (-1108.459) (-1108.887) (-1108.302) * (-1107.695) [-1108.010] (-1107.581) (-1108.584) -- 0:00:05
Average standard deviation of split frequencies: 0.007350
940500 -- (-1106.233) (-1110.260) (-1106.808) [-1108.597] * (-1110.570) (-1109.386) [-1106.880] (-1105.824) -- 0:00:05
941000 -- (-1107.893) [-1108.715] (-1108.626) (-1106.343) * (-1106.589) [-1107.866] (-1112.626) (-1109.314) -- 0:00:05
941500 -- [-1106.214] (-1107.771) (-1107.992) (-1106.157) * [-1107.120] (-1111.141) (-1108.471) (-1107.442) -- 0:00:05
942000 -- [-1107.440] (-1107.315) (-1107.660) (-1109.237) * [-1107.314] (-1108.190) (-1108.553) (-1107.009) -- 0:00:05
942500 -- (-1105.641) (-1106.366) (-1109.806) [-1107.469] * (-1106.364) [-1109.137] (-1106.925) (-1107.785) -- 0:00:05
943000 -- (-1106.848) [-1106.970] (-1109.017) (-1108.050) * (-1111.641) (-1110.268) [-1107.120] (-1111.219) -- 0:00:05
943500 -- (-1106.929) [-1106.992] (-1109.657) (-1107.303) * (-1109.700) (-1110.066) (-1111.136) [-1108.063] -- 0:00:05
944000 -- (-1106.658) (-1108.777) [-1108.316] (-1108.091) * [-1106.644] (-1105.726) (-1108.787) (-1106.879) -- 0:00:05
944500 -- (-1108.016) (-1107.317) (-1118.083) [-1107.220] * (-1108.332) (-1105.577) (-1107.006) [-1106.981] -- 0:00:05
945000 -- (-1106.395) (-1107.448) (-1114.714) [-1108.370] * (-1109.521) [-1108.747] (-1110.739) (-1108.168) -- 0:00:05
Average standard deviation of split frequencies: 0.007076
945500 -- [-1105.896] (-1105.548) (-1109.152) (-1109.987) * (-1105.865) [-1107.366] (-1110.131) (-1106.784) -- 0:00:05
946000 -- (-1107.116) [-1105.235] (-1109.580) (-1109.055) * (-1107.339) [-1105.983] (-1110.001) (-1106.270) -- 0:00:04
946500 -- (-1106.940) [-1108.318] (-1109.137) (-1109.658) * (-1108.903) (-1105.882) (-1105.959) [-1107.492] -- 0:00:04
947000 -- (-1109.402) [-1107.287] (-1106.549) (-1107.402) * (-1108.055) (-1105.966) (-1105.613) [-1106.183] -- 0:00:04
947500 -- [-1108.517] (-1105.935) (-1106.896) (-1107.024) * (-1106.355) [-1105.981] (-1106.000) (-1111.645) -- 0:00:04
948000 -- (-1109.465) [-1105.563] (-1108.265) (-1105.751) * (-1107.926) [-1107.895] (-1109.098) (-1109.776) -- 0:00:04
948500 -- (-1110.538) (-1106.333) (-1108.395) [-1105.248] * [-1107.338] (-1106.864) (-1108.180) (-1110.099) -- 0:00:04
949000 -- (-1110.378) [-1106.540] (-1107.324) (-1105.249) * (-1106.626) [-1108.900] (-1107.322) (-1110.375) -- 0:00:04
949500 -- [-1109.375] (-1106.785) (-1107.388) (-1105.279) * [-1109.468] (-1110.831) (-1105.563) (-1109.230) -- 0:00:04
950000 -- (-1111.331) (-1106.661) [-1105.868] (-1110.709) * (-1105.456) (-1106.438) [-1105.679] (-1111.659) -- 0:00:04
Average standard deviation of split frequencies: 0.006678
950500 -- (-1106.248) (-1105.208) [-1107.483] (-1107.236) * (-1105.823) [-1108.488] (-1109.242) (-1109.710) -- 0:00:04
951000 -- (-1106.185) (-1105.208) [-1110.708] (-1106.167) * (-1107.414) (-1107.731) [-1106.128] (-1109.911) -- 0:00:04
951500 -- (-1109.743) (-1107.825) (-1108.544) [-1106.258] * (-1105.801) [-1106.604] (-1106.700) (-1105.205) -- 0:00:04
952000 -- (-1110.350) (-1114.273) (-1106.282) [-1105.783] * (-1106.352) (-1106.788) (-1106.773) [-1106.973] -- 0:00:04
952500 -- (-1110.785) (-1107.791) (-1107.751) [-1106.113] * (-1108.452) (-1105.546) [-1105.597] (-1105.438) -- 0:00:04
953000 -- (-1106.618) (-1106.882) [-1108.816] (-1107.456) * (-1106.406) (-1107.204) [-1105.775] (-1107.430) -- 0:00:04
953500 -- [-1107.681] (-1108.280) (-1106.760) (-1106.561) * (-1107.305) (-1113.188) [-1105.812] (-1108.741) -- 0:00:04
954000 -- (-1108.788) [-1108.024] (-1106.486) (-1108.988) * (-1109.195) [-1108.551] (-1105.530) (-1112.839) -- 0:00:04
954500 -- (-1108.706) (-1107.500) [-1107.597] (-1105.940) * (-1110.953) (-1107.031) [-1106.200] (-1108.029) -- 0:00:04
955000 -- (-1107.746) (-1107.904) [-1105.713] (-1107.011) * (-1111.158) (-1107.160) (-1106.489) [-1105.599] -- 0:00:04
Average standard deviation of split frequencies: 0.006706
955500 -- [-1109.001] (-1107.763) (-1105.675) (-1105.588) * [-1107.241] (-1110.267) (-1106.908) (-1108.525) -- 0:00:04
956000 -- (-1106.440) (-1107.298) (-1106.270) [-1106.212] * (-1108.666) (-1108.511) [-1107.623] (-1113.373) -- 0:00:04
956500 -- (-1106.110) (-1108.689) [-1106.011] (-1106.788) * (-1109.704) (-1109.317) (-1106.141) [-1109.304] -- 0:00:04
957000 -- (-1109.338) (-1109.787) (-1109.414) [-1105.263] * (-1106.534) (-1112.000) (-1105.499) [-1109.411] -- 0:00:03
957500 -- (-1107.727) [-1105.359] (-1106.066) (-1107.507) * [-1109.331] (-1106.153) (-1105.496) (-1106.147) -- 0:00:03
958000 -- (-1108.003) [-1105.152] (-1106.000) (-1107.376) * (-1108.319) (-1108.552) (-1108.652) [-1105.772] -- 0:00:03
958500 -- (-1110.975) (-1107.758) [-1106.704] (-1106.214) * (-1108.158) (-1110.787) (-1109.922) [-1105.780] -- 0:00:03
959000 -- (-1107.704) [-1107.174] (-1105.609) (-1107.185) * [-1107.610] (-1110.297) (-1108.304) (-1106.063) -- 0:00:03
959500 -- (-1106.999) [-1106.063] (-1105.737) (-1108.174) * (-1108.291) [-1108.579] (-1105.910) (-1108.691) -- 0:00:03
960000 -- (-1105.641) (-1110.286) [-1105.802] (-1108.836) * (-1106.529) (-1107.536) [-1106.217] (-1107.080) -- 0:00:03
Average standard deviation of split frequencies: 0.006772
960500 -- (-1107.063) (-1111.259) [-1105.855] (-1107.654) * (-1108.586) (-1108.428) [-1106.325] (-1107.045) -- 0:00:03
961000 -- (-1107.190) (-1112.087) (-1109.441) [-1106.233] * [-1106.357] (-1106.388) (-1110.380) (-1106.886) -- 0:00:03
961500 -- (-1105.169) (-1110.246) (-1106.009) [-1105.970] * [-1108.352] (-1109.105) (-1108.005) (-1109.849) -- 0:00:03
962000 -- (-1105.821) [-1106.117] (-1107.082) (-1110.971) * (-1107.664) [-1105.692] (-1111.071) (-1106.031) -- 0:00:03
962500 -- (-1106.833) [-1105.524] (-1106.318) (-1108.932) * (-1107.082) (-1106.587) [-1109.313] (-1107.989) -- 0:00:03
963000 -- [-1108.764] (-1106.239) (-1107.130) (-1106.106) * (-1108.692) (-1107.335) [-1107.616] (-1106.513) -- 0:00:03
963500 -- (-1110.801) (-1108.644) [-1106.272] (-1106.825) * [-1109.125] (-1106.749) (-1107.420) (-1108.101) -- 0:00:03
964000 -- [-1106.938] (-1105.776) (-1110.377) (-1108.745) * (-1109.553) (-1110.743) (-1106.539) [-1106.937] -- 0:00:03
964500 -- (-1108.452) [-1107.425] (-1114.091) (-1106.609) * (-1107.796) (-1110.199) [-1109.551] (-1107.584) -- 0:00:03
965000 -- [-1107.597] (-1109.053) (-1110.509) (-1108.999) * (-1105.777) (-1106.175) [-1106.933] (-1110.034) -- 0:00:03
Average standard deviation of split frequencies: 0.006799
965500 -- (-1107.506) (-1108.321) (-1109.983) [-1107.366] * [-1105.603] (-1108.184) (-1107.541) (-1106.963) -- 0:00:03
966000 -- (-1105.966) [-1107.310] (-1107.006) (-1106.649) * (-1109.211) (-1107.558) [-1106.099] (-1109.934) -- 0:00:03
966500 -- (-1106.156) (-1110.842) [-1107.509] (-1108.148) * (-1108.079) (-1106.931) [-1105.994] (-1111.196) -- 0:00:03
967000 -- [-1105.908] (-1109.170) (-1108.130) (-1107.431) * (-1112.140) (-1107.175) (-1109.009) [-1107.377] -- 0:00:03
967500 -- [-1107.462] (-1106.589) (-1106.438) (-1107.580) * [-1106.539] (-1106.906) (-1108.290) (-1107.567) -- 0:00:02
968000 -- (-1106.742) (-1106.679) [-1105.937] (-1107.934) * (-1106.920) (-1110.524) (-1108.374) [-1106.237] -- 0:00:02
968500 -- (-1106.746) [-1105.590] (-1106.497) (-1109.790) * [-1108.716] (-1112.781) (-1107.119) (-1106.549) -- 0:00:02
969000 -- (-1105.687) (-1105.290) [-1106.486] (-1109.558) * (-1107.240) (-1108.382) [-1105.649] (-1107.953) -- 0:00:02
969500 -- (-1105.704) (-1106.441) (-1109.638) [-1107.451] * (-1105.872) (-1107.504) [-1106.739] (-1106.130) -- 0:00:02
970000 -- (-1105.980) [-1108.993] (-1109.258) (-1105.728) * (-1105.802) [-1108.311] (-1105.672) (-1111.729) -- 0:00:02
Average standard deviation of split frequencies: 0.006799
970500 -- (-1105.998) (-1107.723) [-1106.088] (-1105.230) * (-1115.097) (-1108.113) (-1105.331) [-1106.728] -- 0:00:02
971000 -- (-1106.909) (-1109.651) [-1106.354] (-1105.230) * (-1108.790) (-1108.626) (-1106.742) [-1106.564] -- 0:00:02
971500 -- (-1106.434) [-1106.393] (-1108.162) (-1116.297) * (-1107.536) [-1106.587] (-1108.779) (-1106.542) -- 0:00:02
972000 -- (-1107.310) (-1108.102) (-1106.923) [-1105.357] * (-1113.372) (-1105.485) (-1109.313) [-1107.460] -- 0:00:02
972500 -- (-1105.751) [-1108.064] (-1107.830) (-1108.403) * (-1106.532) (-1108.785) (-1106.948) [-1105.922] -- 0:00:02
973000 -- (-1105.737) [-1106.555] (-1106.742) (-1109.301) * (-1113.870) [-1106.583] (-1106.188) (-1107.086) -- 0:00:02
973500 -- [-1107.452] (-1106.564) (-1106.736) (-1105.968) * [-1106.534] (-1106.159) (-1108.247) (-1106.391) -- 0:00:02
974000 -- [-1106.314] (-1107.556) (-1106.283) (-1112.710) * (-1108.035) (-1108.260) (-1112.212) [-1108.036] -- 0:00:02
974500 -- (-1107.783) (-1110.748) [-1106.786] (-1106.310) * (-1107.262) (-1108.835) [-1110.544] (-1107.954) -- 0:00:02
975000 -- [-1105.062] (-1107.473) (-1106.519) (-1106.861) * (-1108.649) (-1107.301) (-1108.587) [-1107.204] -- 0:00:02
Average standard deviation of split frequencies: 0.006698
975500 -- [-1107.698] (-1106.670) (-1108.244) (-1107.357) * (-1111.438) (-1106.466) [-1108.493] (-1107.482) -- 0:00:02
976000 -- [-1107.088] (-1108.483) (-1108.280) (-1108.200) * (-1107.921) (-1107.398) (-1111.821) [-1106.249] -- 0:00:02
976500 -- (-1106.617) (-1107.275) (-1106.924) [-1107.483] * [-1107.629] (-1112.420) (-1109.159) (-1106.195) -- 0:00:02
977000 -- (-1113.345) (-1105.357) [-1106.164] (-1106.397) * (-1107.396) (-1107.534) [-1105.970] (-1107.482) -- 0:00:02
977500 -- (-1110.857) [-1106.763] (-1105.709) (-1108.668) * (-1108.670) (-1105.643) [-1106.952] (-1107.129) -- 0:00:02
978000 -- (-1105.828) (-1106.444) (-1107.986) [-1106.645] * [-1105.578] (-1106.330) (-1107.085) (-1107.901) -- 0:00:02
978500 -- (-1110.720) [-1105.613] (-1111.275) (-1112.015) * (-1107.940) (-1107.769) [-1107.196] (-1108.713) -- 0:00:01
979000 -- (-1106.547) (-1107.714) (-1110.955) [-1109.670] * (-1112.295) (-1109.146) (-1108.032) [-1107.778] -- 0:00:01
979500 -- (-1107.044) (-1106.169) [-1109.973] (-1110.369) * [-1107.695] (-1110.685) (-1106.609) (-1107.036) -- 0:00:01
980000 -- (-1106.429) (-1107.825) (-1106.219) [-1105.895] * (-1106.038) (-1108.650) [-1106.846] (-1106.508) -- 0:00:01
Average standard deviation of split frequencies: 0.006505
980500 -- [-1107.412] (-1108.126) (-1109.290) (-1106.374) * (-1106.192) [-1107.223] (-1107.148) (-1111.922) -- 0:00:01
981000 -- (-1107.442) [-1108.377] (-1105.684) (-1105.943) * (-1107.898) [-1107.878] (-1108.790) (-1109.892) -- 0:00:01
981500 -- (-1106.141) [-1105.700] (-1105.613) (-1105.715) * (-1107.873) (-1108.294) [-1106.056] (-1107.294) -- 0:00:01
982000 -- [-1106.306] (-1107.315) (-1105.646) (-1105.991) * (-1108.046) [-1107.254] (-1106.039) (-1109.716) -- 0:00:01
982500 -- [-1107.873] (-1109.860) (-1106.313) (-1106.155) * (-1110.916) (-1107.761) (-1108.034) [-1108.581] -- 0:00:01
983000 -- (-1107.666) (-1110.740) [-1110.569] (-1108.189) * [-1106.420] (-1106.098) (-1108.968) (-1106.069) -- 0:00:01
983500 -- [-1106.376] (-1110.806) (-1106.226) (-1107.332) * [-1107.414] (-1107.850) (-1108.499) (-1105.193) -- 0:00:01
984000 -- (-1105.331) [-1107.113] (-1108.047) (-1107.707) * (-1106.603) (-1110.357) (-1106.724) [-1107.146] -- 0:00:01
984500 -- (-1107.695) (-1107.939) [-1105.892] (-1105.640) * (-1106.980) (-1110.078) (-1105.707) [-1105.869] -- 0:00:01
985000 -- (-1110.305) (-1106.229) (-1108.908) [-1105.962] * (-1107.289) (-1117.703) (-1109.607) [-1107.759] -- 0:00:01
Average standard deviation of split frequencies: 0.006534
985500 -- (-1109.959) (-1109.479) [-1106.211] (-1106.977) * (-1108.206) (-1106.078) [-1108.450] (-1111.354) -- 0:00:01
986000 -- (-1111.734) (-1108.705) [-1106.667] (-1108.692) * [-1106.910] (-1105.646) (-1108.685) (-1110.852) -- 0:00:01
986500 -- (-1115.556) [-1108.202] (-1105.248) (-1108.187) * (-1107.177) [-1105.646] (-1107.782) (-1108.001) -- 0:00:01
987000 -- (-1109.089) [-1105.476] (-1105.203) (-1106.174) * (-1107.304) [-1105.623] (-1109.631) (-1109.496) -- 0:00:01
987500 -- (-1108.017) (-1107.805) (-1105.453) [-1108.067] * (-1106.863) (-1108.100) [-1106.154] (-1109.171) -- 0:00:01
988000 -- [-1106.991] (-1107.214) (-1107.411) (-1108.849) * (-1105.688) (-1107.117) [-1106.257] (-1107.519) -- 0:00:01
988500 -- (-1109.618) (-1106.352) [-1106.318] (-1108.331) * [-1105.842] (-1105.913) (-1106.127) (-1108.089) -- 0:00:01
989000 -- (-1109.146) (-1108.084) (-1112.271) [-1107.937] * (-1109.349) [-1105.926] (-1105.926) (-1109.448) -- 0:00:01
989500 -- [-1107.409] (-1105.481) (-1110.935) (-1106.810) * (-1110.540) (-1106.511) (-1105.400) [-1107.012] -- 0:00:00
990000 -- (-1107.402) (-1106.542) (-1114.391) [-1106.976] * (-1107.844) (-1113.275) [-1106.457] (-1109.278) -- 0:00:00
Average standard deviation of split frequencies: 0.006725
990500 -- (-1108.096) (-1106.904) [-1110.500] (-1106.816) * (-1105.849) (-1116.459) (-1107.896) [-1106.882] -- 0:00:00
991000 -- (-1107.583) [-1106.244] (-1107.701) (-1105.970) * (-1106.986) (-1112.873) [-1106.855] (-1107.927) -- 0:00:00
991500 -- (-1106.219) (-1106.537) (-1107.263) [-1107.818] * (-1106.544) (-1107.731) [-1107.536] (-1109.575) -- 0:00:00
992000 -- (-1106.449) (-1111.417) [-1106.137] (-1106.816) * (-1108.645) [-1110.044] (-1108.474) (-1106.877) -- 0:00:00
992500 -- (-1107.267) (-1106.384) (-1105.248) [-1106.399] * (-1109.374) (-1107.157) [-1108.385] (-1107.397) -- 0:00:00
993000 -- (-1106.038) [-1107.769] (-1107.999) (-1106.682) * (-1109.721) (-1107.398) (-1106.150) [-1108.826] -- 0:00:00
993500 -- [-1106.882] (-1106.354) (-1105.150) (-1107.133) * (-1110.281) [-1109.306] (-1105.677) (-1110.060) -- 0:00:00
994000 -- (-1106.840) (-1106.598) [-1109.281] (-1107.093) * (-1109.711) (-1108.508) [-1105.573] (-1108.347) -- 0:00:00
994500 -- (-1106.092) (-1105.952) [-1107.536] (-1111.009) * (-1108.583) (-1107.669) (-1107.676) [-1106.792] -- 0:00:00
995000 -- (-1115.748) (-1106.572) [-1107.245] (-1111.987) * (-1106.547) (-1107.979) (-1108.865) [-1105.655] -- 0:00:00
Average standard deviation of split frequencies: 0.006595
995500 -- (-1119.728) [-1105.921] (-1107.027) (-1106.566) * (-1106.718) (-1111.056) (-1110.299) [-1105.945] -- 0:00:00
996000 -- (-1113.116) [-1107.420] (-1106.643) (-1109.965) * (-1107.013) [-1110.100] (-1109.807) (-1109.342) -- 0:00:00
996500 -- (-1111.818) (-1109.177) (-1107.683) [-1107.284] * (-1105.763) (-1105.989) [-1106.026] (-1107.083) -- 0:00:00
997000 -- [-1106.537] (-1107.423) (-1106.514) (-1107.251) * (-1106.526) (-1108.569) (-1106.736) [-1107.100] -- 0:00:00
997500 -- [-1105.555] (-1106.111) (-1106.905) (-1105.117) * (-1105.858) (-1108.569) [-1106.473] (-1107.284) -- 0:00:00
998000 -- (-1105.980) (-1106.967) (-1107.075) [-1105.524] * (-1106.890) [-1108.186] (-1106.636) (-1106.184) -- 0:00:00
998500 -- (-1107.701) (-1107.654) [-1107.734] (-1106.670) * (-1106.890) [-1106.217] (-1113.388) (-1107.300) -- 0:00:00
999000 -- (-1106.380) [-1107.697] (-1106.051) (-1106.830) * (-1106.440) (-1105.759) (-1114.573) [-1107.030] -- 0:00:00
999500 -- (-1109.063) (-1109.401) (-1105.434) [-1106.416] * [-1107.016] (-1106.958) (-1113.504) (-1106.897) -- 0:00:00
1000000 -- (-1113.654) (-1114.625) (-1106.030) [-1106.478] * (-1109.185) [-1107.244] (-1111.317) (-1106.695) -- 0:00:00
Average standard deviation of split frequencies: 0.006689
Analysis completed in 1 mins 32 seconds
Analysis used 91.21 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1104.94
Likelihood of best state for "cold" chain of run 2 was -1104.94
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.0 % ( 23 %) Dirichlet(Pi{all})
28.5 % ( 17 %) Slider(Pi{all})
78.6 % ( 49 %) Multiplier(Alpha{1,2})
78.0 % ( 41 %) Multiplier(Alpha{3})
19.8 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 35 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 65 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
27.3 % ( 23 %) Dirichlet(Pi{all})
29.0 % ( 29 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.3 % ( 51 %) Multiplier(Alpha{3})
20.6 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
69.9 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 37 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166561 0.82 0.66
3 | 166677 166553 0.83
4 | 167323 166255 166631
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166993 0.82 0.67
3 | 165796 166894 0.84
4 | 166802 166696 166819
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1106.48
| 2 |
| 1 1 2 1 1 |
| 1 1 1 1 |
| 21 2 1 2 1 |
| 2 2 2 1 1 1 2 2 * |
| 1 1 * 2 21 122 1 *|
|2 2 1 1 2 1 1 21 2 2 1 1 2 |
| * 1 2 1 * 2* 12 1 21 * 2 2 * 2 1 2 |
| 2 2 1 2 1 1 2 22 1 1 |
| 1 1 2 2 12 2 * 2 |
| 1 2 11 12 |
| 2 2 2 1 22 |
| 2 1 2 1 1 21 |
| 1 |
|1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1108.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1106.60 -1109.71
2 -1106.62 -1110.25
--------------------------------------
TOTAL -1106.61 -1110.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902344 0.091309 0.366325 1.506009 0.867860 1501.00 1501.00 1.000
r(A<->C){all} 0.156995 0.021234 0.000137 0.449806 0.115081 155.26 177.79 1.000
r(A<->G){all} 0.163070 0.020509 0.000001 0.454809 0.121956 134.81 155.01 1.008
r(A<->T){all} 0.176163 0.021032 0.000077 0.473190 0.138721 172.04 209.19 1.000
r(C<->G){all} 0.179897 0.023169 0.000019 0.493524 0.136077 117.66 145.14 1.013
r(C<->T){all} 0.166473 0.020390 0.000065 0.457806 0.127109 243.42 243.47 1.000
r(G<->T){all} 0.157404 0.019185 0.000016 0.433750 0.120092 199.10 233.78 1.000
pi(A){all} 0.210563 0.000196 0.182713 0.237316 0.210304 1147.97 1324.49 1.000
pi(C){all} 0.293083 0.000243 0.261543 0.323617 0.292994 1298.20 1331.63 1.000
pi(G){all} 0.283488 0.000232 0.253127 0.311714 0.283530 1149.31 1325.15 1.000
pi(T){all} 0.212866 0.000213 0.183851 0.240751 0.212429 1481.91 1484.28 1.000
alpha{1,2} 0.432584 0.242686 0.000191 1.407645 0.260065 1268.24 1367.71 1.000
alpha{3} 0.477940 0.252583 0.000206 1.478824 0.322442 868.70 1053.03 1.001
pinvar{all} 0.998156 0.000005 0.994038 1.000000 0.998873 1084.59 1093.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- ..****
9 -- .*..*.
10 -- ...*.*
11 -- ..*..*
12 -- .**.**
13 -- .**...
14 -- .*.*..
15 -- .*.***
16 -- ..**..
17 -- .****.
18 -- ....**
19 -- .*...*
20 -- ...**.
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.003298 0.151233 0.155896 2
8 458 0.152565 0.000942 0.151899 0.153231 2
9 454 0.151233 0.010364 0.143904 0.158561 2
10 445 0.148235 0.008009 0.142572 0.153897 2
11 435 0.144903 0.013662 0.135243 0.154564 2
12 434 0.144570 0.020728 0.129913 0.159227 2
13 431 0.143571 0.010835 0.135909 0.151233 2
14 422 0.140573 0.003769 0.137908 0.143238 2
15 422 0.140573 0.007537 0.135243 0.145903 2
16 421 0.140240 0.006124 0.135909 0.144570 2
17 421 0.140240 0.002355 0.138574 0.141905 2
18 415 0.138241 0.001413 0.137242 0.139241 2
19 413 0.137575 0.002355 0.135909 0.139241 2
20 410 0.136576 0.000000 0.136576 0.136576 2
21 409 0.136243 0.008951 0.129913 0.142572 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099270 0.010061 0.000011 0.298802 0.067867 1.000 2
length{all}[2] 0.102056 0.011077 0.000040 0.304912 0.069613 1.000 2
length{all}[3] 0.097261 0.009935 0.000081 0.295138 0.066669 1.000 2
length{all}[4] 0.100653 0.010473 0.000018 0.299936 0.068499 1.000 2
length{all}[5] 0.102111 0.010372 0.000011 0.307042 0.071606 1.000 2
length{all}[6] 0.100652 0.009987 0.000069 0.297633 0.069335 1.000 2
length{all}[7] 0.095114 0.011177 0.000110 0.294142 0.064130 0.998 2
length{all}[8] 0.105752 0.011780 0.000030 0.324000 0.069236 0.998 2
length{all}[9] 0.092673 0.008837 0.000347 0.254706 0.068319 0.998 2
length{all}[10] 0.099661 0.008891 0.000451 0.298105 0.070673 1.008 2
length{all}[11] 0.102583 0.010813 0.000205 0.309864 0.072425 0.999 2
length{all}[12] 0.098013 0.009383 0.000228 0.287021 0.072314 1.003 2
length{all}[13] 0.103073 0.008873 0.000213 0.298148 0.076774 1.005 2
length{all}[14] 0.093611 0.009059 0.000082 0.299029 0.065618 1.001 2
length{all}[15] 0.097470 0.010070 0.000026 0.285781 0.065459 0.998 2
length{all}[16] 0.099729 0.010252 0.000076 0.293684 0.069950 0.998 2
length{all}[17] 0.102365 0.010426 0.000003 0.312096 0.071785 1.004 2
length{all}[18] 0.095000 0.007925 0.000549 0.260314 0.070243 0.998 2
length{all}[19] 0.107521 0.013874 0.000055 0.337694 0.067061 0.999 2
length{all}[20] 0.098510 0.008247 0.000667 0.273369 0.075931 0.998 2
length{all}[21] 0.099851 0.010916 0.000462 0.317287 0.066825 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006689
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 882
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
78 ambiguity characters in seq. 1
156 ambiguity characters in seq. 2
78 ambiguity characters in seq. 3
78 ambiguity characters in seq. 4
78 ambiguity characters in seq. 5
78 ambiguity characters in seq. 6
52 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 242 / 242 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 242 / 242 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103791 0.043258 0.034642 0.080411 0.037738 0.064276 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1053.973499
Iterating by ming2
Initial: fx= 1053.973499
x= 0.10379 0.04326 0.03464 0.08041 0.03774 0.06428 0.30000 1.30000
1 h-m-p 0.0000 0.0001 580.9023 ++ 1004.761831 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0027 81.9456 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 532.9654 ++ 1001.066353 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0087 64.1114 ---------.. | 2/8
5 h-m-p 0.0000 0.0000 476.3733 ++ 995.797401 m 0.0000 73 | 3/8
6 h-m-p 0.0002 0.0103 51.9556 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 412.2374 ++ 980.699492 m 0.0001 103 | 4/8
8 h-m-p 0.0008 0.0146 38.5171 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 337.2680 ++ 972.923000 m 0.0001 134 | 5/8
10 h-m-p 0.0007 0.0269 24.8333 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 238.6652 ++ 967.253643 m 0.0001 165 | 6/8
12 h-m-p 0.8847 8.0000 0.0000 ++ 967.253643 m 8.0000 176 | 6/8
13 h-m-p 0.1620 8.0000 0.0003 --------Y 967.253643 0 0.0000 197
Out..
lnL = -967.253643
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025227 0.108099 0.022287 0.026695 0.012891 0.097271 0.299949 0.707228 0.386477
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.636056
np = 9
lnL0 = -1034.984044
Iterating by ming2
Initial: fx= 1034.984044
x= 0.02523 0.10810 0.02229 0.02669 0.01289 0.09727 0.29995 0.70723 0.38648
1 h-m-p 0.0000 0.0001 557.9181 ++ 1017.407257 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 306.4058 ++ 1006.385182 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 331.9303 ++ 1004.087482 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 536.0862 ++ 1003.181021 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0003 376.3608 +++ 970.481312 m 0.0003 63 | 5/9
6 h-m-p 0.0000 0.0001 291.3315 ++ 967.253555 m 0.0001 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 967.253555 m 8.0000 87 | 6/9
8 h-m-p 0.0004 0.2009 4.7342 ---------Y 967.253555 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0016 +++++ 967.253553 m 8.0000 126 | 6/9
10 h-m-p 0.0405 2.5235 0.3163 -----------C 967.253553 0 0.0000 152 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253553 m 8.0000 170 | 6/9
12 h-m-p 0.0025 0.6249 0.5237 --------C 967.253553 0 0.0000 193 | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253552 m 8.0000 211 | 6/9
14 h-m-p 0.0030 0.5839 0.5478 --------C 967.253552 0 0.0000 234 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 ---------Y 967.253552 0 0.0000 258 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 967.253552 m 8.0000 276 | 6/9
17 h-m-p 0.0036 1.7982 0.6404 ------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253552 m 8.0000 319 | 6/9
19 h-m-p 0.0082 4.0766 0.2629 ---------Y 967.253552 0 0.0000 343 | 6/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253552 m 8.0000 361 | 6/9
21 h-m-p 0.0060 2.9856 1.0436 ---------C 967.253552 0 0.0000 385 | 6/9
22 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
23 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253551 m 8.0000 426 | 6/9
24 h-m-p 0.0082 4.0870 0.2629 -------------.. | 6/9
25 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253551 m 8.0000 470 | 6/9
26 h-m-p 0.0082 4.1173 0.2615 ---------C 967.253551 0 0.0000 494 | 6/9
27 h-m-p 0.0160 8.0000 0.0006 +++++ 967.253550 m 8.0000 512 | 6/9
28 h-m-p 0.0142 3.3465 0.3393 ------------Y 967.253550 0 0.0000 539 | 6/9
29 h-m-p 0.0160 8.0000 0.0072 +++++ 967.253536 m 8.0000 557 | 6/9
30 h-m-p 0.1542 2.8245 0.3746 ---------------.. | 6/9
31 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253536 m 8.0000 603 | 6/9
32 h-m-p 0.0103 4.7939 0.2404 -------------.. | 6/9
33 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253535 m 8.0000 647 | 6/9
34 h-m-p 0.0104 4.8112 0.2400 -------------.. | 6/9
35 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253534 m 8.0000 691 | 6/9
36 h-m-p 0.0106 4.8607 0.2381 -----------Y 967.253534 0 0.0000 717 | 6/9
37 h-m-p 0.0015 0.7343 0.3703 +++++ 967.253337 m 0.7343 735 | 7/9
38 h-m-p 0.8009 4.2080 0.2469 --------------C 967.253337 0 0.0000 764 | 7/9
39 h-m-p 0.0160 8.0000 0.0001 +++++ 967.253336 m 8.0000 781 | 7/9
40 h-m-p 0.0050 1.3824 0.2258 ---------C 967.253336 0 0.0000 804 | 7/9
41 h-m-p 0.0053 2.6584 0.0002 +++++ 967.253335 m 2.6584 821 | 8/9
42 h-m-p 0.0025 1.2341 0.1615 +++++ 967.253298 m 1.2341 838 | 9/9
43 h-m-p 0.0160 8.0000 0.0000 Y 967.253298 0 0.0160 851 | 9/9
44 h-m-p 0.0160 8.0000 0.0000 Y 967.253298 0 0.0160 863
Out..
lnL = -967.253298
864 lfun, 2592 eigenQcodon, 10368 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044360 0.107584 0.057981 0.092301 0.081243 0.060870 0.000100 1.257639 0.418797 0.110989 1.425587
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.738800
np = 11
lnL0 = -1061.637815
Iterating by ming2
Initial: fx= 1061.637815
x= 0.04436 0.10758 0.05798 0.09230 0.08124 0.06087 0.00011 1.25764 0.41880 0.11099 1.42559
1 h-m-p 0.0000 0.0000 469.7106 ++ 1061.341167 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 427.0855 +++ 1024.875506 m 0.0003 31 | 2/11
3 h-m-p 0.0004 0.0022 152.6408 ++ 983.961306 m 0.0022 45 | 3/11
4 h-m-p 0.0003 0.0013 193.3360 ++ 976.543040 m 0.0013 59 | 4/11
5 h-m-p 0.0000 0.0000 6922.8446 ++ 975.740410 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 804.7400 ++ 974.936257 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0001 11315.6786 ++ 970.772691 m 0.0001 101 | 7/11
8 h-m-p 0.0000 0.0001 4206.4178 ++ 967.253542 m 0.0001 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 967.253542 m 8.0000 129 | 8/11
10 h-m-p 0.0160 8.0000 0.3986 -----------Y 967.253542 0 0.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0007 +++++ 967.253542 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 7.2435 -----------Y 967.253542 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0004 +++++ 967.253542 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 3.9218 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 967.253542 m 8.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 0.4281 +++++ 967.253316 m 8.0000 287 | 8/11
17 h-m-p 0.7304 3.6519 0.8779 ++ 967.253299 m 3.6519 304 | 9/11
18 h-m-p 1.6000 8.0000 0.0904 ++ 967.253298 m 8.0000 321 | 9/11
19 h-m-p 1.1012 8.0000 0.6568 ++ 967.253298 m 8.0000 337 | 9/11
20 h-m-p 1.6000 8.0000 0.0299 ++ 967.253298 m 8.0000 353 | 9/11
21 h-m-p 0.8314 8.0000 0.2877 ++ 967.253298 m 8.0000 369 | 9/11
22 h-m-p 1.6000 8.0000 0.5989 ++ 967.253298 m 8.0000 385 | 9/11
23 h-m-p 0.1730 2.8297 27.6926 +Y 967.253298 0 0.6921 402 | 9/11
24 h-m-p 1.6000 8.0000 0.0000 Y 967.253298 0 1.6000 416 | 9/11
25 h-m-p 0.0160 8.0000 0.0000 N 967.253298 0 0.0160 432
Out..
lnL = -967.253298
433 lfun, 1732 eigenQcodon, 7794 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -967.298535 S = -967.254213 -0.017100
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:05
did 20 / 58 patterns 0:05
did 30 / 58 patterns 0:05
did 40 / 58 patterns 0:05
did 50 / 58 patterns 0:05
did 58 / 58 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017771 0.046604 0.083530 0.075980 0.069265 0.054840 0.000100 0.763714 1.134955
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.619723
np = 9
lnL0 = -1045.733201
Iterating by ming2
Initial: fx= 1045.733201
x= 0.01777 0.04660 0.08353 0.07598 0.06926 0.05484 0.00011 0.76371 1.13496
1 h-m-p 0.0000 0.0000 531.2273 ++ 1045.123715 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0049 80.0577 +++++ 1018.789941 m 0.0049 29 | 2/9
3 h-m-p 0.0001 0.0005 99.6322 ++ 1004.563786 m 0.0005 41 | 3/9
4 h-m-p 0.0002 0.0026 165.5553 ++ 981.620397 m 0.0026 53 | 4/9
5 h-m-p 0.0000 0.0001 372.0300 ++ 977.019179 m 0.0001 65 | 5/9
6 h-m-p 0.0002 0.0897 212.0387 ++
QuantileBeta(0.15, 0.00500, 4.16333) = 5.604646e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.92826) = 1.534087e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
+ 976.366317 m 0.0897 80
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93849) = 1.096950e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.93850) = 1.059947e-161 2000 rounds
| 6/9
7 h-m-p 0.0000 0.0001 20499.4248
QuantileBeta(0.15, 0.00500, 20.22056) = 1.044792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.06675) = 1.001819e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
+ 974.506244 m 0.0001 92
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 1.022770e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34882) = 9.882694e-162 2000 rounds
| 7/9
8 h-m-p 0.0028 0.0417 511.5698
QuantileBeta(0.15, 0.00500, 19.93849) = 1.059947e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.99623) = 1.005265e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.26067) = 9.924645e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.32677) = 9.893152e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34330) = 9.885310e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34743) = 9.883351e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34847) = 9.882862e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34872) = 9.882739e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34879) = 9.882709e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34880) = 9.882701e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 1.022770e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34882) = 9.882694e-162 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0001 218.4770
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
+ 967.253298 m 0.0001 126
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 1.022770e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34882) = 9.882694e-162 2000 rounds
| 8/9
10 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
Y 967.253298 0 0.0160 138
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
Out..
lnL = -967.253298
139 lfun, 1529 eigenQcodon, 8340 P(t)
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 21.34881) = 9.882699e-162 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030936 0.070292 0.084359 0.028715 0.031671 0.082337 0.000100 0.900000 0.722778 1.724139 1.299846
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.793449
np = 11
lnL0 = -1039.844659
Iterating by ming2
Initial: fx= 1039.844659
x= 0.03094 0.07029 0.08436 0.02871 0.03167 0.08234 0.00011 0.90000 0.72278 1.72414 1.29985
1 h-m-p 0.0000 0.0000 512.7833 ++ 1039.318891 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 171.8466 ++++ 1001.686672 m 0.0015 32 | 2/11
3 h-m-p 0.0000 0.0000 7374.0502 ++ 999.228983 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0002 53.5417 ++ 998.916369 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0008 311.9667 +++ 979.957708 m 0.0008 75 | 5/11
6 h-m-p 0.0007 0.0033 117.8960 ++ 968.765427 m 0.0033 89 | 6/11
7 h-m-p 0.0000 0.0000 100152.5718 ++ 967.253551 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 967.253551 m 8.0000 117 | 7/11
9 h-m-p 0.0099 4.9316 0.2249 -------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253550 m 8.0000 167 | 7/11
11 h-m-p 0.0079 2.7139 0.3010 ------------C 967.253550 0 0.0000 197 | 7/11
12 h-m-p 0.0076 3.7797 0.0588 +++++ 967.253443 m 3.7797 218 | 8/11
13 h-m-p 0.6299 8.0000 0.0936 -------------Y 967.253443 0 0.0000 249 | 8/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253442 m 8.0000 269 | 8/11
15 h-m-p 0.0018 0.9075 2.3699 ------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253442 m 8.0000 313 | 8/11
17 h-m-p 0.0033 1.6689 5.5757 ------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253441 m 8.0000 357 | 8/11
19 h-m-p 0.0160 8.0000 0.4155 -------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253441 m 8.0000 405 | 8/11
21 h-m-p 0.0160 8.0000 0.4136 -----------C 967.253441 0 0.0000 433 | 8/11
22 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253441 m 8.0000 481 | 8/11
24 h-m-p 0.0160 8.0000 0.4127 ------------N 967.253441 0 0.0000 510 | 8/11
25 h-m-p 0.0160 8.0000 0.0138 +++++ 967.253411 m 8.0000 530 | 8/11
26 h-m-p 0.2578 8.0000 0.4276 --------------C 967.253411 0 0.0000 561 | 8/11
27 h-m-p 0.0160 8.0000 0.0015 +++++ 967.253407 m 8.0000 581 | 8/11
28 h-m-p 0.0263 8.0000 0.4517 -------------.. | 8/11
29 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253407 m 8.0000 629 | 8/11
30 h-m-p 0.0160 8.0000 0.3375 -------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0003 +++++ 967.253406 m 8.0000 677 | 8/11
32 h-m-p 0.0160 8.0000 0.3341 ------------N 967.253406 0 0.0000 706 | 8/11
33 h-m-p 0.0160 8.0000 0.0002 +++++ 967.253405 m 8.0000 726 | 8/11
34 h-m-p 0.0022 1.1152 1.7845 ----------Y 967.253405 0 0.0000 753 | 8/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 967.253405 m 8.0000 770 | 8/11
36 h-m-p 0.0003 0.1464 3.3133 --------C 967.253405 0 0.0000 795 | 8/11
37 h-m-p 0.0160 8.0000 0.0000 ----N 967.253405 0 0.0000 813 | 8/11
38 h-m-p 0.0160 8.0000 0.0001 +++++ 967.253405 m 8.0000 833 | 8/11
39 h-m-p 0.0027 1.3279 27.2464 ----------Y 967.253405 0 0.0000 860 | 8/11
40 h-m-p 0.0160 8.0000 0.0000 ---Y 967.253405 0 0.0001 877 | 8/11
41 h-m-p 0.0160 8.0000 0.0000 +++++ 967.253405 m 8.0000 897 | 8/11
42 h-m-p 0.0017 0.8282 0.5377 --------N 967.253405 0 0.0000 922 | 8/11
43 h-m-p 0.0160 8.0000 0.0000 ----C 967.253405 0 0.0000 943 | 8/11
44 h-m-p 0.0160 8.0000 0.0000 ------Y 967.253405 0 0.0000 966
Out..
lnL = -967.253405
967 lfun, 11604 eigenQcodon, 63822 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -967.295883 S = -967.252618 -0.019143
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:24
did 20 / 58 patterns 0:24
did 30 / 58 patterns 0:25
did 40 / 58 patterns 0:25
did 50 / 58 patterns 0:25
did 58 / 58 patterns 0:25
Time used: 0:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=294
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
NC_002677_1_NP_302161_1_1033_ML1689 --------------------------MFARELAEYPFGELTFTGRSWPLA
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA
************************
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
NC_002677_1_NP_302161_1_1033_ML1689 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG
**************************************************
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
NC_002677_1_NP_302161_1_1033_ML1689 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS
**************************************************
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
NC_002677_1_NP_302161_1_1033_ML1689 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK
**************************************************
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
NC_002677_1_NP_302161_1_1033_ML1689 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI
**************************************************
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 TVEGIGTLTNPVVRKGKS--------------------------
NC_002677_1_NP_302161_1_1033_ML1689 TVEGIGTLTNPVVRKGKSoooooooooooooooooooooooooo
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 TVEGIGTLTNPVVRKGKS--------------------------
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 TVEGIGTLTNPVVRKGKS--------------------------
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 TVEGIGTLTNPVVRKGKS--------------------------
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 TVEGIGTLTNPVVRKGKS--------------------------
******************
>NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- -------------------------------- >NC_002677_1_NP_302161_1_1033_ML1689 -------------------------------------------------- ----------------------------ATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- -------------------------------- >NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- -------------------------------- >NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- -------------------------------- >NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- -------------------------------- >NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 ATGCGTCTTGGTCGAATATCTAGTCCAGATGGCGTCGCGTTCGTCAGCAT CGAAGGTGAGCCTGACGATCCCGATGGGATGTTTGCCCGTGAGCTCGCTG AGTACCCATTCGGCGAGTTAACCTTCACTGGCCGTTCGTGGCCATTAGCC GATGTCCGGCTACTGGCTCCGATGCTGGCCAGCAAGGTGGTCTGTATCGG TAAGAACTACGCCGATCATATCGTCGAGATGGGTGGCCAAACGGGACTAG CTTCGGCAGATCCGGTGATATTCCTCAAGCCCAATACCGCGATCATCGGG CCAAATGTTCCGATTCGACTGCCTGCCAACGCATCACCTGTGCATTTCGA GGGCGAGTTGGCACTCGTGGTGGGCCGGTCGTGCAAGGACGTCCCGGCAG TCCAGGCCGTCGACTGCATTCTCGGCTATACCATCGGCAACGACATGTCG GCTCGCGATCAACAACGCGCGGATGGTCAATGGACCCGCGCGAAAGGACA TGATACCTTCTGCCCAGTAGGGCCGTGGATCGTCACCGACCTCGGTCCCC TAGACCCAGCCGATCTTGAACTGCGAACCGCAGTCAACGGCGAAGTTAAA CAACACAGCCGCACCTCCCTGATGATTCACGGCATCGGTGCCATCATGGA GTGGATCTCGGCGGTAATGACATTGCTGCCCGGTGATCTCATACTCACCG GGACACCGGCAGGTGTTGGTCCCGTCGAAGACGGTGACATCGTTTCTATC ACTGTCGAAGGCATCGGAACTCTTACCAATCCCGTAGTCCGCAAAGGAAA GTCG---------------------------------------------- --------------------------------
>NC_011896_1_WP_041322908_1_1794_MLBR_RS08515 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS >NC_002677_1_NP_302161_1_1033_ML1689 --------------------------MFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS >NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS >NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS >NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS >NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515 MRLGRISSPDGVAFVSIEGEPDDPDGMFARELAEYPFGELTFTGRSWPLA DVRLLAPMLASKVVCIGKNYADHIVEMGGQTGLASADPVIFLKPNTAIIG PNVPIRLPANASPVHFEGELALVVGRSCKDVPAVQAVDCILGYTIGNDMS ARDQQRADGQWTRAKGHDTFCPVGPWIVTDLGPLDPADLELRTAVNGEVK QHSRTSLMIHGIGAIMEWISAVMTLLPGDLILTGTPAGVGPVEDGDIVSI TVEGIGTLTNPVVRKGKS
#NEXUS
[ID: 5477397897]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_041322908_1_1794_MLBR_RS08515
NC_002677_1_NP_302161_1_1033_ML1689
NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015
NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345
NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280
NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515
;
end;
begin trees;
translate
1 NC_011896_1_WP_041322908_1_1794_MLBR_RS08515,
2 NC_002677_1_NP_302161_1_1033_ML1689,
3 NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015,
4 NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345,
5 NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280,
6 NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06786675,2:0.06961336,3:0.0666687,4:0.0684991,5:0.07160649,6:0.06933475);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06786675,2:0.06961336,3:0.0666687,4:0.0684991,5:0.07160649,6:0.06933475);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1106.60 -1109.71
2 -1106.62 -1110.25
--------------------------------------
TOTAL -1106.61 -1110.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1689/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902344 0.091309 0.366325 1.506009 0.867860 1501.00 1501.00 1.000
r(A<->C){all} 0.156995 0.021234 0.000137 0.449806 0.115081 155.26 177.79 1.000
r(A<->G){all} 0.163070 0.020509 0.000001 0.454809 0.121956 134.81 155.01 1.008
r(A<->T){all} 0.176163 0.021032 0.000077 0.473190 0.138721 172.04 209.19 1.000
r(C<->G){all} 0.179897 0.023169 0.000019 0.493524 0.136077 117.66 145.14 1.013
r(C<->T){all} 0.166473 0.020390 0.000065 0.457806 0.127109 243.42 243.47 1.000
r(G<->T){all} 0.157404 0.019185 0.000016 0.433750 0.120092 199.10 233.78 1.000
pi(A){all} 0.210563 0.000196 0.182713 0.237316 0.210304 1147.97 1324.49 1.000
pi(C){all} 0.293083 0.000243 0.261543 0.323617 0.292994 1298.20 1331.63 1.000
pi(G){all} 0.283488 0.000232 0.253127 0.311714 0.283530 1149.31 1325.15 1.000
pi(T){all} 0.212866 0.000213 0.183851 0.240751 0.212429 1481.91 1484.28 1.000
alpha{1,2} 0.432584 0.242686 0.000191 1.407645 0.260065 1268.24 1367.71 1.000
alpha{3} 0.477940 0.252583 0.000206 1.478824 0.322442 868.70 1053.03 1.001
pinvar{all} 0.998156 0.000005 0.994038 1.000000 0.998873 1084.59 1093.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1689/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 242
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2
CTC 7 7 7 7 7 7 | CCC 5 5 5 5 5 5 | CAC 2 2 2 2 2 2 | CGC 5 5 5 5 5 5
CTA 3 3 3 3 3 3 | CCA 5 5 5 5 5 5 | Gln CAA 5 5 5 5 5 5 | CGA 2 2 2 2 2 2
CTG 6 6 6 6 6 6 | CCG 6 6 6 6 6 6 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 12 12 12 12 12 12 | ACC 10 10 10 10 10 10 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 1 1 1 1 1 1 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 4 4 4 4 4 4 | Asp GAT 8 8 8 8 8 8 | Gly GGT 9 9 9 9 9 9
GTC 11 11 11 11 11 11 | GCC 8 8 8 8 8 8 | GAC 7 7 7 7 7 7 | GGC 10 10 10 10 10 10
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 4 4 4 4 4 4 | GGA 4 4 4 4 4 4
GTG 5 5 5 5 5 5 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_041322908_1_1794_MLBR_RS08515
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
#2: NC_002677_1_NP_302161_1_1033_ML1689
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
#3: NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
#4: NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
#5: NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
#6: NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 30 | TCC 6 | TAC 12 | TGC 18
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 36 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 12
CTC 42 | CCC 30 | CAC 12 | CGC 30
CTA 18 | CCA 30 | Gln Q CAA 30 | CGA 12
CTG 36 | CCG 36 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 0
ATC 72 | ACC 60 | AAC 24 | AGC 12
ATA 12 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 42 | ACG 6 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 24 | Asp D GAT 48 | Gly G GGT 54
GTC 66 | GCC 48 | GAC 42 | GGC 60
GTA 18 | GCA 36 | Glu E GAA 24 | GGA 24
GTG 30 | GCG 24 | GAG 42 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12397 C:0.23967 A:0.23554 G:0.40083
position 2: T:0.30992 C:0.26860 A:0.22727 G:0.19421
position 3: T:0.19421 C:0.38843 A:0.17355 G:0.24380
Average T:0.20937 C:0.29890 A:0.21212 G:0.27961
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -967.253643 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299949 1.299846
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322908_1_1794_MLBR_RS08515: 0.000004, NC_002677_1_NP_302161_1_1033_ML1689: 0.000004, NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015: 0.000004, NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345: 0.000004, NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280: 0.000004, NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29995
omega (dN/dS) = 1.29985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 543.2 182.8 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -967.253298 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322908_1_1794_MLBR_RS08515: 0.000004, NC_002677_1_NP_302161_1_1033_ML1689: 0.000004, NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015: 0.000004, NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345: 0.000004, NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280: 0.000004, NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -967.253298 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322908_1_1794_MLBR_RS08515: 0.000004, NC_002677_1_NP_302161_1_1033_ML1689: 0.000004, NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015: 0.000004, NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345: 0.000004, NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280: 0.000004, NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322908_1_1794_MLBR_RS08515)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -967.253298 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 21.348810
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322908_1_1794_MLBR_RS08515: 0.000004, NC_002677_1_NP_302161_1_1033_ML1689: 0.000004, NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015: 0.000004, NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345: 0.000004, NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280: 0.000004, NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 21.34881
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 550.5 175.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -967.253405 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.230367 1.830253 1.444320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322908_1_1794_MLBR_RS08515: 0.000004, NC_002677_1_NP_302161_1_1033_ML1689: 0.000004, NZ_LVXE01000025_1_WP_041322908_1_1034_A3216_RS08015: 0.000004, NZ_LYPH01000028_1_WP_041322908_1_1116_A8144_RS05345: 0.000004, NZ_CP029543_1_WP_041322908_1_1822_DIJ64_RS09280: 0.000004, NZ_AP014567_1_WP_041322908_1_1869_JK2ML_RS09515: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.23037 q = 1.83025
(p1 = 0.00001) w = 1.44432
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00012 0.00110 0.00477 0.01428 0.03460 0.07337 0.14335 0.27013 0.53433 1.44432
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
7..2 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
7..3 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
7..4 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
7..5 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
7..6 0.000 550.5 175.5 0.1076 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322908_1_1794_MLBR_RS08515)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:25
Model 1: NearlyNeutral -967.253298 Model 2: PositiveSelection -967.253298 Model 0: one-ratio -967.253643 Model 7: beta -967.253298 Model 8: beta&w>1 -967.253405 Model 0 vs 1 6.900000000769069E-4 Model 2 vs 1 0.0 Model 8 vs 7 2.1400000014182297E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
